From nobody Tue Nov 16 21:30:03 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 0A4C918A5BBF for ; Tue, 16 Nov 2021 21:30:23 +0000 (UTC) (envelope-from uspoerlein@gmail.com) Received: from mail-wr1-f43.google.com (mail-wr1-f43.google.com [209.85.221.43]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Htzk571h5z4VYn for ; Tue, 16 Nov 2021 21:30:21 +0000 (UTC) (envelope-from uspoerlein@gmail.com) Received: by mail-wr1-f43.google.com with SMTP id n29so377826wra.11 for ; Tue, 16 Nov 2021 13:30:21 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=03kqhGI4iHpT+rf8Y4drppy2EJlBKvgzASyDkKsRdvc=; b=GiUlgCvAYpaQhK1+aWnQ8SOmoaUSH2H/phiLIS361SDC3Z6LdBB0HEHmGZaSR6NsIB bZo/m2Q7tIg4E1jjdQ8YIBQq1QKngwOcB9Xgqhvl8g/dyjl+34CxcRzbE04Jh+mLeYSd dLKmpfNsL20/dS3VF9OHKkB4tuTjdhfzi7J5O3mVAaNqcnHwd3cVoHIJ1D0JW86qp+Ql Mrhyy63uD8yHty3HjbKNb1Mhd8CIC6c7c+OppO8dwLx4Wbvjms+QzmSBKewfaPDsYY7T ddQ9dkNG9h4hQm1sEmX9FVtgZGcpLtYsMXOPCe9Se/KDFlZU42saFaB5L8Cia8eMtYC8 +ZWg== X-Gm-Message-State: AOAM533CFH8FyXjGtHBnigkbfyJyE4l2LbAT8tOlpiuFVj7dp0ycl9JA ncZOKSAnErbHdI+cB8xEvf11abFprpjI3pAD8RAoa8Zm X-Google-Smtp-Source: ABdhPJw7Hk/5GA9TSrW2hgIcmH8dm0Gt7BQ4kERLCdPCDF84hYaML3Oir+6H9sijcC8zf7hXqb3ZRl5INqcnnWwCy0s= X-Received: by 2002:a05:6000:82:: with SMTP id m2mr13138306wrx.202.1637098215316; Tue, 16 Nov 2021 13:30:15 -0800 (PST) List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> In-Reply-To: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> From: =?UTF-8?Q?Ulrich_Sp=C3=B6rlein?= Date: Tue, 16 Nov 2021 22:30:03 +0100 Message-ID: Subject: Re: cgit, ages and chronological order To: Graham Perrin Cc: freebsd-git@freebsd.org Content-Type: multipart/alternative; boundary="000000000000961f2005d0eea15b" X-Rspamd-Queue-Id: 4Htzk571h5z4VYn X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of uspoerlein@gmail.com designates 209.85.221.43 as permitted sender) smtp.mailfrom=uspoerlein@gmail.com X-Spamd-Result: default: False [1.62 / 15.00]; RCVD_TLS_ALL(0.00)[]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:209.85.128.0/17]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-git@freebsd.org]; DMARC_NA(0.00)[freebsd.org]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; NEURAL_SPAM_SHORT(1.00)[1.000]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[209.85.221.43:from]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[uqs@freebsd.org,uspoerlein@gmail.com]; RWL_MAILSPIKE_POSSIBLE(0.00)[209.85.221.43:from]; R_DKIM_NA(0.00)[]; R_MIXED_CHARSET(0.62)[subject]; ASN(0.00)[asn:15169, ipnet:209.85.128.0/17, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FROM_NEQ_ENVFROM(0.00)[uqs@freebsd.org,uspoerlein@gmail.com]; RCVD_COUNT_TWO(0.00)[2] X-ThisMailContainsUnwantedMimeParts: Y --000000000000961f2005d0eea15b Content-Type: text/plain; charset="UTF-8" On Wed, Nov 10, 2021 at 7:03 AM Graham Perrin wrote: > , for > example, is it normal for results to _not_ be in chronological order? > > (Has it always been so, have I never noticed?) > > Maybe this was fixed in the meantime, but I see a chronological result page under that link. Cheers Uli --000000000000961f2005d0eea15b-- From nobody Tue Nov 16 22:32:52 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 234B6189C7B5 for ; Tue, 16 Nov 2021 22:33:07 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic310-22.consmr.mail.gq1.yahoo.com (sonic310-22.consmr.mail.gq1.yahoo.com [98.137.69.148]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hv16V6CMfz4sWL for ; Tue, 16 Nov 2021 22:33:06 +0000 (UTC) (envelope-from marklmi@yahoo.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637101979; bh=hPmxH4o1XgVuHJQFXZa++wkC3505jAZIuh/Bc2mAVaA=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=ENo49zjRjho4IznboVj4F1RSPrJMU1pkkV6pwWwc0MiBf3IvfSbuhUN9x8AQ9uU1FJPKHGcFP59M5EpGcYtjroZuV4qWd++67FdLnn8m/ZvmCIyuj+gYfTCdiQTz36LZ4adTQVbXrE3g/CGVUtIXOZmWqXeiXDwZV/Z2yzKg1QIAcNxOgFqZ0tO0cA+Ng28bt8r1S+a9Woys5cgza4sQM7L8FiANruligtTs36nT5lpwkbnSYl7Rbel4olMLl4eFFNPEAEBLx9GKr6q7xNW7hTd2SMDMwAzBVfK4WS9/oFk7LpYm5f1EOXHMyH6mibGxDeGmD3vU+ZVcSk8oaq469Q== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637101979; bh=QEtp6Hr2N7pUGvrTt+7UbSPYmJ+F88E1k0emir4hd7g=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=GTqmJ3GnW2Sh1NhlhvbhGamJkaDkqWOHqc2gU3GKQnjd2itxB6xSS+hoahsub6siX46teE4OgwQnf/ALh6bs14316pCviAJvVkP2LyNWtotW284ROCx1ybYjmdbR5s6X1AYnzonOGQ1cnBFI58DLBWxRP0m894m08l4muixBFTH/KUMs2NMCY/HkSYUGaFu+kIxKSwmqKu56TjtVUx3mi789nCMUkIxNu7swJcGapFrictgQrjFV587DKQEmEsls8ZvYYmPCJsufAsVCJnEqz6d+7aEqR7UXe4M1EKZJKrwc3VmPG76zlOH8aTFghRUbjsn2QZokXk9cwceF9KeZIA== X-YMail-OSG: I02QWZoVM1ns8rGyG6yNW2BOY.FYshC51.8c7hYhnZe8hhSUsE2aLVx3uMMWGrL LAYICua5bpa2BF.63t7Hjv09G8d3BU7RBFZfzCwhzpwjqNLnaR_k0QjUwdJ4a7k7SasVF9nEmCmQ r1pgJnlFRRUWAbKwEhOPAdTl1FlV5dgt53NhndnTT67CRPZKo33kQJ8VZa406c2b.Em6mUQwSCe5 UI1AxsGduM1v0MHFJj_dD74RCzp.wrfeEmE4EVq5sS10Mn1gpW5jmk1SwO8NY_Q0dbNIe8VcSA.k mT5vv_.nBYyM83yXE.zXhMqFogWABMYb0dWhDe4WOmvrkfj0HPfHtUDzmWRWdfbioOCnG5K3lIcb JTYyN1GykU07O9DSE7IlIK9MsSa0VYC_4i6UKyMIXfSb1PoH4u4UItzKqke_7U0wptPyAy2GQih8 df2mprGbEZprO5QkGyaR9LVqVe_gM1BSOdUyeeeYRdcrmqtCEViPYX2n9OKKE4PbIFATcM0lWxyQ OrVCeH_fVFl_cnZIEeIyczAYy7AB951kRKx6x6_RcF6pH4RBLQl842iFi.8HRjoxuk8vTHm4Ji0w hcWVnEm3MYtaKhWBPeVsZtHO71TfYJ5wGN6u8ZHqC74SIqtlNROq6J3c_60SLdh6B1oqLnwMh2_S hWHRchRangolCt4C0AgRbWgey.oo0I7.3MNaOtsBEZ7I0Tt2ObDsE_vmbbWycImmbHGdsM0dogGp qmTXAia.l2oX.a9GoWNgnikadaYvvONnZFBLDxRoG9wKBJ.NKJza4xMzP0jcMwTcK9fEO02bL9zp tiJsuY6CUSUQdF20sq6Db6pYIvHZEYxe.4K4vf9BrJmhdNYl_Gq7zpKdbW1.ZBB3ucHvdmez9amV PjcSLXaf8Nk.plhydQwhJl7Gunbk1FItrfkFsBi26se4mbEXZeGSc6HqB1CC33JMTA342nMYoRQU dRmcaroSIkyV3P3nILx.FVjcUSFWhthFNlZaaq.2.I_FewQ18hUAAlpuhxgYjtdeHTUoqc2wVnMx TYFJlA90oKM.Ys0DDpLx7_28Z9u20s1E1fyJZGjaCEQgwoCfyGbze0lVJilhoQaDJIxW3iOjilX3 r.EDdlDWBWWr7ky4Hf5lpo4X3POXu9dtLUuLL5wr7GIUxiIDSp.PXV4SzkcN1L.WzBPIU6l7gqzZ vzpRJi5XesYZ9x8E7vONZho1PQG9NcYIro6Z4zPG9oPD6EeC3vpXkLQT9T8cTdkM0ldKLG.ZLzwM 9Wofsd6FZ04eVeXySQ.WjDODVhMVYqHRlghI1BTDqVoSVEKZ.rMU52v1gg3bRYR7FPrktcrBiDll .Ywm_Qif6a20Vg3AtJQrp8.SX6ZU_rR5pY0uuipN7GnITQlIhc8wGH9cd0Lqhadc5jXThWBlZb1z 3bS5OTzZ48NRwH8Mfr6pGD0o.VD.fcDPCSfkBNCNYPIbZdM0Aw.g7DnjMxHtUpEL3662_75FqJYR oPY3mZ9emZ..Lk5GSjhwXn0IBhItCt2gcQ27ygoMq38BG.UK2uI5ByDyjqsJL4JYgkd.Z4udQEZT FHH33pM20xcZXp_NYJTPK5mqbYnQKsOZ8SW89uj8OWO31K.iEYP1AfGNjIZCHSbQdBQ2mAm.oiiO hMhzuKncp.xmSVuDqazhofVPEV2M6.PbTgl1zeVkyICSdZhTZkW5oS5oS6q0P8ys3Uxsa_0YoR9a XyXmMutMktiIrb_h9RyLVMh3JMmj0kT5WC6lRRxlQHh1lmtL2I6SEEg_eeb2dBF04x7GCNz4VVUx IQdto8vRmfWbhx4Th5gICRnDJowiKPQ_uWEs4WIyjnjXK3IFKLXccdHcT7J3KE2u1an.c_xVVnoz krVaMi7ETr9Ubj4V9zlsAdg3_YLF0jECqgWpocBqUIjHKC8huLocqImXvfn1bKC3KGUNjZjMCMuI 5wgcPtn9fJlZEMNnY7EJ5TJbnax.X.SgOWMcbF2NuTA0JZzchAogbxCHRg1eGegh.0P4jju6ZJnJ bOIdZYQ.yYhi5pvPiClpi84aJwoGxTLgQXZRRdjlfGWoAmVEeKpf8gB75LRtDBAuYOaclscEgrnc yBfVOp6RspjR6dG23JaR4qr8VRSwG15j102yA30HWE1FhSLEsIZADu3.RW8V5Jh7NgSafa3sE6vi hYIfZxrMAMkUsaWbxKone8FOaj7IB.kdDwnz8YEvimZfl_sw53W.bhDb5mL4AObknhfXKE_VVfAo GGnwIHnVETjb1RjgiVuvPkWPJa_xxieBq9hNRjMQrG.OV.ml2Hs.j1YT9bYhz1PkUCK863thRvnE Rg3wtQ8x28GD7NA8Zfa3a5LT1TRGYQKGevhBdbbqJ3KkWpJWheJe6F0gJDq7VQgZR8c1xzULra1T SN325ZFY- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic310.consmr.mail.gq1.yahoo.com with HTTP; Tue, 16 Nov 2021 22:32:59 +0000 Received: by kubenode520.mail-prod1.omega.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 5a74ce035da8d146dfb0fee6f77f9ecb; Tue, 16 Nov 2021 22:32:54 +0000 (UTC) Content-Type: text/plain; charset=utf-8 List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: cgit, ages and chronological order In-Reply-To: Date: Tue, 16 Nov 2021 14:32:52 -0800 Cc: freebsd-git Content-Transfer-Encoding: quoted-printable Message-Id: <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> To: =?utf-8?Q?Ulrich_Sp=C3=B6rlein?= , Graham Perrin X-Mailer: Apple Mail (2.3654.120.0.1.13) X-Rspamd-Queue-Id: 4Hv16V6CMfz4sWL X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] Reply-To: marklmi@yahoo.com From: Mark Millard via freebsd-git X-Original-From: Mark Millard X-ThisMailContainsUnwantedMimeParts: N On 2021-Nov-16, at 13:30, Ulrich Sp=C3=B6rlein wrote: > On Wed, Nov 10, 2021 at 7:03 AM Graham Perrin > wrote: >=20 >> , = for >> example, is it normal for results to _not_ be in chronological order? >>=20 >> (Has it always been so, have I never noticed?) >>=20 >>=20 > Maybe this was fixed in the meantime, but I see a chronological result = page > under that link. >=20 https://cgit.freebsd.org/src/log/ shows (an example of hours, then days, then hours again): Commit message (Expand) Author Age Files Lines . . . * nfsclient: upgrade vnode lock in VOP_OPEN()/VOP_CLOSE() if we = need to flush b... Konstantin Belousov 5 hours 1 -0/+42 * Fix two more nits from 0mp George V. Neville-Neil 6 days = 2 -4/+5 * Address review comments from 0mp, debdrup and oshogbo George = V. Neville-Neil 6 days 3 -17/+18 * Initial clean up the language in the manual pages. George = V. Neville-Neil 6 days 3 -66/+75 * loader: Do not force comconsole for arm and arm64 Emmanuel = Vadot 13 hours 1 -1/+1 . . . But as far as I know this is just the (looking at "Fix two more nits = from 0mp"): author George V. Neville-Neil 2021-11-10 = 17:51:42 +0000 committer George V. Neville-Neil = 2021-11-10 18:09:19 +0000 information being based on local git commit timing (and clocks) vs. when the commits are pushed to FreeBSD servers: The display order is from the timing on the FreeBSD servers but the Age is based on the original commit (before the push). The longer the delay between commit and push, the more noticeable the distinction is. =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From nobody Wed Nov 17 03:37:04 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id C67AF18A7E99 for ; Wed, 17 Nov 2021 03:37:10 +0000 (UTC) (envelope-from pauamma@gundo.com) Received: from mail.gundo.com (gibson.gundo.com [75.145.166.65]) by mx1.freebsd.org (Postfix) with ESMTP id 4Hv7sL504fz3j1L; Wed, 17 Nov 2021 03:37:10 +0000 (UTC) (envelope-from pauamma@gundo.com) Received: from webmail.gundo.com (variax.gundo.com [75.145.166.70]) by mail.gundo.com (Postfix) with ESMTP id 4620B4C14E9; Tue, 16 Nov 2021 21:37:04 -0600 (CST) List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Date: Wed, 17 Nov 2021 03:37:04 +0000 From: Pau Amma To: =?UTF-8?Q?Ulrich_Sp=C3=B6rlein?