From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 01:33:41 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 01911F08 for ; Sun, 5 Apr 2015 01:33:40 +0000 (UTC) Received: from mail-ob0-x22a.google.com (mail-ob0-x22a.google.com [IPv6:2607:f8b0:4003:c01::22a]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id C63ABFFF for ; Sun, 5 Apr 2015 01:33:40 +0000 (UTC) Received: by obbec2 with SMTP id ec2so3380981obb.3 for ; Sat, 04 Apr 2015 18:33:40 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:sender:in-reply-to:references:date:message-id:subject :from:to:cc:content-type; bh=0htRp3R6GgkNSdN1pwKgdXgtcJuxCMTI1yvm7Tn6HNo=; b=MuRt7IDdV715OVEhrqJgT6csIZTK23udG6elL1wAQ3WiyLIBAtScC6aY07NVo1m95R mNeYhWrVB27iQ2h95nQu07qYlzvu6ijuy0zbx8uB5SpQNECVLkw2EYhCzf3XF4X6Y+Ao jl8CAyCAjAZE1gE6g800LAdUrFHcjYzzMnPiAuf20M4YftSLhfU+PLiXu2Bz6ARtD6tf AG+RwBcxi46kKjQB+jJVEZYLQ3Kx6PpltKeQLCBpTldnb901CXRJ+psKC+RFPJgHtq2g rQ5DL4yTliw+kD/v1KT4Npy5aQ8sw6eWcf0FMkYBaJDgrvaLQXfYY/KOHjddxkW9+V/b rtlQ== MIME-Version: 1.0 X-Received: by 10.60.54.37 with SMTP id g5mr10721618oep.43.1428197619970; Sat, 04 Apr 2015 18:33:39 -0700 (PDT) Sender: robbak@gmail.com Received: by 10.76.145.9 with HTTP; Sat, 4 Apr 2015 18:33:39 -0700 (PDT) In-Reply-To: <1428165370116-6002716.post@n5.nabble.com> References: <1428165370116-6002716.post@n5.nabble.com> Date: Sun, 5 Apr 2015 11:33:39 +1000 X-Google-Sender-Auth: d9wn72W4viVoVYShXG-mtZxqFL4 Message-ID: Subject: Re: Blender 2.74 cannot compile on FreeBSD 10.1 From: Robert Backhaus To: pipolandi Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: Freebsd_mailinglist_PORTS X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 01:33:41 -0000 To get the simple things out of the road - you have reinstalled libraw, and checked that libraw_r.so.9 is in /usr/local/lib? This error tells me that your install of libOpenImageIO.so.1.4 is faulty, so you should also rebuild the port that includes that (pkg which `locate \*libOpenImageIO.so.1.4`) On 5 April 2015 at 02:36, pipolandi wrote: > I forgot to say that libraw is installed. > > > > -- > View this message in context: > http://freebsd.1045724.n5.nabble.com/Blender-2-74-cannot-compile-on-FreeBSD-10-1-tp6002715p6002716.html > Sent from the freebsd-ports mailing list archive at Nabble.com. > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 05:14:45 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 5F9287AC; Sun, 5 Apr 2015 05:14:45 +0000 (UTC) Received: from mail-ie0-x232.google.com (mail-ie0-x232.google.com [IPv6:2607:f8b0:4001:c03::232]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 210D79E0; Sun, 5 Apr 2015 05:14:45 +0000 (UTC) Received: by ierf6 with SMTP id f6so3174598ier.2; Sat, 04 Apr 2015 22:14:44 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:sender:in-reply-to:references:date:message-id:subject :from:to:cc:content-type; bh=z8B8FXsE3taRc205GliPsqP1ITbfJRzbhTZTJuYzkdg=; b=m+gvAov7eJ9HjLBGASuj22UWiQrJQFwsjWYZwo54e8AF4kCBePxF3Lr0/ZEL1vQuiy jRWjmwKRTpowiuHCi4unCJwar5vIaUvG4OZVOBDDWp2pK1Y8zy1cYFWooLmrI7qjhOLX oie3zRnjMKb4WEBKfDi8bR+HY+IGrZnBccxrrxiB9LDdCnFr1zRTjg5yO9eGG5FR0F/e GMWFMTHyw8wb67LBWDHBasUqOKnSctPKkk65X/Y9Zsa7pNW2iL64IA8F+tn97x2sGYtS VcIM+os+xFm/eHexuRM2Siff+jaz7XP5C4YOVDDiagJDsCXHMgyXULsHjzdrCrgMnkUy S9CQ== MIME-Version: 1.0 X-Received: by 10.42.99.80 with SMTP id v16mr5463161icn.4.1428210884495; Sat, 04 Apr 2015 22:14:44 -0700 (PDT) Sender: kob6558@gmail.com Received: by 10.107.174.86 with HTTP; Sat, 4 Apr 2015 22:14:44 -0700 (PDT) In-Reply-To: References: <49565FCAB7E8FD98176737C0@atuin.in.mat.cc> Date: Sat, 4 Apr 2015 22:14:44 -0700 X-Google-Sender-Auth: 2bp1qL0H_QrY7qM99eGljQZT9jQ Message-ID: Subject: Re: How do I specify port opt1 requires opt2 From: Kevin Oberman To: Mathieu Arnold Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: Ben Woods , FreeBSD ports X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 05:14:45 -0000 On Sat, Apr 4, 2015 at 1:51 AM, Mathieu Arnold wrote: > +--On 3 avril 2015 20:06:09 -0700 Kevin Oberman > wrote: > | On Fri, Apr 3, 2015 at 11:51 AM, Mathieu Arnold wrote: > | > |> > |> > |> +--On 3 avril 2015 05:46:45 +0000 Ben Woods wrote: > |> | I am working on modifying a port, and was wondering how do I specify > |> | that selecting port option1 requires that option2 is also selected? > |> | > |> | Note that in my example it is perfectly acceptable to have option2 > |> | selected without option1. > |> > |> This functionnality is coming, it's being discussed in > |> but for now, > |> you'll have to do some testing in your Makefile and either add an IGNORE > |> or force the other option. > |> > |> -- > |> Mathieu Arnold > |> > | > | What I have done in the past is to put "(Forces option OPTION)" in the > | description line and then either set opt2 in the IF block for opt1 or > | simply set the opt2 flag, if that is all opt2 requires, in that block. > > But that means you'll need to include bsd.port.options.mk, which will have > to parse bsd.port.mk a second time, which is slow. And also, that you're > not using options helpers. > > -- > Mathieu Arnold > This is what happens when you have not ported anything that required anything beyond the basics since the "new" OPTIONS system came into place. Clearly, you are right in the case of forcing opt2, but, if all opt2 does is set an option for configure or something similarly trivial, that does not look to me like it would incur these problems. (I have no idea if it does.) -- Kevin Oberman, Network Engineer, Retired E-mail: rkoberman@gmail.com From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 05:29:54 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 13B0EADC for ; Sun, 5 Apr 2015 05:29:54 +0000 (UTC) Received: from fed1rmfepi204.cox.net (fed1rmfepi204.cox.net [68.230.241.149]) by mx1.freebsd.org (Postfix) with ESMTP id CB328AE5 for ; Sun, 5 Apr 2015 05:29:53 +0000 (UTC) Received: from fed1rmimpo109 ([68.230.241.158]) by fed1rmfepo203.cox.net (InterMail vM.8.01.05.15 201-2260-151-145-20131218) with ESMTP id <20150405051947.PGWL11247.fed1rmfepo203.cox.net@fed1rmimpo109> for ; Sun, 5 Apr 2015 01:19:47 -0400 Received: from [10.0.0.174] ([68.5.91.177]) by fed1rmimpo109 with cox id C5Km1q00D3pbclw015Km0E; Sun, 05 Apr 2015 01:19:46 -0400 X-CT-Class: Clean X-CT-Score: 0.00 X-CT-RefID: str=0001.0A020201.5520C5F3.0015,ss=1,re=0.001,fgs=0 X-CT-Spam: 0 X-Authority-Analysis: v=2.0 cv=PPrRD4WC c=1 sm=1 a=q2PrEUkHZ5fsldPS+ugKpg==:17 a=IkcTkHD0fZMA:10 a=kviXuzpPAAAA:8 a=sFttYRdPAAAA:8 a=1-2m3FMdAAAA:8 a=ZLWiX-1ReAnwXlrcCdAA:9 a=QEXdDO2ut3YA:10 a=q2PrEUkHZ5fsldPS+ugKpg==:117 X-CM-Score: 0.00 Authentication-Results: cox.net; auth=pass (LOGIN) smtp.auth=rrking949@cox.net Message-ID: <1428211186.18818.1.camel@acer.investineering.com> Subject: FreeBSD Port: evolution-3.12.11 From: "Randall R. King" Reply-To: rrking@member.ams.org To: gnome@FreeBSD.org Date: Sat, 04 Apr 2015 22:19:46 -0700 Organization: Investineering, Inc. Content-Type: text/plain; charset="UTF-8" X-Mailer: Evolution 3.8.5 (3.8.5-22.el7_0.1) Mime-Version: 1.0 Content-Transfer-Encoding: 7bit Cc: ports@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 05:29:54 -0000 Hi, A quick note to let you know that I had difficulty restoring data from a backup (whatever version was running under FreeBSD 9.2). After a careful look at the debug messages, it looked like the tar commands used in the restoration used the option --strip-components=3 (or 2), and the tar command barfed on that option (the '=' sign should be a space). Hiding tar and linking tar to gtar fixed the problem. Perhaps the script(s) for restoration should either lose the equal sign on the --strip-components option or use gtar instead of tar? Sincerely, Randall R. King From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 06:56:12 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 72C6E649; Sun, 5 Apr 2015 06:56:12 +0000 (UTC) Received: from mail-pa0-x229.google.com (mail-pa0-x229.google.com [IPv6:2607:f8b0:400e:c03::229]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 3FE0D283; Sun, 5 Apr 2015 06:56:12 +0000 (UTC) Received: by paboj16 with SMTP id oj16so10625277pab.0; Sat, 04 Apr 2015 23:56:11 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=message-id:subject:from:to:cc:date:in-reply-to:references :content-type:mime-version:content-transfer-encoding; bh=nB8Oj8HXLEN/AxuQ9LRwUYpyuUFOveGsHV2em99jOII=; b=OA14PM71gyf2m4xw0GDv2GPBPsVhI9XSmnIDdOLDzVOgnAwT86Dhi5Oa91fi0WaxYD z5LZxtlyFwW2yBaYNGpscHEbHCnZQNx+rfW1cxuqCUkFQD+nLRco/ilsMM9Qyi89U/t6 KQlHQi3njfZxJ0PDF9UKAdsGrExwFRUjJwvzbMXa6MvyxccO3ASeVRhTgGd8L1MNUHa7 wNYSRHQHSC+2Z8obwbxrE+DmIT8fcVOCbJRbdNfGl6wuQeouZQw5na6YO2rrjCRwx4V+ caH7krVbnuQyws1JRObFGwXA/v8YPU1JmmnEswXNyakhyzDdXA+4Gina0t31NnJ09+A3 +vHg== X-Received: by 10.68.225.162 with SMTP id rl2mr17394896pbc.117.1428216971704; Sat, 04 Apr 2015 23:56:11 -0700 (PDT) Received: from [192.168.1.92] ([175.181.43.117]) by mx.google.com with ESMTPSA id wt1sm751932pbc.76.2015.04.04.23.56.10 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Sat, 04 Apr 2015 23:56:11 -0700 (PDT) Message-ID: <1428216958.83748.5.camel@gmail.com> Subject: Re: FreeBSD Port: evolution-3.12.11 From: Ting-Wei Lan To: rrking@member.ams.org Date: Sun, 05 Apr 2015 14:55:58 +0800 In-Reply-To: <1428211186.18818.1.camel@acer.investineering.com> References: <1428211186.18818.1.camel@acer.investineering.com> Content-Type: text/plain; charset="UTF-8" X-Mailer: Evolution 3.17.1 Mime-Version: 1.0 Content-Transfer-Encoding: 8bit Cc: gnome@FreeBSD.org, ports@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 06:56:12 -0000 於 六,2015-04-04 於 22:19 -0700,Randall R. King 提到: > Hi, > > A quick note to let you know that I had difficulty restoring data from a > backup (whatever version was running under FreeBSD 9.2). After a careful > look at the debug messages, it looked like the tar commands used in the > restoration used the option --strip-components=3 (or 2), and the tar > command barfed on that option (the '=' sign should be a space). Hiding > tar and linking tar to gtar fixed the problem. Perhaps the script(s) for > restoration should either lose the equal sign on the --strip-components > option or use gtar instead of tar? Thanks for finding the cause of the bug. Does the following patch work for you? If yes then I will file an upstream bug report with this patch attached. diff --git a/modules/backup-restore/evolution-backup-tool.c b/modules/backup -restore/evolution-backup-tool.c index 9604513..3eef5f9 100644 --- a/modules/backup-restore/evolution-backup-tool.c +++ b/modules/backup-restore/evolution-backup-tool.c @@ -538,13 +538,13 @@ restore (const gchar *filename, g_mkdir_with_parents (e_get_user_config_dir (), 0700); command = g_strdup_printf ( - "cd $DATADIR && tar xzf %s %s --strip-components=%d", + "cd $DATADIR && tar --strip-components %d -xzf %s %s", quotedfname, data_dir, get_dir_level (data_dir)); run_cmd (command); g_free (command); command = g_strdup_printf ( - "cd $CONFIGDIR && tar xzf %s %s --strip-components=%d", + "cd $CONFIGDIR && tar --strip-components %d -xzf %s %s", quotedfname, config_dir, get_dir_level (config_dir)); run_cmd (command); g_free (command); > > Sincerely, > Randall R. King > > _______________________________________________ > freebsd-gnome@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-gnome > To unsubscribe, send any mail to "freebsd-gnome-unsubscribe@freebsd.org" > From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 08:38:07 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id CE19ED75; Sun, 5 Apr 2015 08:38:07 +0000 (UTC) Received: from mail-wg0-x229.google.com (mail-wg0-x229.google.com [IPv6:2a00:1450:400c:c00::229]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 5A5F5E15; Sun, 5 Apr 2015 08:38:07 +0000 (UTC) Received: by wgin8 with SMTP id n8so6029738wgi.0; Sun, 05 Apr 2015 01:38:05 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc:content-type; bh=YO66QvuEnpbqXc7+9WzXuLDJ6QwiLOL3juCEQHC7u5U=; b=WtE74KIbNLd5iCBlKLXN7Dj20fuyrfvJ3SdExiUTfpxEPyrMtCsDx8d0Ih7fwp+TsI teSw3/sEmzW//lilsxyqVg/6h7ODc7UMsi9uefoq32lS+aQy/JbfDN3uCz5MHC4guKyI dAH/xNQB5Zc0f4/HkHzhmndmbjm/WzvSQBmZ1SVd3QW+kXO2z3ZBo+/9U5AQwdmq93Fm XF68gijreXIXabqoBrNf2mJ+gWrLSIK4x+/iZdr4yGWQ7XUktoOVspvPMpYwFRfBJbDi C9U62QHYEob6UJry+c5NWGFLIN3KDxhH04OfPh24v2pydprB9iF2FuBYqBbbZhP1hScK Sx0w== X-Received: by 10.194.75.168 with SMTP id d8mr21049139wjw.87.1428223085803; Sun, 05 Apr 2015 01:38:05 -0700 (PDT) MIME-Version: 1.0 References: <1428165370116-6002716.post@n5.nabble.com> In-Reply-To: From: Ben Woods Date: Sun, 05 Apr 2015 08:38:05 +0000 Message-ID: Subject: Re: Blender 2.74 cannot compile on FreeBSD 10.1 To: Robert Backhaus , pipolandi , FreeBSD@shaneware.biz, mva@freebsd.org Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: Freebsd_mailinglist_PORTS X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 08:38:08 -0000 The graphics/libraw package installs /usr/local/lib/libraw_r.so.10, not libraw_r.so.9 so it will not be detected. See the pkg-plist for graphics/libraw here: https://svnweb.freebsd.org/ports/head/graphics/libraw/pkg-plist?revision=379518&view=markup The interesting thing is that whilst graphics/blender depends on the graphics/openimageio library, neither depend on the graphics/libraw library. It might be worth asking the port maintainers for graphics/blender and graphics/openimageio if they have come across this before. I have added mva@FreeBSD.org and FreeBSD@Shaneware.biz to the recipients of this email to check with them. Regards, Ben On Sun, Apr 5, 2015 at 9:33 AM Robert Backhaus wrote: > To get the simple things out of the road - you have reinstalled libraw, and > checked that libraw_r.so.9 is in /usr/local/lib? > > This error tells me that your install of libOpenImageIO.so.1.4 is faulty, > so you should also rebuild the port that includes that (pkg which `locate > \*libOpenImageIO.so.1.4`) > > On 5 April 2015 at 02:36, pipolandi wrote: > > > I forgot to say that libraw is installed. > > > > > > > > -- > > View this message in context: > > http://freebsd.1045724.n5.nabble.com/Blender-2-74- > cannot-compile-on-FreeBSD-10-1-tp6002715p6002716.html > > Sent from the freebsd-ports mailing list archive at Nabble.com. > > _______________________________________________ > > freebsd-ports@freebsd.org mailing list > > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > > > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 11:01:34 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 1D0DF8D7; Sun, 5 Apr 2015 11:01:34 +0000 (UTC) Received: from mx.tetcu.info (mx.tetcu.info [217.19.15.179]) by mx1.freebsd.org (Postfix) with ESMTP id 3AE54D53; Sun, 5 Apr 2015 11:01:33 +0000 (UTC) Received: from it.tim.tetcu.info (5-12-108-124.residential.rdsnet.ro [5.12.108.124]) (using TLSv1 with cipher AES128-SHA (128/128 bits)) (No client certificate requested) by mx.tetcu.info (Postfix) with ESMTPSA id 7711D2BF8B6; Sun, 5 Apr 2015 14:07:56 +0300 (EEST) Date: Sun, 5 Apr 2015 14:01:24 +0300 From: Ion-Mihai Tetcu To: Baptiste Daroussin Subject: Re: Share your pkg aliases Message-ID: <20150405140124.3a879cae@it.tim.tetcu.info> In-Reply-To: <20150402201909.GD30115@ivaldir.etoilebsd.net> References: <20150402201909.GD30115@ivaldir.etoilebsd.net> X-Mailer: Claws Mail 3.11.1 (GTK+ 2.24.27; amd64-portbld-freebsd10.1) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit Cc: pkg@FreeBSD.org, ports@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 11:01:34 -0000 On Thu, 2 Apr 2015 22:19:10 +0200 Baptiste Daroussin wrote: > Hi, > > For pkg 1.5.0 we do plan to provide a default pkg.conf full of useful > aliases, of course this is subjective, if you think you have added > some useful aliases into your pkg.conf please share those so we can > add them directly into the next release. options: query -i "%n - %Ok: %Ov", roptions: rquery -i "%n - %Ok: %Ov", comment: query -i "%c", desc: query -i "%e", roptions is particularly useful to see if the default options fit one's needs (either on the initial install or on an upgrade when OPTIONS changed). -- IOnut - Un^d^dregistered ;) FreeBSD "user" "Intellectual Property" is nowhere near as valuable as "Intellect" FreeBSD committer -> itetcu@FreeBSD.org, PGP Key ID 29597D20 From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 14:45:13 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 77AD3C2F for ; Sun, 5 Apr 2015 14:45:13 +0000 (UTC) Received: from smtp.laposte.net (smtpoutz13.laposte.net [194.117.213.172]) (using TLSv1.1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 24BB2346 for ; Sun, 5 Apr 2015 14:45:12 +0000 (UTC) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout001 (Postfix) with ESMTP id 995E44E41E82 for ; Sun, 5 Apr 2015 16:45:02 +0200 (CEST) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout001 (Postfix) with ESMTP id 7D8074E41EAD for ; Sun, 5 Apr 2015 16:45:02 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail1; t=1428245102; bh=1I8CKE0JpkI32uChZlx0AP4xSP9V2XHFB6tXu5g75pY=; h=Date:From:To:In-Reply-To:Subject; b=fvLLtwjZIM5DDVqNF8Izs46zB0pxAlwHh4BBxHB04EptZJPgb2cEF7FdJuMVoeUSl Npv5YLZefTYBikMTaMELiYvqMpgibKIeUr0+9Dth2iB7U34bUvU+3SFLaRlX2wSd3/ 7voSGa67cUXnN2MuCy4Rj81iFTkA5T5Xm8bVsOT5oAjXXQODDWXFaa6QmX0v6AC8+I H14CMNDH0Z6ruqFg3Gmbp7C0EaECotEYKglBeXq30LeTmV7jgAzn5cBjUrknxsVeKS L5VZfKS8R0sesOzzEycu2TvgmRMQIDu/a/mbITLbIM4gMlwKPcJjFoIkmQzFuvQfiB hUJLsX9W0GMhQ== Received: from lpn-prd-mstr045.laposte (lpn-prd-mstr045.laposte [10.128.59.46]) by lpn-prd-vrout001 (Postfix) with ESMTP id 68EB54E41E82 for ; Sun, 5 Apr 2015 16:45:02 +0200 (CEST) Date: Sun, 5 Apr 2015 16:45:02 +0200 (CEST) From: philippe.rodride@laposte.net To: ports@FreeBSD.org Message-ID: <1381759458.42839263.1428245102313.JavaMail.zimbra@laposte.net> In-Reply-To: <95378932.42835849.1428244873533.JavaMail.zimbra@laposte.net> Subject: pipelight update MIME-Version: 1.0 X-Originating-IP: [82.124.158.241] X-Mailer: Zimbra 8.0.6_GA_5922 (ZimbraWebClient - FF37 ([unknown])/La Poste) Thread-Topic: pipelight update Thread-Index: kILk+OQ+qi0Jd2MWVKorDskGxw45iQ== X-VR-SrcIP: [82.124.158.241] X-VR-FullState: 0 X-VR-Score: 0 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeektddrvdeigdejlecutefuodetggdotefrucfrrhhofhhilhgv X-VR-Cause-2: mecunfetrffquffvgfenuceurghilhhouhhtmecuhedttdenucenucfjughrpeffhffvkfgjufggtghi X-VR-Cause-3: ofhtsegrtdgtsgertdejnecuhfhrohhmpehphhhilhhiphhpvgdrrhhoughrihguvgeslhgrphhoshht X-VR-Cause-4: vgdrnhgvthenucfrrghrrghmpehmohguvgepshhmthhpohhuthdphhgvlhhopehlphhnqdhprhguqdhm X-VR-Cause-5: shhtrhdtgeehrdhprhhoshhoughivgdpihhnvghtpedutddruddvkedrheelrdegiedpmhgrihhlfhhr X-VR-Cause-6: ohhmpehphhhilhhiphhpvgdrrhhoughrihguvgeslhgrphhoshhtvgdrnhgvthdprhgtphhtthhopehp X-VR-Cause-7: ohhrthhssefhrhgvvgeuufffrdhorhhg X-VR-AvState: No X-VR-State: 0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 14:45:13 -0000 Hi, I've installed pipelight 0.2.7.3_7 from the ports and i encounter some problems. It is possible to know when a new version (0.2.8.x) will be available ? Thanks. Philippe R. From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 17:15:36 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 85B50ABF; Sun, 5 Apr 2015 17:15:36 +0000 (UTC) Received: from mail-qk0-x22b.google.com (mail-qk0-x22b.google.com [IPv6:2607:f8b0:400d:c09::22b]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 3D38C298; Sun, 5 Apr 2015 17:15:36 +0000 (UTC) Received: by qku63 with SMTP id 63so9249768qku.3; Sun, 05 Apr 2015 10:15:35 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:reply-to:in-reply-to:references:date:message-id :subject:from:to:cc:content-type; bh=BYN2nBVV07B5cek7PAQOcP/bh6A8VigwLEClhPKMg+4=; b=CGbDeNhzviN4NLMacny/k4waPcKKDhipeNGwcH6APLKVsL1YaVfI2oRRXgzTIYeQ/k u3GiTT/6WKh8qxsJz14iyXI6zhA1lGcolwCx1Voz5HwvR3ufnCWGipA6L5K6REv0DRRi DV5p96Qhu9StV7FlJ888qR6cyyQTaskTXsrIhFOCXTTNVt3Y/FfQ2ALccTbq03tIbohH MpXypuu/fbTxc/bX155iL9EN1Rr+3rE6ayGmb80INJBf4/z6rw5DIfCAHEEiQ0WhYiBb xQioM+dJgxCERT1yamZKMwuBJ1+MhbYB3hNSL0dnxnThlc+ckENPAiVO192+gLLLrqlq Pz2g== MIME-Version: 1.0 X-Received: by 10.55.25.34 with SMTP id k34mr21569119qkh.12.1428254135361; Sun, 05 Apr 2015 10:15:35 -0700 (PDT) Received: by 10.96.82.225 with HTTP; Sun, 5 Apr 2015 10:15:35 -0700 (PDT) Reply-To: spil.oss@gmail.com In-Reply-To: <1427983680.2035836.248559593.5ED876C6@webmail.messagingengine.com> References: <551C5C4C.5090707@rawbw.com> <551C615D.8050706@FreeBSD.org> <1427983680.2035836.248559593.5ED876C6@webmail.messagingengine.com> Date: Sun, 5 Apr 2015 19:15:35 +0200 Message-ID: Subject: Re: Pourdriere produces faulty build results due to bsd.openssl.mk bug From: Spil Oss To: Mark Felder Content-Type: text/plain; charset=UTF-8 Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 17:15:36 -0000 Linking OpenSSL in ports and also requiring something from base that links OpenSSL seems to be pretty rare indeed. A notable example being ftp/curl that requires GSSAPI from base kerberos by default (this is now "fixed" in ports) and thus relying on both ports and base ssl via libkrb5.so. This is likely to be the most common case, something relying on kerberos from base. I'm not quite sure how hard the reliance on kerberos in base is but I'd like to see it made private for base, we have multiple alternatives in ports. This thread misses a reference for the starter to https://bugs.freebsd.org/195796 which lists ports linking base libssl/libcrypto whilst WITH_OPENSSL_PORT=yes is set. I'm trying to collect work done to get these ports to link to ports OpenSSL in https://wiki.freebsd.org/OpenSSL/PortsLinkingBase (that is just a placeholder for now, trying to finish the LibreSSL fallout first) Thanks, Bernard On Thu, Apr 2, 2015 at 4:08 PM, Mark Felder wrote: > > > On Wed, Apr 1, 2015, at 16:21, Bryan Drewery wrote: >> On 4/1/2015 3:59 PM, Yuri wrote: >> > I found that packages produced by poudriere likely link with base >> > openssl, while port make likely links with the port openssl. >> > This is because of the lines in bsd.openssl.mk which check for the >> > presence of openssl shared library and headers under PREFIX, and set >> > WITH_OPENSSL_BASE when they aren't present. In case of port make files >> > are likely present, and in case of poudriere build files are likely not >> > present. >> > >> > Example is ftp/curl (with GSSAPI=NONE, OPENSSL=yes options). *Poudriere >> > produces curl library, that causes VirtualBox to break* due to the >> > openssl base vs. port conflicts. See recent emulation@ ML threads. Port >> > make produces curl library that works fine with VirtualBox. >> > >> > I think both WITH_OPENSSL_BASE and WITH_OPENSSL_PORT should be retired, >> > and code checking file presence also should be removed, and all ports >> > should be made to build with an openssl port instead. Ports should never >> > use base OpenSSL. >> > >> > Only <100 ports touch WITH_OPENSSL_... variables. Somebody who is able >> > to make such decisions and has the commit bit should bit should look >> > into this. Otherwise, massively faulty package repositories are produces. >> > >> > Yuri >> >> I've wanted this for a long time. I think we should just do it. >> > > What are the risks of something linking to OpenSSL in ports also > requiring something from base which in turn... links in OpenSSL from > base? > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" From owner-freebsd-ports@FreeBSD.ORG Sun Apr 5 17:17:00 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 14CD5C96 for ; Sun, 5 Apr 2015 17:17:00 +0000 (UTC) Received: from mwork.nabble.com (mwork.nabble.com [162.253.133.43]) by mx1.freebsd.org (Postfix) with ESMTP id EF8EE2C1 for ; Sun, 5 Apr 2015 17:16:59 +0000 (UTC) Received: from msam.nabble.com (unknown [162.253.133.85]) by mwork.nabble.com (Postfix) with ESMTP id 46B2919D06EC for ; Sun, 5 Apr 2015 10:17:18 -0700 (PDT) Date: Sun, 5 Apr 2015 10:16:52 -0700 (MST) From: pipolandi To: freebsd-ports@freebsd.org Message-ID: <1428254212844-6002885.post@n5.nabble.com> In-Reply-To: References: <1428165370116-6002716.post@n5.nabble.com> Subject: Re: Blender 2.74 cannot compile on FreeBSD 10.1 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 05 Apr 2015 17:17:00 -0000 Thank you both for your time and answers. Looks like openimageio was not properly updated. I had to execute: 1- portmaster graphics/openimageio 2- portmaster graphics/blender to get a functional Blender. I thought portmaster was capable of resolving all dependencies of Blender by just doing 'portmaster graphics/blender'. Many thanks again for your answers. Saludos!. -- View this message in context: http://freebsd.1045724.n5.nabble.com/Blender-2-74-cannot-compile-on-FreeBSD-10-1-tp6002715p6002885.html Sent from the freebsd-ports mailing list archive at Nabble.com. From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 07:35:51 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 1BC61F2F; Mon, 6 Apr 2015 07:35:51 +0000 (UTC) Received: from ipmail05.adl6.internode.on.net (ipmail05.adl6.internode.on.net [150.101.137.143]) by mx1.freebsd.org (Postfix) with ESMTP id 73A7971; Mon, 6 Apr 2015 07:35:49 +0000 (UTC) Received: from ppp118-210-45-229.lns20.adl2.internode.on.net (HELO leader.local) ([118.210.45.229]) by ipmail05.adl6.internode.on.net with ESMTP; 06 Apr 2015 17:05:48 +0930 Message-ID: <55223752.3060403@ShaneWare.Biz> Date: Mon, 06 Apr 2015 17:05:46 +0930 From: Shane Ambler User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:31.0) Gecko/20100101 Thunderbird/31.5.0 MIME-Version: 1.0 To: Ben Woods , Robert Backhaus , pipolandi , FreeBSD@shaneware.biz, mva@freebsd.org Subject: Re: Blender 2.74 cannot compile on FreeBSD 10.1 References: <1428165370116-6002716.post@n5.nabble.com> In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Cc: Freebsd_mailinglist_PORTS X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 07:35:51 -0000 On 05/04/2015 18:08, Ben Woods wrote: > The graphics/libraw package installs /usr/local/lib/libraw_r.so.10, not > libraw_r.so.9 so it will not be detected. See the pkg-plist for > graphics/libraw here: > https://svnweb.freebsd.org/ports/head/graphics/libraw/pkg-plist?revision=379518&view=markup > > The interesting thing is that whilst graphics/blender depends on > the graphics/openimageio library, neither depend on the graphics/libraw > library. > > It might be worth asking the port maintainers for graphics/blender and > graphics/openimageio if they have come across this before. I have added > mva@FreeBSD.org and FreeBSD@Shaneware.biz to the recipients of this email > to check with them. Yes that's my fault, if openimageio finds libraw it will use