= Cc: Graham Perrin , freebsd-git@freebsd.org Subject: Re: cgit, ages and chronological order In-Reply-To: References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> User-Agent: Roundcube Webmail/1.4.8 Message-ID: X-Sender: pauamma@gundo.com Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4Hv7sL504fz3j1L X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: N On 2021-11-16 21:30, Ulrich Spörlein wrote: > On Wed, Nov 10, 2021 at 7:03 AM Graham Perrin > wrote: > >> , for >> example, is it normal for results to _not_ be in chronological order? >> >> (Has it always been so, have I never noticed?) >> > Maybe this was fixed in the meantime, but I see a chronological result > page > under that link. The first line is out of order for me, but the rest is: * Remove parameter names from libzfs.h signatures Nick Black 2020-01-09 1 -7/+7 * Remove more terminfo entries after 16d3faad099a Dimitry Andric 2021-03-26 1 -0/+30 * obsoletefiles: also remove the terminfo directory along with the db Baptiste Daroussin 2* Remove terminfo manpage we don't have it Andrey A. Chernov 1997-10-20 3 -1660/+4 * terminfo_extensions.doc: John-Mark Gurney 1997-04-07 2 -182/+193021-03-26 1 -0/+1 * Revert "bootstrap: add tic to the bootstrap tools" Baptiste Daroussin 2021-03-18 1 -5/+0 * terminfo db: add entries for the terminfo database removal Baptiste Daroussin 2021-03-18 1 -0/+2824 * Revert "terminfo: add terminfo database" Baptiste Daroussin 2021-03-18 2 -35/+0 * terminfo: add more path to lookup for the database Baptiste Daroussin 2021-03-18 1 -1/+1 * terminfo: add terminfo database Baptiste Daroussin 2021-02-25 2 -0/+35 And so on back to: From stsp@stsp.name Wed Nov 17 09:40:35 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 20B16183AD91 for ; Wed, 17 Nov 2021 09:40:44 +0000 (UTC) (envelope-from stsp@stsp.name) Received: from einhorn-mail-out.in-berlin.de (einhorn.in-berlin.de [192.109.42.8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mail.in-berlin.de", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvHwq6Ky9z3PwS for ; Wed, 17 Nov 2021 09:40:43 +0000 (UTC) (envelope-from stsp@stsp.name) X-Envelope-From: stsp@stsp.name Received: from authenticated.user (localhost [127.0.0.1]) by einhorn.in-berlin.de with ESMTPSA id 1AH9eZ3F016703 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NOT); Wed, 17 Nov 2021 10:40:36 +0100 Received: from localhost (benson.stsp.name [local]) by benson.stsp.name (OpenSMTPD) with ESMTPA id 79ad8308; Wed, 17 Nov 2021 10:40:35 +0100 (CET) Date: Wed, 17 Nov 2021 10:40:35 +0100 From: Stefan Sperling To: marklmi@yahoo.com Cc: Ulrich =?iso-8859-1?Q?Sp=F6rlein?= , Graham Perrin , freebsd-git Subject: Re: cgit, ages and chronological order Message-ID: Mail-Followup-To: marklmi@yahoo.com, Ulrich =?iso-8859-1?Q?Sp=F6rlein?= , Graham Perrin , freebsd-git References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> X-Rspamd-Queue-Id: 4HvHwq6Ky9z3PwS X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: N On Tue, Nov 16, 2021 at 02:32:52PM -0800, Mark Millard via freebsd-git wrote: > author George V. Neville-Neil 2021-11-10 17:51:42 +0000 > committer George V. Neville-Neil 2021-11-10 18:09:19 +0000 > > information being based on local git commit timing (and clocks) > vs. when the commits are pushed to FreeBSD servers: The display > order is from the timing on the FreeBSD servers but the Age is > based on the original commit (before the push). The longer the > delay between commit and push, the more noticeable the > distinction is. This is not how Git works. If the server changed the timestamp then it would also have to rewrite the commit object and change its hash. Git's server will only ever store objects as they arrived on the wire. Rather, both timestamps were created locally. The above looks as if the author used git-rebase or similar on their own commits. Some Git commands will update the committer field but leave the author field as it is. These fields contain email address and timestamp. Generally, sorting commits by committer timestamp will give the order most people would expect. Unless some client has an unsynced clock, and nothing can be done about that without a hypothetical smarter server and client which support server-side rewriting of commits during push. From nobody Wed Nov 17 16:17:33 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 5C7DB1896611 for ; Wed, 17 Nov 2021 16:17:42 +0000 (UTC) (envelope-from glebius@freebsd.org) Received: from cell.glebi.us (glebi.us [162.251.186.162]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "cell.glebi.us", Issuer "cell.glebi.us" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvSks6Vn0z3tNN; Wed, 17 Nov 2021 16:17:41 +0000 (UTC) (envelope-from glebius@freebsd.org) Received: from cell.glebi.us (localhost [127.0.0.1]) by cell.glebi.us (8.16.1/8.16.1) with ESMTPS id 1AHGHX2q021125 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Wed, 17 Nov 2021 08:17:33 -0800 (PST) (envelope-from glebius@freebsd.org) Received: (from glebius@localhost) by cell.glebi.us (8.16.1/8.16.1/Submit) id 1AHGHXeF021124; Wed, 17 Nov 2021 08:17:33 -0800 (PST) (envelope-from glebius@freebsd.org) X-Authentication-Warning: cell.glebi.us: glebius set sender to glebius@freebsd.org using -f Date: Wed, 17 Nov 2021 08:17:33 -0800 From: Gleb Smirnoff To: marklmi@yahoo.com, Ulrich =?iso-8859-1?Q?Sp=F6rlein?= , Graham Perrin , freebsd-git Subject: Re: cgit, ages and chronological order Message-ID: References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4HvSks6Vn0z3tNN X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; local_wl_from(0.00)[freebsd.org]; ASN(0.00)[asn:27348, ipnet:162.251.186.0/24, country:US] X-ThisMailContainsUnwantedMimeParts: N On Wed, Nov 17, 2021 at 10:40:35AM +0100, Stefan Sperling wrote: S> Generally, sorting commits by committer timestamp will give the order S> most people would expect. Unless some client has an unsynced clock, and S> nothing can be done about that without a hypothetical smarter server and S> client which support server-side rewriting of commits during push. Don't agree with that. When you rebase or amend, original timestamp doesn't change. A commit can sit for month in reviews & testing, can morph to a quite different code and still preserve old timestamp. Then it is finally pushed and most people (well, at least myself) find the timestamp that arrived to official git quite misleading. I already have had problems with that doing "eye bisecting" - looking through history and searching for a commit that could have caused a regression. -- Gleb Smirnoff From nobody Wed Nov 17 16:40:30 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 3E6F51854C6F for ; Wed, 17 Nov 2021 16:40:47 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic309-21.consmr.mail.gq1.yahoo.com (sonic309-21.consmr.mail.gq1.yahoo.com [98.137.65.147]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvTFV6NsXz4Z1Z for ; Wed, 17 Nov 2021 16:40:46 +0000 (UTC) (envelope-from marklmi@yahoo.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637167239; bh=MG/SKlqoejjybu8t608TDtf9JlvtezsPTV4JtmuR3tg=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=YiIaQ5S4H5UPA4FaPM4csw6zzUKxkXN+7ZPnfcn4wYuBj4WdRwH2iOOAeYhRdUfEcVLLh3Uj99E0PVLn9ufOzkt+CCZqb+aQW8ardieViaiE2Q3O/2DyWZQcR76k99t35bd/H8leA/rEV4Ic8PMc9uj8tF1D6H2Xlv4jmLYNU3S7t52fE3OcmmjklZ+Sw4eIMvIjqfAIAtrp8fSzWbL8mUYn6xWxHwmlnRC79yGR0ByV9kfJmds4DbgpcmEB+VwqhulZe7vgAIZhVWvJU7BYu66C2ZyXD6j8rngmDxG53xn4rp9M/4lGyF6C/kpQx9ACpuq3nupy/qHLGjfYZQPtww== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637167239; bh=3gRJTopYxFK4EtgsdIIHpx2SQ7Fmon8QCmszEynrxxM=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=IHOW9HUDq2lqAk6Zk40CCPSWjE9UUjPR9fTsA8Y01ZpznoCHcw8kzTfE/qUoSEpVb8Rqdn0aed4Y08q7GHiNjGA/E3xaDbP50n8PtizvXXa3xZefyPgB1bZyBFVUCT9q9BDyCediyDWtQgjpXwPxPhIQF8aemIBryWsDqq4LD4nHeC4Z8AsfYonSbi3BO95HuY9CdDmrhSPbSckXFwZwqoYWOC1Lc2WssE5UAUsbbaQFz5QvqqXJDoTsJkszoeLg3n3kTbhx/2YHENxOlhj4aZrsngio1qcB8glJnwl/y6ObC9p3f5Dlm49pM1CwEQHaKQqjpYow6PxuF25nbfI2kQ== X-YMail-OSG: QozCfMYVM1m3k8Ysj6vj3HtgzaWP7B.jb3ftNVruwIp01yWUMFBxuu0WG.oJuwE hNHZhSRla0MYj0BILhtXh48XjkTNMnDOimsRz0fxRDZZXJ3pztZUCUJB6y_Fltt.Xnt9xHq_kzk2 vh7k._txtnmTntb_Xa6vOrfD5qhn5Q51fvPdWEcXdA_R07L3Em_H1woAwQuzjiTq9K5_J9pGiJYb EcGUw1gbrLh34FxLd4dgljMz1MD1bFx5wm_q863Iw65aPmRZ50AEoBGV1tGCOioY1DphuUbXV8i1 I_km3glSZuI44RJndAmPWpc7b90CKGLwI8m496lYRXAF.MTVUXsV_EcE_b5_nigAhUnJdwxMTVzO M2NPT5.Y7E1sjthRqcZpm3pgkVyBSWTxjn.SqpIqubiGQR45972YPXlWRGL4woRO1l52cE5rlMJj WfTY9CmpDBaRA1oECNY5nLN5Kl7NEAjhIEISJxFbNSOfpLm5zmG9e4WE7rzqpTC55ml1Q8I3HX7p jo5NpRLseaj8LyC0dqU9SY54lznxymWWTa5YiYwxafzt84FiwIpVU2IGAle.e845CSGQuVgStqK1 VWRSbQf9RyDYhBq8Fl666pOlFTXyzuzKzeF2kcz4rV4W7ikAkBWAassE734Xz6BwkFz.L02LHCnA fFfUCf2voSxtFJWygsP_sTrcf0MJ_S3SYd5rujuJVwhgJFMIDbaYmS7xPTW6Npw0FEZPSQ55ypSQ GgdcFHZkH049VOmBi0mYnpKow5KET0_FHCDMo5I68yWXP2UTV4bBpP.oGnBrV40trnIkeJ9ooxxt UDdN8orpgznqshxCvdknGaD8flYoLx05gjudq.wTAWSpSO4dflohDiTJ4dEJBmaZIkWKtV1tNJ_L voZuUxlLqUDBgpDRw7A7Q535ajLLsjzVEFmq1qATfQF6GfDAtcCxpEaRPsyb_jlbVojP_bJZYug2 cdqo2S1C_HA.bMuvX3V9jWsNSjTID3SLHpnAQOEVdVRonqRB_esfdnjevR4Yi3AjkRozP8W4lHuK gQmnAGCXrGuYo1tSQdZuK5DJ49Tn0iAgKA2zxKTqfJpw1tP7ofnS_wFjo0j1lJ1HtjTCFsiWEwWE QuKMmtCRuxzdFCtNhgZvkjmrdpJBz4Osn41UvIy9mC4l.63Yq5DKFSFyM3f1BzHA2_l923mDGmYD CUtKkB2tdebHEzwFQmurPprTuc0raYS2TgXg3djhWMHr426TUzrEjV_yM9FaC7AyOZXt_Oe5PQ9Q HHX47F55FfuvyyJtJYB6JOswHZTcUjGAtRmmPfvfD8me673whyA64O2YI_YCa0oIkWcBlx.OjAOE OHdOtTyACbj57CmGZxcYOzaKNzlWCOI4Fg5ybZmciu8Vg.8KIjwp3UBg99DmshLrAzQFSfxgsGdJ fSLCnl774htj6Ylejf.6AyTRZR6ZpTiGHhIP646.yU0WFpP6B0RUMLmOyUTtovmUOJrinFCxsCr7 _UjgUKy1VWOH_UeI6fCvLiOpmaaAcgGorQTLvvknoW8GbpUyctTy.eKfYKlUEOEcFHGO53uQKA8g 43bLRuYYazWlTgjlS15rfXRpPkfav4mmkFuDpkISDdIj5cRyGwnn_BDikQ7xE5MdMp8LIyrw0i7G 4PxybS_MkdhNnUNU9BHUF9go.gkAaBZOC4iboZxdFQ9bAvzACY56mPxnTPj9Gfwgsnf_XMHrBad5 hYMqwgM4eOTKoGs45uqxuEewWFXBVzCWORzjviKNro.N7lUowEqwIe3nJ6etWVYon7b18_iYGlDH lDNQz3UbUjvNIRp0HUWrOwkpyyHjlv.UdqzlvWV_gk4NG8kNyB.hIJanpZyCLAv72fMfztDczpPS KOAlIol.7_lp.pqlk.0F.tPBZk1WJYWeppn.Xha9GsMDm7SEvzV_wjjMFFvKS5HRskr5CcWcUUBw bODg1ZQuBwU1nN_3A_qOrE7GlGWeQntGKZ9wdbogVfyOfA3wQFNHiZ_rVal1FhWIj9HYjEt1BvGz Osa9Dq9ShhkzR4EQpyP_gnG08e2vi1RJyS7uourNBda49d6a9ldqb39c43tKNrsOaNzh4qrYHVBE Sk9e.Q4U3AHvB3GTV1AnlKfd1yur4KImPuMBSUhvMVPgP7DMYxE3bcy4G4gO.GdHqJ6aTyebq7A3 TsUg2PgOnsgUdF7TN3.LaylBFZ0DgxfhzZLzJh9zZ1a9EJF8IZ1SjWf5CYJmnwKJALLV1RXESm1M VKiRQw2RWllQ2puAqz8QTFLTt4Bz_adbzlARQLLk- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic309.consmr.mail.gq1.yahoo.com with HTTP; Wed, 17 Nov 2021 16:40:39 +0000 Received: by kubenode505.mail-prod1.omega.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 0954f68b7f800dbf0ec161c9804ac1f3; Wed, 17 Nov 2021 16:40:33 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: cgit, ages and chronological order In-Reply-To: Date: Wed, 17 Nov 2021 08:40:30 -0800 Cc: =?utf-8?Q?Ulrich_Sp=C3=B6rlein?= , Graham Perrin , freebsd-git Content-Transfer-Encoding: quoted-printable Message-Id: References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> To: Stefan Sperling X-Mailer: Apple Mail (2.3654.120.0.1.13) X-Rspamd-Queue-Id: 4HvTFV6NsXz4Z1Z X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] Reply-To: marklmi@yahoo.com From: Mark Millard via freebsd-git X-Original-From: Mark Millard X-ThisMailContainsUnwantedMimeParts: N On 2021-Nov-17, at 01:40, Stefan Sperling wrote: > On Tue, Nov 16, 2021 at 02:32:52PM -0800, Mark Millard via freebsd-git = wrote: >> author George V. Neville-Neil = 2021-11-10 17:51:42 +0000 >> committer George V. Neville-Neil = 2021-11-10 18:09:19 +0000 >>=20 >> information being based on local git commit timing (and clocks) >> vs. when the commits are pushed to FreeBSD servers: The display >> order is from the timing on the FreeBSD servers but the Age is >> based on the original commit (before the push). The longer the >> delay between commit and push, the more noticeable the >> distinction is. >=20 > This is not how Git works. If the server changed the timestamp then > it would also have to rewrite the commit object and change its hash. > Git's server will only ever store objects as they arrived on the wire. >=20 > Rather, both timestamps were created locally. > The above looks as if the author used git-rebase or similar on their = own > commits. Some Git commands will update the committer field but leave = the > author field as it is. These fields contain email address and = timestamp. >=20 > Generally, sorting commits by committer timestamp will give the order > most people would expect. Unless some client has an unsynced clock, = and > nothing can be done about that without a hypothetical smarter server = and > client which support server-side rewriting of commits during push. >=20 Try doing range searches for each of: 8ef0c11e7ce7 8ef0c11e7ce7^ 8ef0c11e7ce7^^ 8ef0c11e7ce7^^^ 8ef0c11e7ce7^^^^ on the main branch and note where each starts. (These are in the range that I showed originally.) That is the order of the history on the branch on the FreeBSD server. It does not follow the Age: Age need not track the sequencing on the branch on the server. =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From nobody Wed Nov 17 16:48:40 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id D84BE18888A7 for ; Wed, 17 Nov 2021 16:48:53 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic303-24.consmr.mail.gq1.yahoo.com (sonic303-24.consmr.mail.gq1.yahoo.com [98.137.64.205]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvTQr6jP2z4c57 for ; Wed, 17 Nov 2021 16:48:52 +0000 (UTC) (envelope-from marklmi@yahoo.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637167726; bh=ORFjz5a0bfb5dYc5Ly8005clmZEodpJiPlyBFtGIJk4=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=CDiAMnOhLk74/2ToWaGWtukzx1y9hJisJ+SWVuqjpZLbwdrs9fg0bONfZqrGg8QJ5XzGoswLO6FfXp68vtyeyh3AxHCQHj06GoUs1/F/7yZxZ+VzxaL6NaGq7oCex9z0pCM2Gy2Vo6TIWdrHisTB9OMzW2bn/Vy3hSK9pH/8knCbNjLD0wERBVAnHIpG8i4x3kB143GfmW99BVURC+Jh0k0D35Ih50TOU5CdaofFk+DNGli4iGdkV3U2ib/oGan05yfaNOEib5aEjugks+1Fs8JId8D5hAZ1u0xiYA6k3a9lJDshDAJDuq79QGCWMAuKZC67m17XVlVw5mgWvop7IA== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637167726; bh=XM0ehFTENd5MLsuhULWEO+COqwW8+xgFEaurU0Xz9xs=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=LBmDNAKx955hUvCDVOGiSrasioe2h+lOrmD2q57dmoH+Xd55nU4jJWWIcDdE7yPIP81s8xzqwMa1Frh+3l4BhAxIGDobXHSAucHEnI15l5lWqhBx3KA6q4KTP+WNBRms09l31yR3+iuz8deFQtond95WyG2QXNBnlvaqr3/bcyelpex9ulv/TR6Si63r+TCCK17eVYHuJBtjFcGmtLXpcno3jvvvxX8uyfcpM89K8OG3eO2GJth28w/KFCyvzRi8T9R2YQlzE3z6h103KXcfA8KiQp3fpJGdgRquZKcIZeI5twFPdfXELqRFQGb8QiPculiV3qsCjuGdOfVt2BPkaw== X-YMail-OSG: gCUE_vwVM1niuvrGMn56p8PkQHIjqr.FU8yOBTNWkmb9SYAHPHIGd7qas_F7hRE 6s1RB00E.EsCNHciP.tW4wIqo_p4RqODhT5qokPk5C61Y4EuZDIBIhmZoOU68gkIhtfviv.tmYQG Im1bPZWe5pTJ6fqEdOck6zWmfjAu_8cx2acneAiwazRinWPzo3crJgmAK7Vjsodle0VGO5lvvIbm _B0LYEgeZAxbwP.J9Mw9BVhexAnny0NM0SJHAdR_7H5.gBoGmcXGfBnUyyT7_r7U.JkwRWr._eXv Kl8QT743L8CIOWlo4bW_2zSua1nl7wqa7fYKIDxIMh_0fagLvgqMb61V1flB5QqNI55MEJCj3HFg A3gMBEfhFDNuNbOaX6SqtHDTxBSUFMEKbm_cZSf8uSFnw4skCtIVPv2yizw_mVkYWpe8_IO3FHEz lPjKWH8_0f.qPKQa6pYniKv6zPH8pM.nb6MM64nBWwWqeiKTNOz52uyCEE5bJz3kwyAd6v0vuECy cs_Uy6S0jnlyqcKpRgw1Fvet9u4sQEIQyNGJ6IM2sfh3aL122VWd8wI9vy3f16pwxUoo_oE1uoCr bH1ppRlkLX9zoxUd8vvw6TXNr2Fe2G7dhaU1xdVeghvPHseBGXTxdNuJ_rZaDFj_h89yfAXikhTX zLg3mEGKB7vJIzbD960VL4kYazmkE8wLcjma_xuV6.kCmgNpkEnOqV.kH1r8S5aAiMe05h8mvDYA op2mBpNEh6mhtAVFf.WKS8tvoHGjEz30H3.PhsJuyMau3v2oFIaLGljEQB7UiB7Kj7QQzY61jFr_ qzmstFM1.ISQJDzET1VIL6VnEuVIm4y5tNo.cj5FmGiP9MjjanxWQqW_fvXl1Smv2ll6XH7Vg06I OVLjvyCIv6bOKBEl6ojaEAGVBGleYeOqiV1AjwAdIEjKPbyyUmKffYePu.Rk7oFVWIVvHglpU61r 0PQST6bLEFnz96u2H07dYxRqRo9ybmAeQQDw3Id_0u5rLu_xOaiAkxbxgpfr3_fK1ldqTx_ezTGK Efo9cJ4Cc.2J1fNEy3SJ.nXwOHQxIFgXvIqIWoo5AsJE.le8Jtw2TI7fCGmUiFJW8ovuulDQx02K 5eeolGoI_wzTmyYCmQ0wh9ZOvPGXaRNdP0z1MuRskLjMfJ6N8TYu3Eg28UWYAeBj.9RyKw5jlBsU WMHdhVTokeqoPtEcK0677Xeb8g8a1buCW05cDl2qRE7bq7GtT6PnAFC0LfCxSVNDbUZiiAbJSFTP z9VmwrqbNzf_zbkiJ2w0vj8jnRJ.oS6KLcmn9SeYaUdxKkqiHo4QyAXm35VJMLbG5BQ9JOLKNb4C f4sZHPY9Wd260Tolm8Ftmr7eSGmdDMrl7WxCQr7RFLRScErvKgWHhYukQ9ejn2UWvbZj.C0jnegQ bQ63SnRMthqV.twy2fERMSepelsQ3rAdAF0Stlvf4eabfGL3_XNQ0cBTY_U3LegQIC9xRucHXA5H KE4oS1jFw3VW7h9WOVjx.HV7.37y5QVpwBM_yBa3U6ZPiAJGYeZ5.cJUj7WfvfmtGsee0NFk8Lz_ DWiYCytAB7LERp2YLzd9TpdVwwAGXw6UPnnBtOFHy6s0Xl69imdTNScXtXjBfC5maykNaXIYR6Ba aW6gF7LU.ZoholDEpjPvDt.x.XRjcxbNBiwZScEPdMh7q.fPs699KFBEDBcHQslzYWSx_ThaFIZT aryatpECopQAJMnpQHxIvjCPadjiexJbn5RxJGyMn58sKxaCHVa6bxwmhOvmjv4fwg0VKmCeu1bH SiRBwh.4mpOASSEN97zN0HTN39cYKePzMazaRCIbpnaO5ffkBUK_zyz6qfsCP.KBEGpyaS_KZzYL 0mY15IwxqvDbmXgoJbFqfxsuKMDHB5MhqBwDRmOd3Oth2Qg5WTa7O6XUtvkbxZekbiP_7__v.vqw _lXT_KKJY_4OsX95UAuSOS1gXlZTG8kOOwCojnhzJhDbkBTUPyTff8F6SNKUu1KHxtX054ILEfMy lWpdveK3HW2X__LHETUrqO0IZkVjTmCSXflNendMDZiimcfgC9aaG.4wn6cQWYU_aHGVsL96SOFR 3vDOCfZ7OZBraw3qeTy5gOKtiekqmiCFdTHmhREXZRgtR5d8Yb914t3bjb6I53C._CWa8q.a9ZTd utP9WYrCZHDAlaJItdNJz3cWsSghpYKwL0siWhCxLhcqwsE3ogOdwCurmkKQFaoWenT8ndimNN81 MFgQUbBs.cvIv0mNzANNEuJoVm0lV87Aen4xUywWas7s- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic303.consmr.mail.gq1.yahoo.com with HTTP; Wed, 17 Nov 2021 16:48:46 +0000 Received: by kubenode505.mail-prod1.omega.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID eae8830a499b112b1f1f406ff9f84edc; Wed, 17 Nov 2021 16:48:43 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: cgit, ages and chronological order In-Reply-To: Date: Wed, 17 Nov 2021 08:48:40 -0800 Cc: =?utf-8?Q?Ulrich_Sp=C3=B6rlein?= , Graham Perrin , freebsd-git Content-Transfer-Encoding: quoted-printable Message-Id: <4EB44761-AF88-46DA-9FA5-D40DAC25EAEA@yahoo.com> References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> To: Stefan Sperling X-Mailer: Apple Mail (2.3654.120.0.1.13) X-Rspamd-Queue-Id: 4HvTQr6jP2z4c57 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=yahoo.com header.s=s2048 header.b=CDiAMnOh; dmarc=pass (policy=reject) header.from=yahoo.com; spf=pass (mx1.freebsd.org: domain of marklmi@yahoo.com designates 98.137.64.205 as permitted sender) smtp.mailfrom=marklmi@yahoo.com X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.205:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.205:from]; FREEMAIL_CC(0.00)[freebsd.org,gmail.com]; RCVD_COUNT_TWO(0.00)[2] Reply-To: marklmi@yahoo.com From: Mark Millard via freebsd-git X-Original-From: Mark Millard X-ThisMailContainsUnwantedMimeParts: N On 2021-Nov-17, at 08:40, Mark Millard wrote: > On 2021-Nov-17, at 01:40, Stefan Sperling wrote: >=20 >> On Tue, Nov 16, 2021 at 02:32:52PM -0800, Mark Millard via = freebsd-git wrote: >>> author George V. Neville-Neil = 2021-11-10 17:51:42 +0000 >>> committer George V. Neville-Neil = 2021-11-10 18:09:19 +0000 >>>=20 >>> information being based on local git commit timing (and clocks) >>> vs. when the commits are pushed to FreeBSD servers: The display >>> order is from the timing on the FreeBSD servers but the Age is >>> based on the original commit (before the push). The longer the >>> delay between commit and push, the more noticeable the >>> distinction is. >>=20 >> This is not how Git works. If the server changed the timestamp then >> it would also have to rewrite the commit object and change its hash. >> Git's server will only ever store objects as they arrived on the = wire. >>=20 >> Rather, both timestamps were created locally. >> The above looks as if the author used git-rebase or similar on their = own >> commits. Some Git commands will update the committer field but leave = the >> author field as it is. These fields contain email address and = timestamp. >>=20 >> Generally, sorting commits by committer timestamp will give the order >> most people would expect. Unless some client has an unsynced clock, = and >> nothing can be done about that without a hypothetical smarter server = and >> client which support server-side rewriting of commits during push. >>=20 >=20 > Try doing range searches for each of: >=20 > 8ef0c11e7ce7 > 8ef0c11e7ce7^ > 8ef0c11e7ce7^^ > 8ef0c11e7ce7^^^ > 8ef0c11e7ce7^^^^ >=20 > on the main branch and note where each starts. (These > are in the range that I showed originally.) >=20 > That is the order of the history on the branch on the > FreeBSD server. It does not follow the Age: Age need > not track the sequencing on the branch on the server. Searching for each of the ranges: 8ef0c11e7ce7 8ef0c11e7ce7~1 8ef0c11e7ce7~2 8ef0c11e7ce7~3 8ef0c11e7ce7~4 gets the same results, by the way. Try it that way if you prefer. =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From stsp@stsp.name Wed Nov 17 19:06:47 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 3E6281855CE2 for ; Wed, 17 Nov 2021 19:06:51 +0000 (UTC) (envelope-from stsp@stsp.name) Received: from einhorn-mail-out.in-berlin.de (einhorn.in-berlin.de [192.109.42.8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mail.in-berlin.de", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvXV273N0z3sWY for ; Wed, 17 Nov 2021 19:06:50 +0000 (UTC) (envelope-from stsp@stsp.name) X-Envelope-From: stsp@stsp.name Received: from authenticated.user (localhost [127.0.0.1]) by einhorn.in-berlin.de with ESMTPSA id 1AHJ6lnZ008301 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NOT); Wed, 17 Nov 2021 20:06:48 +0100 Received: from localhost (benson.stsp.name [local]) by benson.stsp.name (OpenSMTPD) with ESMTPA id 7162f4fd; Wed, 17 Nov 2021 20:06:47 +0100 (CET) Date: Wed, 17 Nov 2021 20:06:47 +0100 From: Stefan Sperling To: marklmi@yahoo.com Cc: Ulrich =?iso-8859-1?Q?Sp=F6rlein?= , Graham Perrin , freebsd-git Subject: Re: cgit, ages and chronological order Message-ID: Mail-Followup-To: marklmi@yahoo.com, Ulrich =?iso-8859-1?Q?Sp=F6rlein?= , Graham Perrin , freebsd-git References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4HvXV273N0z3sWY X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: N On Wed, Nov 17, 2021 at 08:40:30AM -0800, Mark Millard via freebsd-git wrote: > That is the order of the history on the branch on the > FreeBSD server. It does not follow the Age: Age need > not track the sequencing on the branch on the server. I see. Sorry, I misunderstood the case under discussion. If the displayed commits are already ordered by parent-commit relationships, then displaying commits in that order regardless of timestamp makes sense, of course. Sorting commits by timestamp only matters when parallel commits from distinct branches need to be sorted into a single list for display (as opposed to drawing a graph). From nobody Wed Nov 17 19:36:22 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id EF2AC1895895 for ; Wed, 17 Nov 2021 19:36:35 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic316-54.consmr.mail.gq1.yahoo.com (sonic316-54.consmr.mail.gq1.yahoo.com [98.137.69.30]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvY8M52Gmz4ZBD for ; Wed, 17 Nov 2021 19:36:35 +0000 (UTC) (envelope-from marklmi@yahoo.