it but doesn't seem to find the current libraw. I should add that as an option and patch it to find the current version. Looks like I should also do the same for libgif. thanks > > On Sun, Apr 5, 2015 at 9:33 AM Robert Backhaus wrote: > >> To get the simple things out of the road - you have reinstalled libraw, and >> checked that libraw_r.so.9 is in /usr/local/lib? >> >> This error tells me that your install of libOpenImageIO.so.1.4 is faulty, >> so you should also rebuild the port that includes that (pkg which `locate >> \*libOpenImageIO.so.1.4`) >> >> On 5 April 2015 at 02:36, pipolandi wrote: >> >>> I forgot to say that libraw is installed. >>> -- FreeBSD - the place to B...Software Developing Shane Ambler From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 09:22:26 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 30FB5966 for ; Mon, 6 Apr 2015 09:22:26 +0000 (UTC) Received: from portscout.freebsd.org (portscout.freebsd.org [IPv6:2001:1900:2254:206a::50:6]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 1D552CEA for ; Mon, 6 Apr 2015 09:22:26 +0000 (UTC) Received: from portscout.freebsd.org ([127.0.1.123]) by portscout.freebsd.org (8.14.9/8.14.9) with ESMTP id t369MPqG066762 for ; Mon, 6 Apr 2015 09:22:25 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.freebsd.org (8.14.9/8.14.9/Submit) id t369MPCC066761; Mon, 6 Apr 2015 09:22:25 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <201504060922.t369MPCC066761@portscout.freebsd.org> X-Authentication-Warning: portscout.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain MIME-Version: 1.0 Date: Mon, 6 Apr 2015 09:22:25 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: FreeBSD ports you maintain which are out of date X-Mailer: portscout/0.8.1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 09:22:26 -0000 Dear port maintainer, The portscout new distfile checker has detected that one or more of your ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. If any ports have already been updated, you can safely ignore the entry. You will not be e-mailed again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ converters/showkey | 1.5 | 1.7 ------------------------------------------------+-----------------+------------ java/jgrapht | 0.7.3 | 0.9.1 ------------------------------------------------+-----------------+------------ print/lilypond-devel | 2.19.11 | 2.19.18 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Thanks. From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 10:31:24 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 42B13623 for ; Mon, 6 Apr 2015 10:31:24 +0000 (UTC) Received: from smtp.infracaninophile.co.uk (smtp6.infracaninophile.co.uk [IPv6:2001:8b0:151:1:3cd3:cd67:fafa:3d78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "smtp.infracaninophile.co.uk", Issuer "ca.infracaninophile.co.uk" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id BEF3E36C for ; Mon, 6 Apr 2015 10:31:23 +0000 (UTC) Received: from seedling.local ([192.168.100.2]) (authenticated bits=0) by smtp.infracaninophile.co.uk (8.15.1/8.15.1) with ESMTPSA id t36AVDFD020765 (version=TLSv1.2 cipher=DHE-RSA-AES128-SHA bits=128 verify=NO) for ; Mon, 6 Apr 2015 11:31:13 +0100 (BST) (envelope-from matthew@FreeBSD.org) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=none header.from=FreeBSD.org DKIM-Filter: OpenDKIM Filter v2.9.2 smtp.infracaninophile.co.uk t36AVDFD020765 Authentication-Results: smtp.infracaninophile.co.uk/t36AVDFD020765; dkim=none reason="no signature"; dkim-adsp=none; dkim-atps=neutral X-Authentication-Warning: lucid-nonsense.infracaninophile.co.uk: Host [192.168.100.2] claimed to be seedling.local Message-ID: <55226070.1060909@FreeBSD.org> Date: Mon, 06 Apr 2015 11:31:12 +0100 From: Matthew Seaman User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: databases/mysql-connector-java: Looks broken to me References: <20150401173142.1b36d256@rsbsd.rsb> <551C2260.5050904@freebsd.org> In-Reply-To: <551C2260.5050904@freebsd.org> Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="In2JXCJEM497TKAVpC4WPIEdDe4q8rkeT" X-Virus-Scanned: clamav-milter 0.98.6 at lucid-nonsense.infracaninophile.co.uk X-Virus-Status: Clean X-Spam-Status: No, score=-2.9 required=5.0 tests=ALL_TRUSTED,BAYES_00, URIBL_BLOCKED autolearn=ham autolearn_force=no version=3.4.0 X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on lucid-nonsense.infracaninophile.co.uk X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 10:31:24 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --In2JXCJEM497TKAVpC4WPIEdDe4q8rkeT Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable On 01/04/2015 17:52, Matthew Seaman wrote: > On 04/01/15 15:31, Beeblebrox via freebsd-ports wrote: >> I was getting indications that mysql connections through the com.mysql= =2Ejdbc driver was not working. So I searched for a test method (included= below) and here are the results. >> >> * Server: mariadb100--10.0.17, jailed, tcp connection. Able to connect= through other drivers & using same params. >> * Client: mysql-connector-java-5.1.35 >> * Test code compiled with javac, $ java -cp . jdbc > >> com.mysql.jdbc.Driver >> Exception in thread "main" java.lang.ClassNotFoundException: com.mysql= =2Ejdbc.Driver # I compile with OPTIONS_UNSET=3D NLS >> at java.net.URLClassLoader$1.run(URLClassLoader.java:366) >> at java.net.URLClassLoader$1.run(URLClassLoader.java:355) >> at java.security.AccessController.doPrivileged(Native Method) >> at java.net.URLClassLoader.findClass(URLClassLoader.java:354) >> at java.lang.ClassLoader.loadClass(ClassLoader.java:425) >> at sun.misc.Launcher$AppClassLoader.loadClass(Launcher.java:308) >> at java.lang.ClassLoader.loadClass(ClassLoader.java:358) >> at java.lang.Class.forName0(Native Method) >> at java.lang.Class.forName(Class.java:191) >> at jdbc.main(jdbc.java:15) >> >=20 > Thank you for the report. Unfortunately, I'm at a loss to fix this. Th= e > driver is supplied pre-compiled by Oracle -- we used to compile it, lon= g > ago, but then it grew some compatibility shims that meant bits of it > needed compiling with different JDKs, something that couldn't be > supported in the ports. I guess it's time to try recompiling it > ourselves since java has moved on quite a lot since those days. Give m= e > a while to test that please. >=20 > Given that it's basically a .jar file downloaded from the net and copie= d > into position, the OPTIONS_USET=3DNLS thing will have absolutely no eff= ect > on mysql-connector-java itself Having managed to find time to test this out, the situation is still the same: compiling this .jar requires a java-1.5 JDK to be installed alongside a more current JDK: > lucid-nonsense:/tmp/mysql-connector-java-5.1.35:% ant compile > Buildfile: /tmp/mysql-connector-java-5.1.35/build.xml >=20 > -jdk5-check: > [exec] Execute failed: java.io.IOException: Cannot run program "/u= sr/lib/jvm/jdk1.5/bin/java": error=3D2, No such file or directory >=20 > BUILD FAILED > /tmp/mysql-connector-java-5.1.35/build.xml:240: Java 5 is required. Set= the full path to this JDK home with the property 'com.mysql.jdbc.jdk5'. = Default: '/usr/lib/jvm/jdk1.5'). Java 6 (for JDBC4+ implementation) is al= so required. Set the full path to this JDK home with the property 'com.my= sql.jdbc.jdk6'. Default: '/usr/lib/jvm/jdk1.6'. >=20 > Total time: 1 second Given there is no longer any support in the ports for java-1.5 I'm afraid we're stuck with using the pre-compiled .jar file. Cheers, Matthew --=20 Dr Matthew J Seaman MA, D.Phil. PGP: http://www.infracaninophile.co.uk/pgpkey --In2JXCJEM497TKAVpC4WPIEdDe4q8rkeT Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG/MacGPG2 v2.0.20 (Darwin) iQJ8BAEBCgBmBQJVImBwXxSAAAAAAC4AKGlzc3Vlci1mcHJAbm90YXRpb25zLm9w ZW5wZ3AuZmlmdGhob3JzZW1hbi5uZXQ2NTNBNjhCOTEzQTRFNkNGM0UxRTEzMjZC QjIzQUY1MThFMUE0MDEzAAoJELsjr1GOGkATIUUP/i6nO76XhZqUeq+lcSG2Y05N vtZIQf0fuwpP6Mek7UZ/92gJzqjVVwh0D/gSfor0kbVtRBfzKBPR2zN9RCIx+XLF qDYKzYqOq6TT1rHpnq9uJfEfPqEMSWwf4OQvWenMjW4fx9hWdOk5CXJIrqS7fqfV 1BIlEOD99eexoV2jj6tC5pFRVBo5z/jjaxfEHEQVogFf9LRgpeAb3xYDg1L9LE+f g0aOVQFfHfStRuS2weixN1fJqQ9t+8XA6NS8/G6evdBDJj3HqInz4pc98V9kSPWU ZzUK4A/hj1spsRwFvFNDu2a5bemjYf01tUG8ZUJrizNF6CmMuSaAir85RSorN3K7 MaKbWOgDTQ+bLLi9tU94hyy3m40qvQzIAyYfbA9RSJoS91pWrtVy7V4WXu5N2IVz 9/t731XKX5M3W0OBif+68VyNNxcsZ+DKJchJ35elKIQKDHcbI89MiYHegVQ6x4Rx TjJ4GvVU8M9YXXkIT0w9D52kkBssI0ojrKb1w78Cl0HS9spL0qSqyw6jKDbzfaNh rw30aB1gonLehtW1HU873L6CE+6Pa184Xc13Vrw4etRWWGvsZ3NiLNoAz1upLa1u 64s8ek1+uVKxgi5Kq9bmNltvK8Jz3S4k7NsSm9GZakfqUnVuQc85I90fPPNhWcmy C1X5Lun8jgz6/CkjNCJE =Bmc3 -----END PGP SIGNATURE----- --In2JXCJEM497TKAVpC4WPIEdDe4q8rkeT-- From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 11:37:24 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 55FD8D7F for ; Mon, 6 Apr 2015 11:37:24 +0000 (UTC) Received: from mail-vn0-x229.google.com (mail-vn0-x229.google.com [IPv6:2607:f8b0:400c:c0f::229]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 105C9B51 for ; Mon, 6 Apr 2015 11:37:24 +0000 (UTC) Received: by vnbf1 with SMTP id f1so4011893vnb.0 for ; Mon, 06 Apr 2015 04:37:23 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:date:message-id:subject:from:to:content-type; bh=0ONuodbrHz12pjBiHLqBi0anbDnTsLFeQl0OvrTRkys=; b=KpBMhIPlBOaVdVU3pqvVNhgSYRsJUBF+5BV+Ruva8Qz+lmZ/nT/DhO3r30cW8zjU1j kY5vDu0YM+zuGxuEbCyMVxTjU7xyO5FIs/NpMtdsxvyDWdGih2f1WkuMclYlRvq+ka9G HjRADn5cXreD9VBSUYPLPKx8rDHzmmngBZWl7Sczjmhku6NNsG8JgnyjEwN3UmGOLiIl S7wUfBuaokK/HKy7meR2ajpu+/E7qHMCSvnf9WBsvb788+YvNDf+iqWPNSQgmM+8B5/L ZPfds5xPgFgNxCR/FKwBzl1Kwolj0nZMKMxwUOqWoLlmCAbXM5ev9btLvcRk0v0qOe9Y 2NPA== MIME-Version: 1.0 X-Received: by 10.52.189.40 with SMTP id gf8mr9559859vdc.44.1428320243137; Mon, 06 Apr 2015 04:37:23 -0700 (PDT) Received: by 10.52.23.3 with HTTP; Mon, 6 Apr 2015 04:37:23 -0700 (PDT) Date: Mon, 6 Apr 2015 14:37:23 +0300 Message-ID: Subject: 3proxy PR From: Pavel Timofeev To: ports-list freebsd Content-Type: text/plain; charset=UTF-8 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 11:37:24 -0000 Hello! Could anyone look into the https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=188374 PR, please? From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 13:50:35 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id DB240BBB; Mon, 6 Apr 2015 13:50:35 +0000 (UTC) Received: from mail-ig0-x231.google.com (mail-ig0-x231.google.com [IPv6:2607:f8b0:4001:c05::231]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 9C6E1A8D; Mon, 6 Apr 2015 13:50:35 +0000 (UTC) Received: by igblo3 with SMTP id lo3so21243127igb.1; Mon, 06 Apr 2015 06:50:35 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc:content-type; bh=Iiws0D9vSfZUWK4myWty5OiZRcEKYRN9WqeNQ44gofc=; b=hnTnDZMCVKmQVSBjLmvx7ONuKiTvjMcCUNgWPj9DKBr5YLk73iMmuAq8GeiAkWOVpR PbKN2TNq2+C+OySfsfXFiObd0vwbrycYMPuAkTuyR3eERLKIXC/OwAq+DJdPTVzUvHlq k4sdDOM222roIsQCRC6r0Sm0w/QK/pfl625VXvmdDiKyJ+BrSAbRjhRhiEkWABWWhP7K 2DFyX40JODjCVGZzlnZu5ATVdhTD4G1djgjAPTKmR4Eq7S9DS9/QodvNlbhrqLJ9HrH/ uYJUyjrk/YaFu5hVxRqCchyaEm3NBZdHhhil0M4KEpdtQkUQTsmhCIn3EQFlTS+hRu5A 5OjQ== X-Received: by 10.107.128.3 with SMTP id b3mr22604632iod.24.1428328235044; Mon, 06 Apr 2015 06:50:35 -0700 (PDT) MIME-Version: 1.0 References: <1428165370116-6002716.post@n5.nabble.com> <55223752.3060403@ShaneWare.Biz> In-Reply-To: <55223752.3060403@ShaneWare.Biz> From: Ben Woods Date: Mon, 06 Apr 2015 13:50:34 +0000 Message-ID: Subject: Re: Blender 2.74 cannot compile on FreeBSD 10.1 To: Shane Ambler , Robert Backhaus , pipolandi , mva@freebsd.org Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: Freebsd_mailinglist_PORTS X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 13:50:35 -0000 Thanks for the feedback Shane :) On Mon, Apr 6, 2015 at 3:35 PM Shane Ambler wrote: > On 05/04/2015 18:08, Ben Woods wrote: > > The graphics/libraw package installs /usr/local/lib/libraw_r.so.10, not > > libraw_r.so.9 so it will not be detected. See the pkg-plist for > > graphics/libraw here: > > https://svnweb.freebsd.org/ports/head/graphics/libraw/ > pkg-plist?revision=379518&view=markup > > > > The interesting thing is that whilst graphics/blender depends on > > the graphics/openimageio library, neither depend on the graphics/libraw > > library. > > > > It might be worth asking the port maintainers for graphics/blender and > > graphics/openimageio if they have come across this before. I have added > > mva@FreeBSD.org and FreeBSD@Shaneware.biz to the recipients of this > email > > to check with them. > > Yes that's my fault, if openimageio finds libraw it will use it but > doesn't seem to find the current libraw. I should add that as an option > and patch it to find the current version. Looks like I should also do > the same for libgif. > > thanks > > > > > On Sun, Apr 5, 2015 at 9:33 AM Robert Backhaus > wrote: > > > >> To get the simple things out of the road - you have reinstalled libraw, > and > >> checked that libraw_r.so.9 is in /usr/local/lib? > >> > >> This error tells me that your install of libOpenImageIO.so.1.4 is > faulty, > >> so you should also rebuild the port that includes that (pkg which > `locate > >> \*libOpenImageIO.so.1.4`) > >> > >> On 5 April 2015 at 02:36, pipolandi wrote: > >> > >>> I forgot to say that libraw is installed. > >>> > > > -- > FreeBSD - the place to B...Software Developing > > Shane Ambler > > From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 14:50:42 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 25068C42; Mon, 6 Apr 2015 14:50:42 +0000 (UTC) Received: from vms173011pub.verizon.net (vms173011pub.verizon.net [206.46.173.11]) (using TLSv1 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id F0545240; Mon, 6 Apr 2015 14:50:41 +0000 (UTC) Received: from [192.168.1.8] ([108.53.86.243]) by vms173011.mailsrvcs.net (Oracle Communications Messaging Server 7.0.5.32.0 64bit (built Jul 16 2014)) with ESMTPA id <0NME00HJD134VP30@vms173011.mailsrvcs.net>; Mon, 06 Apr 2015 08:49:57 -0500 (CDT) X-CMAE-Score: 0 X-CMAE-Analysis: v=2.1 cv=e7Wxkht6 c=1 sm=1 tr=0 a=OxtTj1AvBIaAxO256ZN+aQ==:117 a=3WGNbyozUhgA:10 a=LaogzpLLAAAA:8 a=oR5dmqMzAAAA:8 a=-9mUelKeXuEA:10 a=e9J7MTPGsLIA:10 a=r77TgQKjGQsHNAKrUKIA:9 a=9iDbn-4jx3cA:10 a=cKsnjEOsciEA:10 a=gZbpxnkM3yUA:10 a=UitB9n-fQ2xmJgRMcMIA:9 a=pILNOxqGKmIA:10 a=6I5d2MoRAAAA:8 a=SOa5ClQLlVI4H-CA37YA:9 a=QmWrDH08wY_l8ac5:21 a=_W_S_7VecoQA:10 Message-id: <55228EFF.6090904@aldan.algebra.com> Date: Mon, 06 Apr 2015 09:49:51 -0400 From: "Mikhail T." User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: Re: databases/mysql-connector-java: Looks broken to me References: <20150401173142.1b36d256@rsbsd.rsb> <551C2260.5050904@freebsd.org> <55226070.1060909@FreeBSD.org> In-reply-to: <55226070.1060909@FreeBSD.org> Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: matthew@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 14:50:42 -0000 On 04/06/15 06:31, Matthew Seaman wrote: >> lucid-nonsense:/tmp/mysql-connector-java-5.1.35:% ant compile >> > Buildfile: /tmp/mysql-connector-java-5.1.35/build.xml >> > >> > -jdk5-check: >> > [exec] Execute failed: java.io.IOException: Cannot run program "/usr/lib/jvm/jdk1.5/bin/java": error=2, No such file or directory >> > >> > BUILD FAILED >> > /tmp/mysql-connector-java-5.1.35/build.xml:240: Java 5 is required. Set the full path to this JDK home with the property 'com.mysql.jdbc.jdk5'. Default: '/usr/lib/jvm/jdk1.5'). Java 6 (for JDBC4+ implementation) is also required. Set the full path to this JDK home with the property 'com.mysql.jdbc.jdk6'. Default: '/usr/lib/jvm/jdk1.6'. >> > >> > Total time: 1 second > Given there is no longer any support in the ports for java-1.5 I'm > afraid we're stuck with using the pre-compiled .jar file. Can't the build.xml be patched to augment and/or drop the requirement? We might then see the actual problem in the Java source -- if any -- and patch that... -mi From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 20:00:41 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id AF0E780F for ; Mon, 6 Apr 2015 20:00:41 +0000 (UTC) Received: from smtp.infracaninophile.co.uk (smtp6.infracaninophile.co.uk [IPv6:2001:8b0:151:1:3cd3:cd67:fafa:3d78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "smtp.infracaninophile.co.uk", Issuer "ca.infracaninophile.co.uk" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 3F0DFC2E for ; Mon, 6 Apr 2015 20:00:41 +0000 (UTC) Received: from seedling.local ([192.168.100.2]) (authenticated bits=0) by smtp.infracaninophile.co.uk (8.15.1/8.15.1) with ESMTPSA id t36K0OR9000474 (version=TLSv1.2 cipher=DHE-RSA-AES128-SHA bits=128 verify=NO); Mon, 6 Apr 2015 21:00:24 +0100 (BST) (envelope-from matthew@FreeBSD.org) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=none header.from=FreeBSD.org DKIM-Filter: OpenDKIM Filter v2.9.2 smtp.infracaninophile.co.uk t36K0OR9000474 Authentication-Results: smtp.infracaninophile.co.uk/t36K0OR9000474; dkim=none reason="no signature"; dkim-adsp=none; dkim-atps=neutral X-Authentication-Warning: lucid-nonsense.infracaninophile.co.uk: Host [192.168.100.2] claimed to be seedling.local Message-ID: <5522E5CF.3090902@FreeBSD.org> Date: Mon, 06 Apr 2015 21:00:15 +0100 From: Matthew Seaman User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: "Mikhail T." , freebsd-ports@freebsd.org Subject: Re: databases/mysql-connector-java: Looks broken to me References: <20150401173142.1b36d256@rsbsd.rsb> <551C2260.5050904@freebsd.org> <55226070.1060909@FreeBSD.org> <55228EFF.6090904@aldan.algebra.com> In-Reply-To: <55228EFF.6090904@aldan.algebra.com> Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="tOoJI0Ui388MB0kWnrhb2HNXFiedourfR" X-Virus-Scanned: clamav-milter 0.98.6 at lucid-nonsense.infracaninophile.co.uk X-Virus-Status: Clean X-Spam-Status: No, score=-2.9 required=5.0 tests=ALL_TRUSTED,BAYES_00, URIBL_BLOCKED autolearn=ham autolearn_force=no version=3.4.0 X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on lucid-nonsense.infracaninophile.co.uk X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 20:00:41 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --tOoJI0Ui388MB0kWnrhb2HNXFiedourfR Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable On 06/04/2015 14:49, Mikhail T. wrote: > Can't the build.xml be patched to augment and/or drop the requirement? > We might then see the actual problem in the Java source -- if any -- an= d > patch that... That might be possible, but it would result in dropping a serious slice of functionality from the connector. So I'd only ever want to have that as an optional thing. It's also something which is probably beyond what I'm competent to do, right now. I'd need to do some intensive revision to bring my java+ant skills back up to scratch. On the other hand, I have no idea if this would even solve the OP's actual problem. Cheers, Matthew --=20 Dr Matthew J Seaman MA, D.Phil. PGP: http://www.infracaninophile.co.uk/pgpkey --tOoJI0Ui388MB0kWnrhb2HNXFiedourfR Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG/MacGPG2 v2.0.20 (Darwin) iQJ8BAEBCgBmBQJVIuXYXxSAAAAAAC4AKGlzc3Vlci1mcHJAbm90YXRpb25zLm9w ZW5wZ3AuZmlmdGhob3JzZW1hbi5uZXQ2NTNBNjhCOTEzQTRFNkNGM0UxRTEzMjZC QjIzQUY1MThFMUE0MDEzAAoJELsjr1GOGkATqqsP/0tzh/NvmrDbbo6owqu51cAD raQWkXThT+C+EtyXu3XFzdz/wTDepsGmXKiqO+SxSG8hA2t4yrUb12t2/ELTi7hJ /HwJKJxMcDwhjwlEdo3KHIjCWw+eZoVMkNG7iBgpQueP8fKQp/o/LOKpWP+ryE+a j+8heD9P1wzvGl+7svyqIk5QNDmP5KljOHGbuQi5k6gxMuy8elyBohCc+NzO7EmF AW4Uiwa3pXjvfmZv10iDISMIdWCfaheFOP5LfL+/mTHHBMGTNt/Kms+2sMlltXmW bBtqSeMFIQsx23HZDU3cKHR8LTVsHinj8T5dFaFiQV9BDoNN1RCiBekLsA9kLmaa 10JTxSqghgbUsQsxVtaPvPIDKaqCb2JkE6AB90BL4wDQXCwm8bAtUWIXap/hwWrL 2IftbQsIXYkMfirzqfxSvDbi8r9l4Z9t6KF515l7OTLFfJR+W0wYJ228YlEpnX4B zhlTTPOiKie65T858DHlcDF9spfTUXqpW9sBdhalsjvBFGsgIJpnfIkGRhD8gi5x rO4k3cWPnD8ARO9y+jc+QFLDm6CS8IYonLHYV6b5BjsUT9DQTFqWJVr3/E703Zmf 04+pt9tf9hYDUmajDDbDuQj1jlRg5nWMrUa/+EdY9sm8LuVFWJddjjb5pTP9fvth +tFssfYsZQJZug06CPfM =Nwwp -----END PGP SIGNATURE----- --tOoJI0Ui388MB0kWnrhb2HNXFiedourfR-- From owner-freebsd-ports@FreeBSD.ORG Mon Apr 6 22:16:43 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id BA65C87C; Mon, 6 Apr 2015 22:16:43 +0000 (UTC) Received: from vms173009pub.verizon.net (vms173009pub.verizon.net [206.46.173.9]) (using TLSv1 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 91D2FE2C; Mon, 6 Apr 2015 22:16:43 +0000 (UTC) Received: from [192.168.1.8] ([108.53.86.243]) by vms173009.mailsrvcs.net (Oracle Communications Messaging Server 7.0.5.32.0 64bit (built Jul 16 2014)) with ESMTPA id <0NME00CSYLQUAT90@vms173009.mailsrvcs.net>; Mon, 06 Apr 2015 16:16:10 -0500 (CDT) X-CMAE-Score: 0 X-CMAE-Analysis: v=2.1 cv=NqFmqHZM c=1 sm=1 tr=0 a=OxtTj1AvBIaAxO256ZN+aQ==:117 a=3WGNbyozUhgA:10 a=LaogzpLLAAAA:8 a=oR5dmqMzAAAA:8 a=-9mUelKeXuEA:10 a=e9J7MTPGsLIA:10 a=r77TgQKjGQsHNAKrUKIA:9 a=9iDbn-4jx3cA:10 a=cKsnjEOsciEA:10 a=gZbpxnkM3yUA:10 a=yLlBkcTh6z1CclkBctQA:9 a=QEXdDO2ut3YA:10 a=6I5d2MoRAAAA:8 a=c2Cdw6LlG2ZcaXYtIpwA:9 a=PRkS9jKpQNWGvi9S:21 a=_W_S_7VecoQA:10 Message-id: <5522F796.10709@aldan.algebra.com> Date: Mon, 06 Apr 2015 17:16:06 -0400 From: "Mikhail T." User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-version: 1.0 To: Matthew Seaman Subject: Re: databases/mysql-connector-java: Looks broken to me References: <20150401173142.1b36d256@rsbsd.rsb> <551C2260.5050904@freebsd.org> <55226070.1060909@FreeBSD.org> <55228EFF.6090904@aldan.algebra.com> <5522E5CF.3090902@FreeBSD.org> In-reply-to: <5522E5CF.3090902@FreeBSD.org> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 06 Apr 2015 22:16:43 -0000 On 04/06/15 16:00, Matthew Seaman wrote: > That might be possible, but it would result in dropping a serious slice > of functionality from the connector. Which functionality is it? If an old compiler is truly required at all, it can only be to generate code to run in an old JVM. Since FreeBSD stopped offering java-1.5 long ago, this can not possibly be a concern... And, of course, even a modern javac can be asked to generate 1.5-compatible byte code. None of these changes would be particularly /pleasant/ -- I, personally, am always revolted by the innards of a pom.xml or build.xml -- but they ought to be /possible/... -mi From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 05:53:08 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id A83B0B49 for ; Tue, 7 Apr 2015 05:53:08 +0000 (UTC) Received: from ainaz.pair.com (ainaz.pair.com [209.68.2.66]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 83B002D9 for ; Tue, 7 Apr 2015 05:53:08 +0000 (UTC) Received: from [192.168.0.133] (vie-91-186-144-236.dsl.sil.at [91.186.144.236]) by ainaz.pair.com (Postfix) with ESMTPSA id 80DDC3F445 for ; Tue, 7 Apr 2015 01:53:06 -0400 (EDT) Date: Tue, 7 Apr 2015 07:53:04 +0200 (CEST) From: Gerald Pfeifer To: ports@FreeBSD.org Subject: Re: [package - head-i386-default][emulators/wine-compholio] Failed for wine-compholio-1.7.40,1 in build In-Reply-To: <201504070547.t375lmtZ086740@beefy3.isc.freebsd.org> Message-ID: References: <201504070547.t375lmtZ086740@beefy3.isc.freebsd.org> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 05:53:08 -0000 On Tue, 7 Apr 2015, pkg-fallout@FreeBSD.org wrote: > Ident: $FreeBSD: head/emulators/wine-compholio/Makefile 375756 2014-12-28 20:39:48Z dbn $ > Log URL: http://beefy3.isc.freebsd.org/data/head-i386-default/p383446_s281156/logs/wine-compholio-1.7.40,1.log > Build URL: http://beefy3.isc.freebsd.org/build.html?mastername=head-i386-default&build=p383446_s281156 > Log: > > ====>> Building emulators/wine-compholio > build started at Tue Apr 7 04:55:12 UTC 2015 > port directory: /usr/ports/emulators/wine-compholio > building for: FreeBSD head-i386-default-job-13 11.0-CURRENT FreeBSD 11.0-CURRENT #0 r279966: Fri Mar 13 22:02:53 UTC 2015 peter@build-11.freebsd.org:/usr/obj/usr/src/sys/CLUSTER11 i386 > maintained by: gerald@FreeBSD.org > Makefile ident: $FreeBSD: head/emulators/wine-compholio/Makefile 375756 2014-12-28 20:39:48Z dbn $ > Poudriere version: 3.1.3 > Host OSVERSION: 1100064 > Jail OSVERSION: 1100067 > > !!! Jail is newer than host. (Jail: 1100067, Host: 1100064) !!! > !!! This is not supported. !!! > !!! Host kernel must be same or newer than jail. !!! > !!! Expect build failures. !!! Apart from me wondering why those test results are shared if build failures are to be expected.... > cc -c -o socket.o socket.c -I. -I../../include -D__WINESRC__ -DUSE_WS_PREFIX -D_REENTRANT -fPIC -Wall \ > -pipe -fno-strict-aliasing -Wdeclaration-after-statement -Wempty-body -Wignored-qualifiers \ > -Wstrict-prototypes -Wtype-limits -Wvla -Wwrite-strings -Wpointer-arith -fno-omit-frame-pointer \ > -I/usr/local/include -O2 -pipe -fstack-protector -fno-strict-aliasing > socket.c:368:27: error: use of undeclared identifier 'WS_IPX_PTYPE' > DEBUG_SOCKOPT(WS_IPX_PTYPE); > ^ > socket.c:330:32: note: expanded from macro 'DEBUG_SOCKOPT' > #define DEBUG_SOCKOPT(x) case (x): stropt = #x; break > ^ > socket.c:369:27: error: use of undeclared identifier 'WS_IPX_FILTERPTYPE' > DEBUG_SOCKOPT(WS_IPX_FILTERPTYPE); > ^ > socket.c:330:32: note: expanded from macro 'DEBUG_SOCKOPT' > #define DEBUG_SOCKOPT(x) case (x): stropt = #x; break > ^ > socket.c:370:27: error: use of undeclared identifier 'WS_IPX_DSTYPE' > DEBUG_SOCKOPT(WS_IPX_DSTYPE); > ^ ...does anyone know what is going on in HEAD and what to do about it? Or is this a temporary thing and we should ignore this on the ports side? Gerald From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 06:42:11 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 6331BAA6 for ; Tue, 7 Apr 2015 06:42:11 +0000 (UTC) Received: from smtp.infracaninophile.co.uk (smtp6.infracaninophile.co.uk [IPv6:2001:8b0:151:1:3cd3:cd67:fafa:3d78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "smtp.infracaninophile.co.uk", Issuer "ca.infracaninophile.co.uk" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id EE1159B1 for ; Tue, 7 Apr 2015 06:42:10 +0000 (UTC) Received: from zero-gravitas.local ([192.168.100.4]) (authenticated bits=0) by smtp.infracaninophile.co.uk (8.15.1/8.15.1) with ESMTPSA id t376flKe015035 (version=TLSv1.2 cipher=DHE-RSA-AES128-SHA bits=128 verify=NO); Tue, 7 Apr 2015 07:41:47 +0100 (BST) (envelope-from matthew@FreeBSD.org) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=none header.from=FreeBSD.org DKIM-Filter: OpenDKIM Filter v2.9.2 smtp.infracaninophile.co.uk t376flKe015035 Authentication-Results: smtp.infracaninophile.co.uk/t376flKe015035; dkim=none reason="no signature"; dkim-adsp=none; dkim-atps=neutral X-Authentication-Warning: lucid-nonsense.infracaninophile.co.uk: Host [192.168.100.4] claimed to be zero-gravitas.local Message-ID: <55237C20.7060406@FreeBSD.org> Date: Tue, 07 Apr 2015 07:41:36 +0100 From: Matthew Seaman User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:31.0) Gecko/20100101 Thunderbird/31.5.0 MIME-Version: 1.0 To: "Mikhail T." Subject: Re: databases/mysql-connector-java: Looks broken to me References: <20150401173142.1b36d256@rsbsd.rsb> <551C2260.5050904@freebsd.org> <55226070.1060909@FreeBSD.org> <55228EFF.6090904@aldan.algebra.com> <5522E5CF.3090902@FreeBSD.org> <5522F796.10709@aldan.algebra.com> In-Reply-To: <5522F796.10709@aldan.algebra.com> Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="40qwlfsHPvIjVM2BaeOkAkxSRKACqtL6j" X-Virus-Scanned: clamav-milter 0.98.6 at lucid-nonsense.infracaninophile.co.uk X-Virus-Status: Clean X-Spam-Status: No, score=-2.9 required=5.0 tests=ALL_TRUSTED,AWL,BAYES_00, URIBL_BLOCKED autolearn=ham autolearn_force=no version=3.4.0 X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on lucid-nonsense.infracaninophile.co.uk Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 06:42:11 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --40qwlfsHPvIjVM2BaeOkAkxSRKACqtL6j Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable On 2015/04/06 22:16, Mikhail T. wrote: > On 04/06/15 16:00, Matthew Seaman wrote: >> That might be possible, but it would result in dropping a serious >> slice of functionality from the connector. > Which functionality is it? If an old compiler is truly required at > all, it can only be to generate code to run in an old JVM. >=20 > Since FreeBSD stopped offering java-1.5 long ago, this can not > possibly be a concern... And, of course, even a modern javac can be > asked to generate 1.5-compatible byte code. >=20 > None of these changes would be particularly /pleasant/ -- I, > personally, am always revolted by the innards of a pom.xml or > build.xml -- but they ought to be /possible/... build.xml says this: Compiling Connector/J =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D Connector/J 5.1 supports both JDBC3 and JDBC4+ with a single code base. This requires JDBC3 classes to be compiled with Java 5 and JDBC4+ to be compiled with Java 6. The variables 'com.mysql.jdbc.jdk5' and 'com.mysql.jdbc.jdk6' are used to find the respective compilers when building the driver. Side by side with these, the variable 'com.mysql.jdbc.extra.libs' must point to the location of third-party libraries that we don't distribute and are required for compiling. Further details can be found in http://dev.mysql.com/doc/connector-j/en/connector-j-installing-source.htm= l. So anyone using JDBC3 would be disappointed by our chopping it out. I have precisely zero idea how many people that might be, or indeed how much call there is for JDBC3 adaptors in general. Cheers, Matthew --40qwlfsHPvIjVM2BaeOkAkxSRKACqtL6j Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG/MacGPG2 v2.0.22 (Darwin) Comment: GPGTools - https://gpgtools.org iQIcBAEBCgAGBQJVI3wpAAoJEABRPxDgqeTn8x4P/RM264I+FqsAe1fdJtfFAPy5 T/69q1E3SGodPItVJIhgpGx2minXoN8kduEvN0U0vf84y4JLKxfypvvHI8/rj2lT CGV4lTh8kblG/s+wZMJrhLMW0hNIcdVo+T4cS1B0dz+HOOzzDlNu4hk0LotVel3r We8B9GKjW1v5GSBR0qikmgWRvh+OHfxfOTaYNDmprALsgm8e5ONC1irCXhi2cDCw tuRsWMrt01mg1t1ANOq8EBsxL8FoStb4Fczy+5wYTC/vQ7riEZ9q+BLBdhWFk7L5 Jk7eaXMyMC8ChX/wlCnOEMkTOTRrvVyn4jYJkXdPgwsJj87aptpk27Fs4V527UWY LYZ5CT0diEjXOAjiCAe0Ka9QUEpDeO0XX+n5TnG/RCMu84USkWEzlcgzQgATB5SK vBnEUAYGmufhAsaiTCzRtCI2z9KYwgBfAAi6hXcuCY4GMaLdyrCBvtTscyuj1Imm MlQfkhvSu/f05fGkjdQKFB04yBF5q4WAFXkdwznBG7rjGPNiQhaMIBkIGzU90HuK wEkMBd1FXYIjY2MiVP7wEb5t6E7Aemr9wJ3o+XMOc74HxkLcDe/cYK5QicOPNTPf FDU+o8ljijN/NkrGgA+Hu09dSPejAHO/7AKqPDN/3iaB2C92HByftyjNXibXVCDl p/xeATiThJRVdCxQLWsb =tjws -----END PGP SIGNATURE----- --40qwlfsHPvIjVM2BaeOkAkxSRKACqtL6j-- From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 07:56:55 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 9AEC0C6E for ; Tue, 7 Apr 2015 07:56:55 +0000 (UTC) Received: from smtp205.alice.it (smtp205.alice.it [82.57.200.101]) by mx1.freebsd.org (Postfix) with ESMTP id 278E3242 for ; Tue, 7 Apr 2015 07:56:54 +0000 (UTC) Received: from soth.ventu (87.18.56.84) by smtp205.alice.it (8.6.060.28) (authenticated as acanedi@alice.it) id 547D8A4D1B88565C; Tue, 7 Apr 2015 09:51:10 +0200 Received: from alamar.ventu (alamar.ventu [10.1.2.18]) by soth.ventu (8.15.1/8.14.9) with ESMTP id t377p8jH063051; Tue, 7 Apr 2015 09:51:09 +0200 (CEST) (envelope-from ml@netfence.it) Message-ID: <55238C6C.3040203@netfence.it> Date: Tue, 07 Apr 2015 09:51:08 +0200 From: Andrea Venturoli User-Agent: Mozilla/5.0 (X11; FreeBSD i386; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: michael@fuckner.net Subject: arcconf dumps core Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Cc: ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 07:56:55 -0000 Hello. The box is a 9.3/amd64 and this is the controller I have: > aac0@pci0:4:14:0: class=0x010400 card=0x02bc9005 chip=0x02859005 rev=0x00 hdr=0x00 > vendor = 'Adaptec' > device = 'AAC-RAID' > class = mass storage > subclass = RAID Since I've upgraded arcconf to the latest version (1.7.21229,1) it won't work anymore, dumping core. Actually "arcconf" works and displays the help message with all the available commands, but anything which really interacts with the controller (e.g. "arcconf GETCONFIG 1") will dump core. I've seen Bug 194265, which was closed with the upgrade from 1.6 to 1.7; in my case the latest SVN version that works is 355559. Of course I'm downgrading now, but I thought you should know. bye & Thanks av. From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 08:29:12 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id BF82B58C for ; Tue, 7 Apr 2015 08:29:12 +0000 (UTC) Received: from portsmon.freebsd.org (portsmon.freebsd.org [IPv6:2001:1900:2254:206a::50:3]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id AD00485C for ; Tue, 7 Apr 2015 08:29:12 +0000 (UTC) Received: from portsmon.freebsd.org ([127.0.1.104]) by portsmon.freebsd.org (8.14.9/8.14.9) with ESMTP id t378TCM7009233 for ; Tue, 7 Apr 2015 08:29:12 GMT (envelope-from linimon@FreeBSD.org) Date: Tue, 7 Apr 2015 08:29:12 GMT Message-Id: <201504070829.t378TCM7009233@portsmon.freebsd.org> From: linimon@FreeBSD.org To: ports@freebsd.org Reply-To: portmgr-feedback@FreeBSD.org Subject: FreeBSD unmaintained ports which are currently marked broken X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 08:29:12 -0000 As part of an ongoing effort to reduce the number of problems in the FreeBSD ports system, we periodically notify users of ports that are marked as "broken" in their Makefiles. In many cases these ports are failing to compile on some subset of the FreeBSD build environments. One common problem is that recent versions of FreeBSD use clang instead of gcc by default. Another common problem is that the compiles succeed on the i386 and amd64 architecture (e.g. the common Intel PC), but fail on one or more of the other architectures due to assumptions about things such as size of various types, byte-alignment issues, and so forth. In occasional cases we see that the same port may have different errors in different build environments. The script that runs on the build cluster uses heuristics to try to 'guess' the error type to help you isolate problems, but it is only a rough guide. One more note: on occasion, there are transient build errors seen on the build farm. Unfortunately, there is not yet any way for this algorithm to tell the difference (humans are much, much better at this kind of thing.) The errors are listed below. In the case where the same problem exists on more than one build environment, the URL points to the latest errorlog for that type. (By 'build environment' here we mean 'combination of 8.x/9.x/10.x/-current with target architecture'.) portname: archivers/pecl-lzf broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=pecl-lzf portname: archivers/zipmix broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=zipmix portname: astro/gpstk broken because: Distfile size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=gpstk portname: astro/sky2000 broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=sky2000 portname: audio/amb-plugins broken because: Distfile size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=amb-plugins portname: audio/amrcoder broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=amrcoder portname: audio/btc broken because: Ftp time out build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=btc portname: audio/cplay broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=cplay portname: audio/linux-genpuid broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=linux-genpuid portname: audio/musica broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=musica portname: audio/optimfrog broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=optimfrog portname: audio/pecl-id3 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=pecl-id3 portname: audio/pure-audio broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=pure-audio portname: audio/rsynth broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=rsynth portname: audio/sonice broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=sonice portname: audio/sphinx broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=sphinx portname: audio/xmradio broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=xmradio portname: benchmarks/fhourstones broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=fhourstones portname: benchmarks/flops broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=flops portname: benchmarks/geekbench broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=geekbench portname: benchmarks/pathload broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=pathload portname: benchmarks/pathrate broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=pathrate portname: benchmarks/unixbench broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=unixbench portname: biology/migrate broken because: unfetchable build errors: http://beefy2.isc.freebsd.org/bulk/84amd64-default/2015-03-20_06h25m48s/logs/errors/migrate-3.6.6.