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637177787; bh=dwwzGvx0VP7LvNbYELillOLbJ7JQiDRQS++TOfIthkw=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=ks7LcyEZ7WeQfk2oYXkvLOdH7gazCv9srlKLxnmqRDtt/cRpzzFZJNnNimKFCtOnMPLQNsbmEDPf1uorPSYd5QWefaQDyewII85Ne7RMCd0Uv3O6Nlzj7S42qV5EfEbAyJDqOtYreiRmTJ6CupNhMd3A1vMB9OWRrgjZW/IGphpJwtrUNu+XGSorjxjQ+xPKWgWeYf+sag1nkJrNosEDs6Ry9atbBybi1fKcnQxz6Nabb8OZ6eDO3g4h9BTVMMa0jvYirph1foKmENdDVHf+umivtS0Xftir8c9vSLvTP4pFQ4HXJZ7rI/o9vv9sbxs6UIsK7Css1GyB0ZODhaGAng== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637177787; bh=S7nm+cs3oG3JwAgPHJqJ0LcdFtVeEXlZ5rg0wan3dzF=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=h5p1L8tmNGccoLwch+WwDPDfc026fZN17nktWv1kz5L+BBUnAxATpuyeMjqAR8vkvoKzdnR0K6lXCVssy8WOyg+NVGONhrzw00zKwH7AcAS9X4k7hHOcbGywf6NDPZYZh9T3Z+sw3mbRpZg3DQrIt5sYxiY17QJ+ntTGCA3ftFz+PEIz12wL9mfXxBi5VWprX1XpRbxbqTCY0bQWM8wSrHK9yLW5fvdicwohz2ADxWiieiUqgHfqHJUWv1tPgGelLC4so9fWiAFu7iEYrfhG3lAlSQ0d+Who7yXm8DWNrV3fGbK3DSVHqrX2PimLMwCQnzsVnrZIEkD5zCPz+Rz7IA== X-YMail-OSG: 7GcP84QVM1lHY6sE8uZRoct_Da_HEULn6WW.UuzrlS1cjfaHvkCtt16CCjRTq89 .l001UlfL0ASqNN3V54vbMJy1rSYPJeniRxyMaWw5xj6j0AdLOM1g_b_pLiMoz6A1tBliJsPv..q BNL3P.k9piVaQDDApsF0lAbCs0iAAxtFRWcEoBNIYok6S0VGI483c1PUo4Soyb7um8lNz7D3AQ.4 J4DyyukndM2GYvAVfkhRp.j_pgDrC.IOg1k28R6j3gCkbKSjbzlXcSex4BMZnxwd.eFWlXq7XuF6 U8o1Ylj9zrzRmVrvdujHEu9Hjp8Ali_eedzpjNxCdHlhCC8Zxk..ttFVYXKHYYoCfDfGxkf4oOwJ HpyK9AFMHazX_OUTuthJKl5BwKe8Mt9yBmfFDDQh95SW0rCEbjdwAjw53ud1Y3iQRMyERI7Rxb3u goAiB1d1no68j5l0oIa4O4eqnEldW57vY7ElGESuI7EgQ78WafbFlqfF1G9bJb.tEYQ6iJnFPB.d deW_j.Sl.caIdEbLRWjPF9u9TXyarZ60islpMxXt4RFXJvW5FU6VTnd3GxJlgTXEFNRTR7jUhh15 bGgCWwFGch65uUGaUYZY1JFDCnY_0eaeQzgelNyzLVeC7lwpD5skEN0nnVrdbmU2sFjsinQ5T7NV 8ENPcHhGvlyCgtOZRM6v9_483JWDF2Gx_VSYGevJIDx7cM5SEuNi8qtkHz2tGdNo6y14txHFCcxP jBxHpNP_SizaRD_e6cob7WwHfxMAFOoATvXcCxJmJh4MZoOI5XYc6tDVYMr1.s6opOxBqjiP8zNs zMq4jDgZWkuDtyp.rSOg17UqNbOxC8tCejU53Ls0chIQDPfR36ajEQLQwwPJPF7B3eElvk9xfRjq oPKj5UMiuua5KV2L0nfc73s.Nm4i_V_RIRstvDUIDF2ZKJ1JE5nIA5J8T9JlqAFtSVzWvFcFEiW2 kprtsp1NV3GdRK91C2IF5IQp98.jk7RL1n9XGlNcW1H2_ctvqIjeR0HfO6mBKwh_F38a7FCEP0rs FLdPl9T8l4kTpfMlmUq9uPUVUvv1MrSA7t4HBywcKLy9Uhmlg5SOva6ae68iSHLSnfsBaeYwkhMd vGcu6Ik5qS8X52KW2VwiwwO7WUgCltc8ugTfzc8J8K.bbFw6oXLT0TATzcZA1pval2NvYjj3oXeL .MRBgo1PUxKILucgCf3g5QjXcheXbNXNfX_XElRDcBX2gi.OSmZiLC2_Ec8X0VB22fXbUsRDnfMP ZE_mRtQ6kNlFZ4QEQLJ0eO1a7za4VtbwAJ2VPwdeVUrCfG27fKvAblvfUJwXmuqCnHNuRgBaLTYB Lc94IJmFQyC2BGFl9lwSYEKBXaY5bGTdufgRx1T9pby1lzll0cLnrSORACKYxM17ohgbstIVauoE DmZ92VH_ONJ07mFoHQKh1b9SxxUv8K9dHUANXRZ36X78mxNwXPUaNndwp.4oWscuHIsYLtgBm9QY Vg0JnZseMQyxVZNIywPmxY6KYRIx_lVxpKVwPDD4GF0chw0rtw2JVdVBsFeGv_8jO8i7ew9J9xWS RcVwQB0s_MOotMfDV2gHRn_mdqxiw8ca5aY_RMd4Khvd9DBWyJiEjNMI_IKwpPAUPzTaDXjNn1ut H.7VEEJ7mQ4qbQsrg44AzMn9e9ZvkssUp3QelcjVdL8mEaPTGbct.4y6v1X8_Ae1UIh3MG16IewT .PXdA4jgDVcz3CcaDk_NvEJzZT9sYOuYwD3KuT_fk5sN3OsjT7hj3ylBXPIqeSLA.Iw5A0PyUqwh JshwvcbZCNoybpyDG4RrFhbaotABss1saewZ2ZTinfLbBhCTPOzkc_dCCr_U9MjFLrZ.tBF0FuSq rIyNMxdLhFKlisQ_AxX_7y6BDxUqfCgGq_l3ctiIX9anwMvcwjrbkyplYgRksJDUr1GdA8DkBHbk 7jKmeyU81K_eWF4taSoi.e4xHGylYa4.Y7nk14T4y_c_6FByTu32GpGpQ3xqZQ0a88xCUiuj3TRC SF3fXBg11cWp2XjzOSIfcGTOuwW0I3ypgfl.t2odoCducl8UngmoS8mmD25wib7V5KbtTB_mdQ4y UV2_MiLXaBhGpU_Kaf09HJqENvkApHWqHrtUOjARaCU.tzUXBKBHtE1XiLjwc18iJBtjhqMWV2mZ jdO4fxdbd72JUJDFbuC3hxFmV.plAa9bGIaaRZq.Ffac9aekwe1.xlW2t_zQkd6PiTgftM5leb6a hALjNPdZrVaFInQ.4rhHH_SIKUTULUOLuetaUmasClKHtOeLpJexjZwyLhMGPJSQ- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic316.consmr.mail.gq1.yahoo.com with HTTP; Wed, 17 Nov 2021 19:36:27 +0000 Received: by kubenode503.mail-prod1.omega.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 5b29cf61f22365d838f882ba256a8752; Wed, 17 Nov 2021 19:36:25 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: cgit, ages and chronological order In-Reply-To: Date: Wed, 17 Nov 2021 11:36:22 -0800 Cc: =?utf-8?Q?Ulrich_Sp=C3=B6rlein?= , Graham Perrin , freebsd-git Content-Transfer-Encoding: quoted-printable Message-Id: References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> To: Stefan Sperling X-Mailer: Apple Mail (2.3654.120.0.1.13) X-Rspamd-Queue-Id: 4HvY8M52Gmz4ZBD X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] Reply-To: marklmi@yahoo.com From: Mark Millard via freebsd-git X-Original-From: Mark Millard X-ThisMailContainsUnwantedMimeParts: N On 2021-Nov-17, at 11:06, Stefan Sperling wrote: > On Wed, Nov 17, 2021 at 08:40:30AM -0800, Mark Millard via freebsd-git = wrote: >> That is the order of the history on the branch on the >> FreeBSD server. It does not follow the Age: Age need >> not track the sequencing on the branch on the server. >=20 > I see. Sorry, I misunderstood the case under discussion. > If the displayed commits are already ordered by parent-commit = relationships, > then displaying commits in that order regardless of timestamp makes = sense, > of course. > Sorting commits by timestamp only matters when parallel commits from > distinct branches need to be sorted into a single list for display (as > opposed to drawing a graph). Yea, trying to make a linear list out of partially-ordered things is messy for interpreting the results. But https://cgit.freebsd.org/src/log/ for main does include a graph at the left: One is currently visible on the first page that is not linear (from a zfs merge: 2 parents involved in what is visible). =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From nobody Thu Nov 18 04:46:49 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 47BB1188F17C for ; Thu, 18 Nov 2021 04:47:07 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4HvnMb1Qkxz4dmn; Thu, 18 Nov 2021 04:47:07 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from auth1-smtp.messagingengine.com (auth1-smtp.messagingengine.com [66.111.4.227]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 05B8A232B7; Thu, 18 Nov 2021 04:47:07 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from compute6.internal (compute6.nyi.internal [10.202.2.46]) by mailauth.nyi.internal (Postfix) with ESMTP id 7054327C005B; Wed, 17 Nov 2021 23:47:06 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute6.internal (MEProxy); Wed, 17 Nov 2021 23:47:06 -0500 X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvuddrfeehgdejfecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffufffokfgjfhggtgesthdtmhdtredttdenucfhrhhomheprfhhihhlihhp ucfrrggvphhsuceophhhihhlihhpsehfrhgvvggsshgurdhorhhgqeenucggtffrrghtth gvrhhnpedvgfdtledvgfeggeehfefgvedtkefhjeeludfgvdeftefgudduleegtdeludek udenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehphh hilhhiphdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqudduieeivdeivdeg kedqvdefhedukedttdekqdhphhhilhhipheppehfrhgvvggsshgurdhorhhgsehtrhhouh gslhgvrdhish X-ME-Proxy: Received: by mail.messagingengine.com (Postfix) with ESMTPA; Wed, 17 Nov 2021 23:47:04 -0500 (EST) From: Philip Paeps To: marklmi@yahoo.com Cc: Ulrich =?utf-8?q?Sp=C3=B6rlein?= , Graham Perrin , freebsd-git Subject: Re: cgit, ages and chronological order Date: Thu, 18 Nov 2021 12:46:49 +0800 X-Mailer: MailMate (1.14r5847) Message-ID: In-Reply-To: <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-ThisMailContainsUnwantedMimeParts: N On 2021-11-17 06:32:52 (+0800), Mark Millard via freebsd-git wrote: > information being based on local git commit timing (and clocks) > vs. when the commits are pushed to FreeBSD servers: The display > order is from the timing on the FreeBSD servers but the Age is > based on the original commit (before the push). The longer the > delay between commit and push, the more noticeable the > distinction is. Some projects require a "git rebase --ignore-date" (or "git rebase --reset-author-date", which I consider the more obvious spelling) before pushing. A hook could potentially reject commits with timestamps that are too far off to the server's liking. I can't comment on whether we need or want either the policy or the hook or both. I don't really have a problem with the default Git behaviour here. Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From nobody Thu Nov 18 15:50:58 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 8C8581898793 for ; Thu, 18 Nov 2021 15:51:00 +0000 (UTC) (envelope-from glebius@freebsd.org) Received: from cell.glebi.us (glebi.us [162.251.186.162]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "cell.glebi.us", Issuer "cell.glebi.us" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hw45c29sPz3jFL; Thu, 18 Nov 2021 15:51:00 +0000 (UTC) (envelope-from glebius@freebsd.org) Received: from cell.glebi.us (localhost [127.0.0.1]) by cell.glebi.us (8.16.1/8.16.1) with ESMTPS id 1AIFow6d027008 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Thu, 18 Nov 2021 07:50:58 -0800 (PST) (envelope-from glebius@freebsd.org) Received: (from glebius@localhost) by cell.glebi.us (8.16.1/8.16.1/Submit) id 1AIFowMI027007; Thu, 18 Nov 2021 07:50:58 -0800 (PST) (envelope-from glebius@freebsd.org) X-Authentication-Warning: cell.glebi.us: glebius set sender to glebius@freebsd.org using -f Date: Thu, 18 Nov 2021 07:50:58 -0800 From: Gleb Smirnoff To: Philip Paeps Cc: marklmi@yahoo.com, Ulrich =?iso-8859-1?Q?Sp=F6rlein?= , Graham Perrin , freebsd-git Subject: Re: cgit, ages and chronological order Message-ID: References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4Hw45c29sPz3jFL X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: N On Thu, Nov 18, 2021 at 12:46:49PM +0800, Philip Paeps wrote: P> On 2021-11-17 06:32:52 (+0800), Mark Millard via freebsd-git wrote: P> > information being based on local git commit timing (and clocks) P> > vs. when the commits are pushed to FreeBSD servers: The display P> > order is from the timing on the FreeBSD servers but the Age is P> > based on the original commit (before the push). The longer the P> > delay between commit and push, the more noticeable the P> > distinction is. P> P> Some projects require a "git rebase --ignore-date" (or "git rebase P> --reset-author-date", which I consider the more obvious spelling) before P> pushing. A hook could potentially reject commits with timestamps that P> are too far off to the server's liking. P> P> I can't comment on whether we need or want either the policy or the hook P> or both. I don't really have a problem with the default Git behaviour P> here. I think we should strongly recommend this before pushing, not enforce. I often myself forget to do that, though. -- Gleb Smirnoff From nobody Thu Nov 18 16:29:27 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id ACB211853F7F for ; Thu, 18 Nov 2021 16:29:33 +0000 (UTC) (envelope-from brooks@spindle.one-eyed-alien.net) Received: from spindle.one-eyed-alien.net (spindle.one-eyed-alien.net [199.48.129.229]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hw4y54Q0jz3vYp; Thu, 18 Nov 2021 16:29:33 +0000 (UTC) (envelope-from brooks@spindle.one-eyed-alien.net) Received: by spindle.one-eyed-alien.net (Postfix, from userid 3001) id 7B9903C0199; Thu, 18 Nov 2021 16:29:27 +0000 (UTC) Date: Thu, 18 Nov 2021 16:29:27 +0000 From: Brooks Davis To: Philip Paeps Cc: marklmi@yahoo.com, Ulrich Sp??rlein , Graham Perrin , freebsd-git Subject: Re: cgit, ages and chronological order Message-ID: <20211118162927.GG81740@spindle.one-eyed-alien.net> References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="11Y7aswkeuHtSBEs" Content-Disposition: inline In-Reply-To: User-Agent: Mutt/1.9.4 (2018-02-28) X-Rspamd-Queue-Id: 4Hw4y54Q0jz3vYp X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: N --11Y7aswkeuHtSBEs Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Nov 18, 2021 at 12:46:49PM +0800, Philip Paeps wrote: > On 2021-11-17 06:32:52 (+0800), Mark Millard via freebsd-git wrote: > > information being based on local git commit timing (and clocks) > > vs. when the commits are pushed to FreeBSD servers: The display > > order is from the timing on the FreeBSD servers but the Age is > > based on the original commit (before the push). The longer the > > delay between commit and push, the more noticeable the > > distinction is. >=20 > Some projects require a "git rebase --ignore-date" (or "git rebase=20 > --reset-author-date", which I consider the more obvious spelling) before= =20 > pushing. A hook could potentially reject commits with timestamps that=20 > are too far off to the server's liking. >=20 > I can't comment on whether we need or want either the policy or the hook= =20 > or both. I don't really have a problem with the default Git behaviour=20 > here. I always use --ignore-date when curating pre-commit. I'd like to at an absolute minimum enforce that CommitDate be newer than the previous commit and older than the push time. There is no good argument for allowing non-linear CommitDates since the only requirement is that the committer have their clock set more or less correctly. -- Brooks --11Y7aswkeuHtSBEs Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJhln9mAAoJEKzQXbSebgfAjwsIAILdwZcvgF8rovwLguO+0enr OCOgiPndIB4u2vyhbKSpAin14sXq3IK2vkUph9FcoRYwS4J3qxqQqwTjwtI9KLzS /tEAj3uwYawk0zNXJu7vm9MsVrWO5p5QR0749vwLMYJMkbASMF2o23qmvkjcUie1 uD/kLsadfEum6zd70tMbWObAQKzbLj3F7tG/w07mXMSvmdQcH4gBzeMAFwibd83X QIQBRq+cK0ljTWbj2x3imUaxtMRoTrRHrUF9QVIHilq9iDny7+ak4UmVgAvHfku1 bD6GgLC/kTDZD4rmncQaYEnDWfYyT7lPEDDy+ti14uhmeKvWOmXfbpmUUiZbQjY= =iiT7 -----END PGP SIGNATURE----- --11Y7aswkeuHtSBEs-- From nobody Thu Nov 18 16:46:50 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id D494B188B3CB for ; Thu, 18 Nov 2021 16:47:00 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-vk1-xa33.google.com (mail-vk1-xa33.google.com [IPv6:2607:f8b0:4864:20::a33]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hw5LD5HSCz4TkS for ; Thu, 18 Nov 2021 16:47:00 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-vk1-xa33.google.com with SMTP id 84so4173941vkc.6 for ; Thu, 18 Nov 2021 08:47:00 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20210112.gappssmtp.com; s=20210112; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=jh8ziTjmYlGhQmP6oh2S96xYkEM58xKpIn+B7yN1V7o=; b=f88Cz/rFsbb3BK6wOKLbsJygmW33zxVYXumy9/YQ8T1z/OkfWsoGKl8LyRo7bkYUza OEZocsmfo1N+OaYIetuTeoU9485UnZZ36CHX/2EPLtRP63lkJApc1+iTzuecDgSQThwT 5iRVATCqZEGRxX3i0GSWWS3XAzKg9MYUwY1PjftMDeahDL0wVzLBBQDaRwWz12rAAwJF 28B16EtVVim3Ge+Gp1ODXIMZZ/Wna5/HBrpsT/LH+mdiMYl3R/tKDOdPdLNPDJF4g8yg JIaOzBunv0e0CEPl4s8IGg6V6AOklHW3zWEJEyHcETMN0FyacrJ/rhfxRfdAZnRvx1+5 E5Kw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=jh8ziTjmYlGhQmP6oh2S96xYkEM58xKpIn+B7yN1V7o=; b=h+SWjW051YVV2TCzzlTLPFRMA9Krrv7SLIi8CphwIJM5EvJzmD9t0+ht3kjib30aYT mL0HmG35WgKTpm2782cegOfhNgbDOtCS5Q8B+HIwZbJDPZ1Oql1b7pw5hMES75jjzhLr Y32P136mRKkxADEgM/V6XzMFt2CxjysX16jfQs/YHB9y+b+aiZbKsjFDGh+zAnPZq5TG ckvHSW78ynktSAL5jjCvKAFCRtaGWhMSKvE/QbKhX+Qi9GXzx6+5SBACEbuV7jMWnxac Q3AYmqKTaDA6RFSQET+pUIDiZ5GKpUalIbJXx3CzWR4Tp6TaaEs9XiSugeBf5/YZQGVr kqmg== X-Gm-Message-State: AOAM531Vla9mjHaPTIFDewzBgL8lstgsiv33Qdxc+1uvr7RZZWlxKRg/ d+QzOiQGHlyR0jiSjZ1nTZGeXAWjnhGdeJUqHvP+7Q== X-Google-Smtp-Source: ABdhPJxkVD5H8NA2tHsFz0KoRZasthv+o6IS0KPWL+PJGUB6hZhFQsiOPiDW5XdivgfDIxLZsmpm1v+LB2RD9dBlAu4= X-Received: by 2002:a05:6122:114c:: with SMTP id p12mr105744927vko.21.1637254020193; Thu, 18 Nov 2021 08:47:00 -0800 (PST) List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> <20211118162927.GG81740@spindle.one-eyed-alien.net> In-Reply-To: <20211118162927.GG81740@spindle.one-eyed-alien.net> From: Warner Losh Date: Thu, 18 Nov 2021 09:46:50 -0700 Message-ID: Subject: Re: cgit, ages and chronological order To: Brooks Davis Cc: Philip Paeps , Mark Millard , "Ulrich Sp??rlein" , Graham Perrin , freebsd-git Content-Type: multipart/alternative; boundary="00000000000047f07e05d112e827" X-Rspamd-Queue-Id: 4Hw5LD5HSCz4TkS X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: Y --00000000000047f07e05d112e827 Content-Type: text/plain; charset="UTF-8" On Thu, Nov 18, 2021 at 9:29 AM Brooks Davis wrote: > On Thu, Nov 18, 2021 at 12:46:49PM +0800, Philip Paeps wrote: > > On 2021-11-17 06:32:52 (+0800), Mark Millard via freebsd-git wrote: > > > information being based on local git commit timing (and clocks) > > > vs. when the commits are pushed to FreeBSD servers: The display > > > order is from the timing on the FreeBSD servers but the Age is > > > based on the original commit (before the push). The longer the > > > delay between commit and push, the more noticeable the > > > distinction is. > > > > Some projects require a "git rebase --ignore-date" (or "git rebase > > --reset-author-date", which I consider the more obvious spelling) before > > pushing. A hook could potentially reject commits with timestamps that > > are too far off to the server's liking. > > > > I can't comment on whether we need or want either the policy or the hook > > or both. I don't really have a problem with the default Git behaviour > > here. > > I always use --ignore-date when curating pre-commit. I'd like to at > an absolute minimum enforce that CommitDate be newer than the previous > commit and older than the push time. There is no good argument for > allowing non-linear CommitDates since the only requirement is that the > committer have their clock set more or less correctly. > At the very least, we should document this suggestion. I also like the idea of enforcing this as a pre-commit hook, but before that we should have it the docs... wouldn't hurt to have a section in the docs about each of the major points we enforce to tell people have to fix the issue should they encounter it. Warner --00000000000047f07e05d112e827-- From nobody Fri Nov 19 14:37:57 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 1557F18A7D16 for ; Fri, 19 Nov 2021 14:37:59 +0000 (UTC) (envelope-from marcnarc@gmail.com) Received: from mail-qv1-xf34.google.com (mail-qv1-xf34.google.com [IPv6:2607:f8b0:4864:20::f34]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4HwfQt6s3tz4sGH; Fri, 19 Nov 2021 14:37:58 +0000 (UTC) (envelope-from marcnarc@gmail.com) Received: by mail-qv1-xf34.google.com with SMTP id i13so7228177qvm.1; Fri, 19 Nov 2021 06:37:58 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=message-id:date:mime-version:user-agent:subject:content-language:to :cc:references:from:in-reply-to:content-transfer-encoding; bh=U0DfhyivVfQxIA4csw0O1GaVCWND51pmdepOFsPGROw=; b=bQu3T9OAW1SuxbkaRXPLD1aQsAIkPrfoI033P9t9aC+J/MXsxD8wxvd96Nh85Oscuo FJYKP6ZmzXYuz/nBFC5vddsk3sjYC02pmogbPF2ac3vZLCPg3NEL+zLvDA1bhUJcx2U6 EnLFmrLL0zyuxKMmrYQPuzhJN4pIC+u1yMgiM+36hk6BiHlTqArPD/tlr0d5sH51GjIT hq1nre1ckqs7YYr3PGjWYOlew46kGafUpM0SRYeBK/0QqkO5DB4I7c9S1t+WQC5ksDjZ 2hkUIsNZYMzyeraQiW6vCQFAHj/OmNqzIvGAOi3qWH7Pk1oHiubjX+Q70CkN+MuQ6K6X rmXQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:message-id:date:mime-version:user-agent:subject :content-language:to:cc:references:from:in-reply-to :content-transfer-encoding; bh=U0DfhyivVfQxIA4csw0O1GaVCWND51pmdepOFsPGROw=; b=tKQShP8jWdIXrLLE6asNLlvgNcXjftQvH/J32RY0KkvFFzS9GljuDWewETNxWWXaA5 dOuxJ7G0WazomJLozmgIrh9dz+18wSA6CTmJDQrQvD/MxnajTdKywdHvO9ei7oC4nczT Lh6wpvRZLeSBNKFhGB5XBZsjx214tuud8FbgOKuvEslh4Fixt2AczK2ezu9aGjM7zRwa Fbqk933NKjFS9IBOTOoFn4EC7wa1THnkvUy/uyh6YQmTq7OyevFv/gtL1U3IoRpLOnoG S389Z1IDLPrP6wiXTP4ROej2yqmyxXvR6VpgLPUAeVBYjurx+PAAaqh+dSkqWVi0LPqx eI/g== X-Gm-Message-State: AOAM530vcoLFu3rrydSAIQccfM0V2KTLSqcAFLZiYUuK/tCTjKFpLYeB 8xJfN3IvFt9GL+uFl/GDIFpdjnFZyUM= X-Google-Smtp-Source: ABdhPJx+H+064oRDobM2ny+nZ6wnR5c7SUy1ioAY5+T4e6GyP+Hc055BhCT7Sc9iKEVdwbGsHkkKqQ== X-Received: by 2002:ad4:5ae5:: with SMTP id c5mr74315371qvh.29.1637332678606; Fri, 19 Nov 2021 06:37:58 -0800 (PST) Received: from [192.168.222.18] (192-222-183-158.qc.cable.ebox.net. [192.222.183.158]) by smtp.gmail.com with ESMTPSA id q20sm1723852qkl.53.2021.11.19.06.37.57 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Fri, 19 Nov 2021 06:37:58 -0800 (PST) Message-ID: <58e89a2f-f53e-1b41-138f-e2d0fd536a28@gmail.com> Date: Fri, 19 Nov 2021 09:37:57 -0500 List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:91.0) Gecko/20100101 Thunderbird/91.2.1 Subject: Re: cgit, ages and chronological order Content-Language: en-US To: Warner Losh , Brooks Davis Cc: Philip Paeps , Mark Millard , Ulrich Sp??rlein , Graham Perrin , freebsd-git References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> <36020FD7-32A4-4869-B6A2-2622F50F6478@yahoo.com> <20211118162927.GG81740@spindle.one-eyed-alien.net> From: Marc Branchaud In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4HwfQt6s3tz4sGH X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-ThisMailContainsUnwantedMimeParts: N On 2021-11-18 11:46, Warner Losh wrote: > On Thu, Nov 18, 2021 at 9:29 AM Brooks Davis wrote: > >> On Thu, Nov 18, 2021 at 12:46:49PM +0800, Philip Paeps wrote: >>> On 2021-11-17 06:32:52 (+0800), Mark Millard via freebsd-git wrote: >>>> information being based on local git commit timing (and clocks) >>>> vs. when the commits are pushed to FreeBSD servers: The display >>>> order is from the timing on the FreeBSD servers but the Age is >>>> based on the original commit (before the push). The longer the >>>> delay between commit and push, the more noticeable the >>>> distinction is. >>> >>> Some projects require a "git rebase --ignore-date" (or "git rebase >>> --reset-author-date", which I consider the more obvious spelling) before >>> pushing. A hook could potentially reject commits with timestamps that >>> are too far off to the server's liking. >>> >>> I can't comment on whether we need or want either the policy or the hook >>> or both. I don't really have a problem with the default Git behaviour >>> here. >> >> I always use --ignore-date when curating pre-commit. I'd like to at >> an absolute minimum enforce that CommitDate be newer than the previous >> commit and older than the push time. There is no good argument for >> allowing non-linear CommitDates since the only requirement is that the >> committer have their clock set more or less correctly. >> > > At the very least, we should document this suggestion. > > I also like the idea of enforcing this as a pre-commit hook, but before that > we should have it the docs... wouldn't hurt to have a section in the docs > about each of the major points we enforce to tell people have to fix > the issue should they encounter it. A Git alias could be a useful recommendation here, eg. to create a "git rb" command that does a rebase with the desired option: git config --add alias.rb 'rebase --ignore-date' (Add --local to make Git only configure the alias for your FreeBSD clone.) I think maybe you can even create a "rebase" alias that overlays the real "rebase" Git command, but I'm not 100% sure of that (I don't like to mask the real Git commands with my aliases, so I've never tried). M. From nobody Sat Nov 20 06:02:45 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id F38021896711 for ; Sat, 20 Nov 2021 06:02:54 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-ua1-x929.google.com (mail-ua1-x929.google.com [IPv6:2607:f8b0:4864:20::929]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hx2y61MDMz4j2L for ; Sat, 20 Nov 2021 06:02:54 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-ua1-x929.google.com with SMTP id r15so25652181uao.3 for ; Fri, 19 Nov 2021 22:02:54 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20210112.gappssmtp.com; s=20210112; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=D0KHk+5bAr2HdDyV5oEM7uKVBSsYC/AXWBVXHk5nBq8=; b=Nm2kS9T2aO29RaEomsTGgtpwwPTZgsVtkHj9h+lTmxNo8O4k+HVkvwyLVIqhFZfzN8 c/Tvu9aG6LzXIP2zEh5i+aGGa5J2Qozl6uDH2a2vlmTywiOrNCJbU7LHm9npG0AP9m2M qqBLIGsDLuyFrrY0Rs5VmKJzBNvrQMxcQynm7f1NNKwZIwSD5CqzHB4GaWUjlGJ7xS42 Ayry2jRxlTMSv556GzcLBys5kLkUMaSk5IpLg8BIe3ECqoKng/t7nXMMJwDz4pmeoH6m 39HiaSunuJRGtEiPS+0BNvJ5r0aywi2DtukzFPWJCz2fm1csNiUTTNSc+qoUzpZfZSfZ qNXw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=D0KHk+5bAr2HdDyV5oEM7uKVBSsYC/AXWBVXHk5nBq8=; b=iHSpHUOG/rpR1Ff40AYD3xiVW29QhXLUCjLSRokFeuBrWmJtRhFhok5im6S3E8imvg EAxveNtX2BoK/C04Z1CJLYFjue5NA5xDBAUf+2GcabSj0JQ5vSGSSRBEE989GtlVPxvz rFP3g6PII/Fc3XtDWW9R4PhdkJ0Hc+L4Xj6tT2Ux22ooszq4K1QB5We9tRQlehMhqXCI SIHcayEiYY9WVaT5IYed17e4oVw9UkU8BMnq+d9w40nWpHoVnLRbE6sT9BttWsRoJP3m hCwRCGPtpX0sOshEgTfi/x4Xz+VvYx0DQY35JB9xLfDO1+4nQ1OCnRh4lUioGcPZrReW N/Vg== X-Gm-Message-State: AOAM5328oUY4PQvio5cW8zNPT2ASNNvxwNz/MAYJWm18h53XGPNcDRM5 8zHtajcXtVI+sUGWbnkru1siMIhupm1Q2NMTYfgu3ovnrOpPbA== X-Google-Smtp-Source: ABdhPJwUOTjOGOp5I+4BBNerkhkILkJdvsYwAlETD8t8f2UdYp7Vpf2yvUZdOO5zBjWwqrWmkFDeN8FpYO/Mgrt4hgU= X-Received: by 2002:a05:6102:d94:: with SMTP id d20mr105390839vst.12.1637388173627; Fri, 19 Nov 2021 22:02:53 -0800 (PST) List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 References: <6e72c7e11f43c844f44b343f3aadf040@gundo.com> In-Reply-To: <6e72c7e11f43c844f44b343f3aadf040@gundo.com> From: Warner Losh Date: Fri, 19 Nov 2021 23:02:45 -0700 Message-ID: Subject: Re: CI Piplines To: Pau Amma Cc: freebsd-git Content-Type: multipart/alternative; boundary="00000000000072e48a05d1322496" X-Rspamd-Queue-Id: 4Hx2y61MDMz4j2L X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20210112.gappssmtp.com header.s=20210112 header.b=Nm2kS9T2; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::929) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [1.04 / 15.00]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20210112.gappssmtp.com:s=20210112]; FROM_HAS_DN(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-git@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20210112.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::929:from]; NEURAL_HAM_SHORT(-0.96)[-0.960]; NEURAL_SPAM_LONG(1.00)[1.000]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; RCVD_TLS_ALL(0.00)[]; RCVD_COUNT_TWO(0.00)[2] X-ThisMailContainsUnwantedMimeParts: Y --00000000000072e48a05d1322496 Content-Type: text/plain; charset="UTF-8" Sorry for my delay in replying... I've been extra busy at work... On Sat, Nov 13, 2021 at 12:16 PM Pau Amma wrote: > On 2021-11-12 21:24, Warner Losh wrote: > > The weekly meetings haven't been as productive as I'd have liked them > > to > > be. That tells me I need to try something else. That's another reason I > > skipped this week, but I'm planning on having one next week at the 1pm > > MST > > time slot (UTC 20:00). More details by Monday. > > I welcome this use of the mailing list as a medium for discussion, and I > hope it becomes the primary, and who knows maybe the only medium, since, > in addition to working across timezones and sleep cycles, it would > enable me to take part in discussions equally. (And before anyone trots > out that trope again, let me repeat: I am talking about ability to take > part at all, not taste or preference.) > Understood. > > First up on that list is before the commit testing. We can do a lot > > more. I > > have done work with other projects that have setup sophisticated > > pipelines > > to ensure that nothing is broken. We have a couple of github and Cirrus > > CI > > jobs defined in the tree for smoke testing, but it would be nice to > > have > > more. > > I had a look at https://github.com/freebsd/freebsd-ci/tree/master/jobs > and although I don't understand most of it, there seems to be 2 pieces > related to docs with different tests being run, FreeBSD-doc-main and > phabric-FreeBSD-doc-main. However, I haven't seen, in the nearly 2 years > since I've had a phabricator account, any evidence that uploading doc > diffs to it for review will trigger CI actions. > There's currently no triggers configured in phabricator to trigger a Jenkins run. All the Jenkins runs are done after the fact to ensure that the docs tree continues to build. > It would be nice IMO to have something that upon submitting or updating > a phabricator doc review (or maybe even before that, eg when committing > to a documenter's local git clone) would do some or all of: > - checking for AsciiDoc markup errors > - checking for bad link targets > - optionally, based on individual preferences and document language, > checking spelling > - rendering, at least to HTML > - checking the result against accessibility guidelines (ideally, this > would use the AsciiDoc source for ease of interpretation and correction > of problems, but most accessibility checkers I know of only deal with > HTML, and some checks, like color and contrast, are only possible when > HTML and CSS are both available) > - reporting to the author in near real-time (an email within a few > minutes would probably be enough) > > I don't know, however, whether that would take phabricator action, CI > action, or both. > Phabricator has the ability to kick off Jenkins runs. https://github.com/uber/phabricator-jenkins-plugin has what looks like the necessary plugin. And https://www.linkedin.com/pulse/using-phabricator-jenkins-git-continuous-automated-pre-commit-tayal has a walkthrough of setting it up. Would you be able to look into what it would take to apply those instructions to our phabricator setup? We have a 'test' phabricator setup that I think you can get access to if you wanted to try to do all the things listed above. Warner --00000000000072e48a05d1322496-- From nobody Sat Nov 20 06:14:33 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 5AC46189B0FD for ; Sat, 20 Nov 2021 06:14:44 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-ua1-x929.google.com (mail-ua1-x929.google.com [IPv6:2607:f8b0:4864:20::929]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hx3Ck0h6Rz4lb9 for ; Sat, 20 Nov 2021 06:14:41 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-ua1-x929.google.com with SMTP id az37so25586629uab.13 for ; Fri, 19 Nov 2021 22:14:41 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20210112.gappssmtp.com; s=20210112; h=mime-version:from:date:message-id:subject:to; bh=tPemCf66BbdHIp6zZWG6Q0yn7C47yp37C7BI52cOonk=; b=snI0lOd44+4V8liRlWvZujRGRNMEps3wTxs7RLn0WByU0vkNvEvmiDGNTqv0aS9YSC 7zaz82ZgKZCW6lwa0Dg0pfR/INF8x+/yJOT60/XEAM1e8kayEK6Jsow7AbMmVnRq+lb6 paTQBRs6Gpc5nKHUOgw3feFOhMq9wzKrvA6cR6nkLxIY+O60CKNDH0QYiybf/Zbnm6OA sa+jVM6xhkewXBVsyv6yQpjLtLEImQvDC5XyUfOnH6V2YgRjC5aEWtMjAuRyjKfvcb87 P2rEn6qNudTpXRwOQ2AfVxdW+2fIE0za2TTVKT55Bzq1QHD5Y2+n8pSfwTM+jZJ/k6Ul wUvg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=tPemCf66BbdHIp6zZWG6Q0yn7C47yp37C7BI52cOonk=; b=hJh8x1GkEBOTsY4BPlMqpHJTmwwzDRJe8KJw8lrz6qg6+Tyr9YlJBssW6B+aixTZFh PG12OLuspW6x/5xkhfxAQGP+1Z/pBgJ4Yx+JybH0FUEgKutzFCj0X0+hQV3pCra2DsrO Vb76gKbOYXKEYxmx3Nkb2ZOXsfbmBLn6bf6fzlh2btnwIWdgFl1w+jXOwlye8VF5EETK ojBoO5rTO5dyqPUq5U588U/nzPQQHDnjW8JpIoAsTfRUWGrbgkTkXFxzA57i5ZSPJRod ohzHWZzvpxSvmbeCa9pdG8qvobR5QCKUNlj+uk2opaGCOqZZjTL5orqYWpAKb8I+WAEH g/3Q== X-Gm-Message-State: AOAM5313klqtb9j8kpsIOFBeiwqu9L7mWREzs8IwIraojTfTHiU1Zyjr 1s1OPEm4OdOL34jaDS1FVf3ja88zRCkosyehOFMCVxeF2yE= X-Google-Smtp-Source: ABdhPJxdVcIT2CK7CQ8x+yGXQHmvTZG6wKW45vqLyVoNDXv9JlX/NF7mV4iWcr/6dOQjtlcIM7Hpv8JVEzUey5pLC2s= X-Received: by 2002:a05:6102:d94:: with SMTP id d20mr105466117vst.12.1637388880842; Fri, 19 Nov 2021 22:14:40 -0800 (PST) List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 From: Warner Losh Date: Fri, 19 Nov 2021 23:14:33 -0700 Message-ID: Subject: Short Term Focus To: freebsd-git Content-Type: multipart/alternative; boundary="0000000000009a22cc05d1324e3f" X-Rspamd-Queue-Id: 4Hx3Ck0h6Rz4lb9 X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20210112.gappssmtp.com header.s=20210112 header.b=snI0lOd4; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::929) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [1.68 / 15.00]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20210112.gappssmtp.com:s=20210112]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-git@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20210112.gappssmtp.com:+]; NEURAL_SPAM_LONG(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::929:from]; NEURAL_HAM_SHORT(-0.32)[-0.317]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; RCVD_TLS_ALL(0.00)[]; RCVD_COUNT_TWO(0.00)[2] X-ThisMailContainsUnwantedMimeParts: Y --0000000000009a22cc05d1324e3f Content-Type: text/plain; charset="UTF-8" Greetings, We had an impromptu discussion about pre-commit testing after the vendor summit today. We talked about different ways to split things up. There are a fair number of 'free' services that can be used to run CI pipelines. However, in general, they are best used for 'testing' or 'orchestration'. Large, intensive compute jobs (like for building FreeBSD) can be done occasionally, but will need to be offloaded from these services if there's a lot of builds since the limitations of the free services would be exhausted too quickly. We had a side conversation about optimization at this point. I presented David Chisnel's idea of creating a snapshot of 'yesterday's. build, and all pushes would use that to do a meta-mode build for the recent deltas and proposed changes. This idea was presented again later when others joined the call. While a good idea, there's a number of things that need to be done before we can optimize. The general consensus was the first steps would be to investigate building freebsd (multiple architectures) and running kyua (and maybe other) tests. This dovetails well with our Asia Timed meeting where Li-Wen, Philip and i discussed taking the current Jenkins scripts and adapting them to run in the cloud. There's a number of different means to do this. We have Azure credits, Oracle credits, and a few free things to stand up runners. We also can use the work Ed presented on terraform to interface to these different cloud providers so we can use it for runners to do the heavy lifting. This will also give us a number of choices for how to move jobs between different services as prices change, free offers are there, etc down the line. There's a number of different ways to kick off builds when changes are pushed. We have a little bit of that in github today, but it's used to kick off the Cirrus CI builds. We do kernel builds on pull requests, but only on Ubuntu and macOS. There's currently nothing done when a push happens to github. So Ed Maste, myself and John Baldwin will be looking at different aspects of expanding this integration (others are welcome to help). I'll be looking at gitlab kicking off the standard cirrus-ci builds we can get from github now (to compare and contrast). I'll also look at standing up other jobs that use the testing features of gitlab using the artifacts built part of the cirrus ci integration and maybe a few other checking things. There's a number of other software projects that I can crib from. Ed and John will be doing their experiments as well. And to be clear: others are welcome to run their own experiments to learn what's available, what we can use, how we can optimize. Mention was made of using the general github push hook that others have used in other projects that might be useful. We also talked about different ways to parameterize the CI pipeline so different pushes can get different levels of testing depending on things like gitlab CI variables. This is a very rich field, and there's a number of other areas that can be applied to FreeBSD's specific needs that aren't being explored. We'd love to hear from others that have done these things. Once these initial experiments are done, we're planning on getting together with anybody else that's done their own experiments and a few experts that have joined the group who have time to advise but not to experiment. To give people time, and to account for the US Thanksgiving holiday, we'll meet next on December 1th, again on December 15th and again January 5th to talk about the experiments, to plan next steps, etc. I'll send out meeting details. So I hope I've captured all we talked about, but it was a somewhat informal conversation that ranged over a number of areas not related to CI. If anybody else wants to add anything, please do. Warner --0000000000009a22cc05d1324e3f-- From nobody Sat Nov 20 09:14:39 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 7ABD8189212D for ; Sat, 20 Nov 2021 09:14:54 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic305-19.consmr.mail.gq1.yahoo.com (sonic305-19.consmr.mail.gq1.yahoo.com [98.137.64.82]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Hx7Cd2Qpwz4jKg for ; Sat, 20 Nov 2021 09:14:53 +0000 (UTC) (envelope-from marklmi@yahoo.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637399685; bh=gg/RkTbQwYrdtwbURvAT+fDowcR7Ci+4VtFmXlxPO4k=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=KZwB1bFm3bGkdWqThFxx6Jc8ajkyLXtImhGxT1nMx6PDqwmx1KNQJpSBePUMi8wvXfmZjc0gN1BtOs8veHa8d8JLq2j0D1Y7fO2x5j1tYeGlRfdb9bvar9sY5UdSTbiEfK13ZwlHEnA264QUsDoV7IfoB2RWRb9Sct7uabLY1iv7dxgXhflCYEL9vx5/rDfRwFTI7AgRL1B/x2IQGMa7H1YEPefcb94O+S8nJji2MZqmZixQtVHzqQVmrxzQNa3CtrYmDVrmqyfce6u8sRmBTpvnnsbHW1tg3BeqW5QgEKyqB+HzjUm6j48kwe3kmVjNGQw6GEU/TM8KCgwrbcXd2w== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637399685; bh=WCEl+nbRjA4+g2urAWPzBB7FHgmVOTjrCHZSlWx8ssu=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=VcrRYDxztWYeB11MzIX27ROJCUW3JMLfOWnxn/izN+IDJp9Yofrwy4/bZnnVSCR3YYp33k43yfwecr8poQMuKew7fTxVTRQmjkrha+OS1xumfTRiW1Y3UIzfSvlUaCMXWd4gbXRMRWc3/QFICi/hnHyhPHIBPTu3nGMYvSRaDazc5/IOhS72M8ciTnZ15RCOWgAbDFQsSpETRNwiBEQt2KYx5Kj+4tA4KouyOoCr+GSDUvaUscoRfS4wv/V5M1g+K9f0S2Ssg5m5cXYghFPVFRpn2npbD7J3twnKjnLUIfQF5RMyrpJRMyh7H3XAqPWeUuSaA0cBcbVFua65wGEsVw== X-YMail-OSG: D4wdB4UVM1nlvZEb9DrT8cgBkO0hjYTm5LgoeHsQSwDdm9z.c6mAaPatfhQQMsj KgCAklG8mCl5ZqWTg_FKzlLKmL6NuJ5MSPO8zp1VQU4uSg1M5k9qf26RTtOHlBAyMlvnuyFKSa.r ffl1F2z024MBQm5cXa5U9phxfg2YyF1Ky7RKzU6Nuz7tQY12PVfIu9g4lu10fvyA1n0TYjiistl0 I0tLJerwRQerOSWUu4wgj9pYMOirO95Z2iGsJJN7MBr0LqF5SlE3VuU8qQFVWjD_OZGbceRr_y4e mAadrmXpcCeT0D_H4ElMh0Z1se43yrt1BHBIgZuS.FzITVcIzbIT5DpCM3uWmP328aKb60OE44M3 ofBlWkXe8q7X4mGtIPLkn_hpVVMzTupuArsPEQMqNO5tdQol8PG.kEM5S94eHjrWmTj2m3mMr0vU M.7NIN0bZVLNN7eCUbL6KXupJ0LKVJuiEDWxC2UJY8wapYSfp7to0gVA3BbS0zfa5ZkTcSLyWmnD D824Hp0bLS_snggmO_JbjIbB3qqmoOPQ2JTVxzAS64QhOtOEipU_fHpEjMR_D.A_6eEHcO8EIOKr p7IOQpkYGp8JSQ.skL88A1Jc0swDk1rx935sb0Bulvf__wUt4WA_QhGQOlHLrko8gbSx9qVuTwn6 xD6B3f8CCYgDwc2HA3wG8alIdZQxwXE_Pe33cXxmTVo5KGIuxlXTBXqFuhBL9EaxPWJ.bad3kzTc paAALFgK5H40PwqFDMzsRSLuwU2g8okk8aEen_VbDKliWHkdcZItHAVd6ickcZuTWZQsdLUvCXZm RUJQFwa4knXsUq2gvqMb0fQsDxKKq5E5S2Cg1qTB_opZ8fIG652O0vFxKXt3N3hWCzy4M1KfAHDw 9e4pQdDAEvF8ywfoWhkARMJ98SuDmy9aOEmb3RE.VUf0hSbc_7L36itWLGNE5jX3jx.cihIYe0O2 Ua73ndeTfeTr087yEOkpaM2I1HC6URA8gryWyvAGrUMamiNT92HWzvgDaYDcIwWVmX1zh6vP6UyR osweuDLIlkU2MfcQV16v.JoeSYHC3fpcZG3o9Y__J4XVh9A8k1DamIQYPzMo.t9F9iKKtq8AOUMU 2WcUwJAJyGbGef8KldQf6dcvx3vnwh8DBzh.m737g0vT8kRFi5Uq2MkoZD1FhaPYr1oiO1uTvPyJ 3pJ46OfGenOPAoVL21KtY1R0K0nLcBlOd_H6JHtm8x3.B9Am2smrN1F78DDFmoIjZJQaanyjtNDf k0are9HsLF2yHueGS_LG.xBII4ZcauZP8l.pg9IsV9wnOce0JzAH8V2WcrrM9.JkLA7Dzm4ZawFf ZHEAk6fz9NSTMkWBsWI__rv2bwW6RUicwQx2B8v7ySCoPKWBxQMtjqFNeqrqTyKAIT.uglHw_oqI DLOiJnj7WeirAYVw3EhqWCf_miHzZQpifBpjOnOrCVsUTfxLM4C1u2OclGMdK5i5cM8Zb66ynxh_ UWLbacSrVaS5mGNYSvj7oML2h5Mpcj_Mc3FwzdZAH2lt17yRQRsMlmOVQE_6Rt2AGvj4qwSzBuKK N_N84ERpkXau9YIlXHteIa0Bkx4vRTeVgEeBZ6DGqX9IwZMjZYfh7N4fAbAKAwrFD10oBt6cB6S8 MRF.PlcbqlH5KCKSzjteY_hito4dEZQWujwHr9oPSMQ05xQFzd2hd4RMTZKX1x2MG2cyiinrbtpK 6QZJuUS5dtalkhXRyladHU541mQctUM3Ya3Q8Z6NXFAhkl2WxXObvIWTdOAW0Li6XfSBSiQ9Iplx TXr0KKBGnE9AEGe0Yh1SJlsHBxjD8bHWI6CDMsHX169RVBoR4eiTv1ke6O2rQODPUc12ipmM5127 VCHGfxkTct_5KIFO5cWC.AUkVDAXIEk1LaV2xLZ6SLKIDtqfJT49PVMkZqS8ZurPxlm8Kc.ESWVx tdUq7mBpwFHbEK8SEwR_.73Avd83gxBtTvPaWT.7dqMQQ0INJznpyvQljk1l8HU_32nzvhQwpuBH 5MgM02GWYtWIafSdZOBMb3NZULyaBVb8dMr1L_jRV5NAWiwJSYl1SYKNjcBKsjnNoa2uQFsx9zZ7 uh4xN3hx_GGGGD0E84i1LIXvlP__SkPKhNkvhpYjjHOvEnbEW_J0X5Q0xfefZOKqCoK_DU2EC1eW PtXoSi3CAe7neAphGzvvu5fwuxhzlksXtgD25Y.6E5LEyGAvGiWa0.Rs9f8FRfKTxwtSQbnJmeVc xbvnwWMiBQsXWPqmkQ20JyvUSn7NkiWLHEO8HteiHPdtE_l3Y0PR6DZl2M7pHbLhhWSSAoSEowpx uVUmIKUfSYnLZjyDYBw-- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic305.consmr.mail.gq1.yahoo.com with HTTP; Sat, 20 Nov 2021 09:14:45 +0000 Received: by kubenode545.mail-prod1.omega.gq1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID d7296dd7c01095d0c3e921a810d975a9; Sat, 20 Nov 2021 09:14:41 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: cgit, ages and chronological order In-Reply-To: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> Date: Sat, 20 Nov 2021 01:14:39 -0800 Cc: freebsd-git@freebsd.org Content-Transfer-Encoding: quoted-printable Message-Id: References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> To: Graham Perrin X-Mailer: Apple Mail (2.3654.120.0.1.13) X-Rspamd-Queue-Id: 4Hx7Cd2Qpwz4jKg X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=yahoo.com header.s=s2048 header.b=KZwB1bFm; dmarc=pass (policy=reject) header.from=yahoo.com; spf=pass (mx1.freebsd.org: domain of marklmi@yahoo.com designates 98.137.64.82 as permitted sender) smtp.mailfrom=marklmi@yahoo.com X-Spamd-Result: default: False [-1.50 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; FREEMAIL_FROM(0.00)[yahoo.com]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; FROM_HAS_DN(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.82:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.82:from]; RCVD_COUNT_TWO(0.00)[2] Reply-To: marklmi@yahoo.com From: Mark Millard via freebsd-git X-Original-From: Mark Millard X-ThisMailContainsUnwantedMimeParts: N On 2021-Nov-9, at 22:03, Graham Perrin wrote: > , = for example, is it normal for results to _not_ be in chronological = order? >=20 > (Has it always been so, have I never noticed?) >=20 If I gather correctly, a distinction is being made here between searches that result in tracking parent-commit order, with parents shown = (possibly only the "first-parents" path), vs. searches that need not display = various parent-commits (even omitting some first-parent ones). Ones that follow parent-commit order (those involving one of): ?qt=3Dgrep?q=3D ?qt=3Dauthor?q=3D ?qt=3Dcommiter?q=3D ?qt=3Drange?q=3D ?qt=3Drange?q=3DSOMETEXT (that is a correct range specification) (Those empty ?q=3D lead to being like https://cgit.freebsd.org/src/log/ = lists.) Ones that do not follow parent-commit order (because of what is omitted): Those with, ?qt=3Dgrep?q=3DSOMETEXT ?qt=3Dauthor?q=3DSOMETEXT ?qt=3Dcommiter?q=3DSOMETEXT For those last 3, I gather you would like the display order to be by the Age order. I've not figured out what the crtieria is for the order currently = displayed for these, with your specific example of https://cgit.freebsd.org/src/log/?qt=3Dgrep&q=3Dterminfo&h=3Dmain being a good example: The first line after the column title line being: * Remove parameter names from libzfs.h signatures Nick Black = 2020-01-09 1 -7/+7 is far from obvious to me. (One thing I do not know is how reasonable it would be to sort search results that have a huge number of lines to make the end results be in Age order.) Notes: I may not have listed all forms of ?qt=3D????q=3D???? that match = everything or a single subsequence of a parent-commit order vs. those that do not match such and so omit some partent-commits. Still, I hope the general point is clear. For this note, I'm ignoring the "time mismatch" issue. It appears that consideration of trying to avoid sizable mismatches is being made. (This would not fix already existing sizable mismatches, just prevent more.) =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From nobody Sun Nov 21 00:30:55 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4BC6718899EF for ; Sun, 21 Nov 2021 00:31:08 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic304-25.consmr.mail.gq1.yahoo.com (sonic304-25.consmr.mail.gq1.yahoo.com [98.137.68.206]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4HxWXq0mtXz4kK7 for ; Sun, 21 Nov 2021 00:31:07 +0000 (UTC) (envelope-from marklmi@yahoo.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637454659; bh=ufsAE0uevTDoL9Zl6y/rUFHcBeCXy44ynuLfFCZph54=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=GSgjkG6gDdypZSdF0oOcZfDqnNNHk+Jy/wc54vanBGH2fj1eKCSOI5Dxb48QH8CjmHbMPh8YvUxPyzOZrCQuLHS39YgwOIUWfAeZVvhj9fc69TMQVpnd9f70ZNGaxMlI23g8sNfb/v/O2zRP5rzuRyjndHZCdm0AfbuzF6FeIuKY1+ohtj6itEEBqmeGlIQaJJDOExFgUNZM6ctI2nZwi0968wJt9VQa2pHXVsWD7HVgFJ5TZEp5PnM315UbiryvxDpB1QVrQ2B/6NlTBurT2/UxPxjxIFZvMDYyWBA9rYLzxJvu/OEpND1kYuhGIQW6mDxHFGXzijbVSyBkaIbucA== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1637454659; bh=pDfPnW1jl7NMVYNmfx+algG5DkMdLZ9ZACH+1tPUpU9=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=WSgg7pxaPPYQtlAPW5JcwRyIm1FaHb06cd5CKjNr7hUErzX21M/z8M/6E1c6fq9R7wLqaeZNjSkRi88CYa75HXJ0hSLCad9k4v4CzJrhkqlC9q/ad93LUlO7LJkSllcy3iKMS7Eb/Jhq9GKkAzra+hSFNzpaMQYqJninDKm9JO7z1LLgkgW9sWZXD0878fI/AAeNscdD/5SjWVaaITrwEA8+KEEucIuTIDVgx3Ku+fEPTYP4xEj/V/JoVD+Gt4ns00rqLWgQChsqdxCmHB/KN9Vlq4q7KynExbOxUQ1dYBjABItHygqfDofdv7RXuvtRsS9hGKTeUv+CvvPrAtnWRg== X-YMail-OSG: Mu4PjqEVM1lboNate9Yg2zpqJ38BP273W4p0V9C4maGnQjFJd3GaPQ.swGH_boc aSb.6aBZBZ_VApHWOjksK3AWnIB2AilEPsX7tNbt9epai3SBd4kiYDDo8BXSjvv9F0PYhlEkTCj3 3yIRsgXjCiod5s.4_GCjAWUN8TDWMjF6.McXAmMoo778_cnjWTpx8iR1vSfKU0pQja5JF9PGQdxV 0LogcLyWOUu.G_NJw.3hxQ16DnKNRbEhYkTzOJp9EZt0QWKogS8SESAcJy68jYVacoNGa7SjbTdV WntYcn5FNhto0f5cO3wHtl435t6f5_Ytok4BPn1vzLVc.nh2EoQQzSf87m5ozB0IYNRynVxv3VUX zqcLt2k0ON1eXQ03byBPbSgI_2VT7_PKKSxawFW9X3BRsxrbPb_bdKr0HWsCdSnwIQTpi9meDUCf 8zqI45ZBSqWimqGjWeHyB.mzoBGGB7tgbfuIuiAynjKsTmnI1BJCFFKs3Iv2LtYPwYwjHQfNVaz9 2qyef8afSI.zvtMZXoh04NU_bVOhWtRkCOB4pSbsSlVnRvPP50PfEoxPYgYUEgEWGLj3VdpaX8hT Lox7QTX2v989L9qkL6BqEWzC5qEwpZVw9mJVbyUIN4YgQ9SugvmFTVbTypQXgB4tdlva0UH6_Jks ZQHBphUzBnNRdf2gNFKQ42i8Yt.nerauqlCXfJp.4_NeGhF5Matq2SM13z1vZf6QOFAZaBBSSAA3 FfE3rm5TBvGXF3ADoJ9vUFUJHBESkIVhRXsUj748qAYtwvUmwv719IxHrgKeKvZWbTKYSFITDgYf mEUgiFLC6HJCyZ3xJ04g1HLC.U0fRTmT.ZrsSIsWuqo98rwcqPBe36lv7TH9tA5HVqnrFNcI6b8w 4tHm3.1RDOcCrlFZDisT7RZ9RxSrwl7FedD1OFaHCywgUDww10SBnJbvArwQwkpK0pT1cqiSSGzA X3Rdm7ZQQV1h_4kLVIgqudp1AqRHSm2stKdWy5hrD_W7tFhOIBwOZ4keNKJd73J11QrA7GdRaSpx NFlKAQsVpFgi0fH73qhgjG8g9KdsXO4kpTStNM1zhhau._ZOw6RZsfjSb_LZ9mYlOnrP9k6zhuFt FmuO5vz2w1liDrf.InNLsuuv43EcdDKw0hP95fe4IIbJOGSQQMLoVVH3yxAmXZdEBw2Vz2.sB_Ny IvwHtynkBM8NNmGpv8yc7HHh34Sz7QaW8qo1EyhY4dpGEZRGMpgfJy5N.Tma_HpeWhWwekj1v76m rNmpSPgwGygjmHCFBwnvN1gbiaNfLC9Sf26Bc0_gAjJfSSFC6g3GgsdeoJg6MfZR2KdNzGZDzKDg aePywMpVyH9pw6BZuy.D6.U3aBv9hS3vFZqij2gbuTcPxxVMqnS64t2CpDKeuTW6QObkyJkrKuPR Oh_HLDcQiPhGAH15aEd2EyoaSRPEAlebOueGcH.O9BoN4OiKsU.1JJQBydLCQFtbRpioThCyORgr m8JPMI7y4EGxTUGObxrMt6N9eOcx6A1f4AQHUAAaEJYNzNHMBxTo7K3LD8_uZylXXMRFoTIryZ26 QPN2ZOPbpMAOU.7_wpSc3gZyKzPC3qsfpf_cY3wf2jW8MjNpTsqfzudICNa_1FeZo6Mqiq63tww. I6iobi.DVZ_ceS3gRRDua6GOrFJDsRO0ezLplEMLbYx.sSQrACk8KYBmTpg2xFXrguJpOgM9nOdc tKs.dSZUBj7MSnJUfaVa7UVrG5VbqmBqK3DBSX_VUfRJdlqfeZX2Cnvzq_cdhbDs9.az6_0YK.Nt VdQdxclHa0zs6fkHNHjCCkwlmOxXH3ni7ZmAS3zUk6rH3fHR7rvOsmhdK8aBuCT6dM9rDiO0pwcp ptphmbqLjY0Be7j3NeDJ3VstlV1vmrTHZ9NvFcl5flUVPPRTXTXZQ6ziPtdx9upY0nDR4eX4qSrh h2s0yfzjcS5SW6JbBAvHWwSALZV_4v_IYx9JxiJG0k3dMMn4RSWMbqfc9wS.KMlh5vHMpBVLrHFH wvykwQkf_39wXNWAeb_KbczW.UhW3ngYDrn6O69e20.BtgFuqDEpFIZmlmkfM11BJE5yO3ZwEcGB RkPmz.XBbti_LsYj9V83lX4e1wy4XppJkTP8eD7zCESUGXU66y.TaLmMUdhaWHCjXzprbtsGYofX uBrYd1ctkn4JgicYyakWdRLoHXDkN21PxIOkgEdMs_J_I3gbfZqKtKghubO9LnGueWbQV7mFZuLO ikI_00V9NH_RDtKX1Iyr6Luqor9vtDYyM4Vw4y8TvEXj4DUfJWk5A8yybUQXzZkUt1kUqP4i7YJd LJu.1SXMdFdhn2itPehyjmg57ZAfXGVd1I2TogVg- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic304.consmr.mail.gq1.yahoo.com with HTTP; Sun, 21 Nov 2021 00:30:59 +0000 Received: by kubenode523.mail-prod1.omega.gq1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID be10a373a5e4db89d04baf4f65308b32; Sun, 21 Nov 2021 00:30:56 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.120.0.1.13\)) Subject: Re: cgit, ages and chronological order In-Reply-To: Date: Sat, 20 Nov 2021 16:30:55 -0800 Cc: freebsd-git@freebsd.org Content-Transfer-Encoding: quoted-printable Message-Id: <413C1A06-F18B-4556-B11E-B04471BEC272@yahoo.com> References: <9766b3e1-fb5d-1993-46e2-057e2567315a@gmail.com> To: Graham Perrin X-Mailer: Apple Mail (2.3654.120.0.1.13) X-Rspamd-Queue-Id: 4HxWXq0mtXz4kK7 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=yahoo.com header.s=s2048 header.b=GSgjkG6g; dmarc=pass (policy=reject) header.from=yahoo.com; spf=pass (mx1.freebsd.org: domain of marklmi@yahoo.com designates 98.137.68.206 as permitted sender) smtp.mailfrom=marklmi@yahoo.com X-Spamd-Result: default: False [0.49 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; FREEMAIL_FROM(0.00)[yahoo.com]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.99)[0.988]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[98.137.68.206:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.68.206:from]; RCVD_COUNT_TWO(0.00)[2] Reply-To: marklmi@yahoo.com From: Mark Millard via freebsd-git X-Original-From: Mark Millard X-ThisMailContainsUnwantedMimeParts: N On 2021-Nov-20, at 01:14, Mark Millard wrote: > On 2021-Nov-9, at 22:03, Graham Perrin wrote: >=20 >> , = for example, is it normal for results to _not_ be in chronological = order? >>=20 >> (Has it always been so, have I never noticed?) >>=20 >=20 > If I gather correctly, a distinction is being made here between = searches > that result in tracking parent-commit order, with parents shown = (possibly > only the "first-parents" path), vs. searches that need not display = various > parent-commits (even omitting some first-parent ones). >=20 > Ones that follow parent-commit order (those involving one of): >=20 > ?qt=3Dgrep?q=3D > ?qt=3Dauthor?q=3D > ?qt=3Dcommiter?q=3D > ?qt=3Drange?q=3D > ?qt=3Drange?q=3DSOMETEXT (that is a correct range specification) >=20 > (Those empty ?q=3D lead to being like = https://cgit.freebsd.org/src/log/ lists.) >=20 > Ones that do not follow parent-commit order (because of > what is omitted): Those with, >=20 > ?qt=3Dgrep?q=3DSOMETEXT > ?qt=3Dauthor?q=3DSOMETEXT > ?qt=3Dcommiter?q=3DSOMETEXT >=20 > For those last 3, I gather you would like the display order to be by = the > Age order. Well, those 3 are not complete coverage for cgit: Using something like, https://cgit.freebsd.org/src/log/sys/contrib/openzfs also filters out parent-commit lines and will show things that are not on a specific branch (at the time). An example is:=20 Revert "Handle partial reads in zfs_read" where on main the actual patch that covers the issue shows up in: zfs: merge openzfs/zfs@6c8f03232 (master) into main instead and the branch's parent-commit sequencing does not include the "Revert" one. (The "Revert" one was a FreeBSD-local commit from what I can tell, pending the actual openzfs fix.) (The specific example page happens to show lines sorted by Age currently. But this may be an accident.) > I've not figured out what the crtieria is for the order currently = displayed > for these, with your specific example of > https://cgit.freebsd.org/src/log/?qt=3Dgrep&q=3Dterminfo&h=3Dmain = being > a good example: The first line after the column title line being: >=20 > * Remove parameter names from libzfs.h signatures Nick Black = 2020-01-09 1 -7/+7 >=20 > is far from obvious to me. >=20 > (One thing I do not know is how reasonable it would be to sort search > results that have a huge number of lines to make the end results be in > Age order.) >=20 > Notes: >=20 > I may not have listed all forms of ?qt=3D????q=3D???? that match = everything > or a single subsequence of a parent-commit order vs. those that do not > match such and so omit some partent-commits. Still, I hope the general > point is clear. >=20 > For this note, I'm ignoring the "time mismatch" issue. It appears that > consideration of trying to avoid sizable mismatches is being made. > (This would not fix already existing sizable mismatches, just prevent > more.) =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From nobody Thu Nov 25 23:21:24 2021 X-Original-To: freebsd-git@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 73CE318AE8F6 for ; Thu, 25 Nov 2021 23:21:35 +0000 (UTC) (envelope-from pauamma@gundo.com) Received: from mail.gundo.com (gibson.gundo.com [75.145.166.65]) by mx1.freebsd.org (Postfix) with ESMTP id 4J0YmG3SfTz3nY4 for ; Thu, 25 Nov 2021 23:21:34 +0000 (UTC) (envelope-from pauamma@gundo.com) Received: from webmail.gundo.com (variax.gundo.com [75.145.166.70]) by mail.gundo.com (Postfix) with ESMTP id AAB634C5005; Thu, 25 Nov 2021 17:21:27 -0600 (CST) List-Id: Discussion of git use in the FreeBSD project List-Archive: https://lists.freebsd.org/archives/freebsd-git List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-git@freebsd.org MIME-Version: 1.0 Date: Thu, 25 Nov 2021 23:21:24 +0000 From: Pau Amma To: Warner Losh Cc: freebsd-git Subject: Re: CI Piplines In-Reply-To: References: <6e72c7e11f43c844f44b343f3aadf040@gundo.com> User-Agent: Roundcube Webmail/1.4.8 Message-ID: X-Sender: pauamma@gundo.com Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4J0YmG3SfTz3nY4 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pauamma@gundo.com designates 75.145.166.65 as permitted sender) smtp.mailfrom=pauamma@gundo.com X-Spamd-Result: default: False [-2.84 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEFALL_USER(0.00)[pauamma]; FROM_HAS_DN(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[75.145.166.65:from]; R_SPF_ALLOW(-0.20)[+a]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[gundo.com]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; RCVD_IN_DNSWL_MED(-0.20)[75.145.166.65:from]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.44)[-0.438]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7922, ipnet:75.144.0.0/13, country:US]; RCVD_COUNT_TWO(0.00)[2]; MID_RHS_MATCH_FROM(0.00)[] X-ThisMailContainsUnwantedMimeParts: N On 2021-11-20 06:02, Warner Losh wrote: > On Sat, Nov 13, 2021 at 12:16 PM Pau Amma wrote: > >> It would be nice IMO to have something that upon submitting or >> updating >> a phabricator doc review (or maybe even before that, eg when >> committing >> to a documenter's local git clone) would do some or all of: >> - checking for AsciiDoc markup errors >> - checking for bad link targets >> - optionally, based on individual preferences and document language, >> checking spelling >> - rendering, at least to HTML >> - checking the result against accessibility guidelines (ideally, this >> would use the AsciiDoc source for ease of interpretation and >> correction >> of problems, but most accessibility checkers I know of only deal with >> HTML, and some checks, like color and contrast, are only possible when >> HTML and CSS are both available) >> - reporting to the author in near real-time (an email within a few >> minutes would probably be enough) >> >> I don't know, however, whether that would take phabricator action, CI >> action, or both. > > Phabricator has the ability to kick off Jenkins runs. > https://github.com/uber/phabricator-jenkins-plugin > has what looks like the necessary plugin. And > https://www.linkedin.com/pulse/using-phabricator-jenkins-git-continuous-automated-pre-commit-tayal > has a walkthrough of setting it up. Would you be able to look into what > it > would take > to apply those instructions to our phabricator setup? We have a 'test' > phabricator > setup that I think you can get access to if you wanted to try to do all > the > things > listed above. Thanks for the links. I had a first look at the plugin, and https://github.com/uber/phabricator-jenkins-plugin#jenkins-setup says some of the configuration is on the Jenkins side, not the Phabricator side. So my first question is: does FreeBSD have a Jenkins sandbox as well? (If you don't know, who does?) And who do I ask for access to the Phabricator sandbox? phab-admin@, phabric-admin@, or whatever the email address for the Phabricator admin people is? I also skimmed through https://www.linkedin.com/pulse/using-phabricator-jenkins-git-continuous-automated-pre-commit-tayal which seems to use a similar method, except it relies on Github instead of the plugin, so I'm setting it aside unless and until FreeBSD goes that route.