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=migrate portname: biology/ortep3 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=ortep3 portname: biology/platon broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=platon portname: biology/povchem broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=povchem portname: cad/geda-docs broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-docs portname: cad/geda-examples broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-examples portname: cad/geda-gattrib broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-gattrib portname: cad/geda-gschem broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-gschem portname: cad/geda-netlist broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-netlist portname: cad/geda-symbols broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-symbols portname: cad/geda-symcheck broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-symcheck portname: cad/geda-utils broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-utils portname: cad/libgeda broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=libgeda portname: cad/slffea broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=slffea portname: cad/z88 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=z88 portname: chinese/bg5ps broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=bg5ps portname: chinese/cce broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=cce portname: chinese/cwtexttf broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=cwtexttf portname: chinese/fireflyttf broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=fireflyttf portname: chinese/libtabe broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=libtabe portname: chinese/oxim broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=oxim portname: comms/gkermit broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=gkermit portname: comms/mlan3 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=mlan3 portname: comms/qpage broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=qpage portname: comms/serialoverip broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=serialoverip portname: comms/seyon broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=seyon portname: databases/mysql-connector-c broken because: Fails to configure build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=mysql-connector-c portname: deskutils/bigyear broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=bigyear portname: deskutils/cdcat broken because: Fails to build with new p7zip build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=cdcat portname: deskutils/charmap broken because: Newer version does not work with recent objective C build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=charmap portname: deskutils/displaycalibrator broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=displaycalibrator portname: deskutils/glipper broken because: Uses unknown GNOME components pygnomedesktop and pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=glipper portname: deskutils/gnochm broken because: Uses unknown GNOME component pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=gnochm portname: deskutils/gnustep-notebook broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=gnustep-notebook portname: deskutils/kupfer broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=kupfer portname: deskutils/libopensync-plugin-sunbird broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=libopensync-plugin-sunbird portname: deskutils/timer-applet broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=timer-applet portname: devel/gettext-msghack broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=gettext-msghack portname: devel/hgview broken because: Logilab mirrors have gone build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=hgview portname: devel/libphish broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=libphish portname: devel/p5-Cdk broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=p5-Cdk portname: devel/rubygem-debugger broken because: Does not build with Ruby 2.1 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=rubygem-debugger portname: devel/subclipse broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=subclipse portname: devel/xtla broken because: Fails to package build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=xtla portname: dns/fastresolve broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=fastresolve portname: editors/e93 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=e93 portname: editors/scribes broken because: Uses unknown GNOME component pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=scribes portname: emulators/xzx broken because: Unfetchable build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/xzx-4.6_4.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=emulators&portname=xzx portname: french/belote broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=french&portname=belote portname: french/dico broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=french&portname=dico portname: ftp/twoftpd broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=twoftpd portname: games/alephone-data broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=alephone-data portname: games/fortunate broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=fortunate portname: games/py-pychess broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=py-pychess portname: games/wmfortune broken because: No public disfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=wmfortune portname: german/bsdpaste broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=german&portname=bsdpaste portname: german/wordpress broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=german&portname=wordpress portname: graphics/aeskulap broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=aeskulap portname: graphics/epdfview broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=epdfview portname: graphics/gnash broken because: unable to link in libboost_system build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gnash portname: graphics/gpsmanshp broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gpsmanshp portname: graphics/gx broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gx portname: graphics/optar broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=optar portname: graphics/php-magickwand broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=php-magickwand portname: graphics/png2html broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=png2html portname: graphics/pure-gl broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=pure-gl portname: graphics/pyro broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=pyro portname: graphics/qcread broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=qcread portname: java/eclipse-RDT broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-RDT portname: java/eclipse-aptana-radrails broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana-radrails portname: java/eclipse-checkstyle broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-checkstyle portname: java/eclipse-examples broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-examples portname: java/eclipse-gef-examples broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-gef-examples portname: java/eclipse-hibernatetools broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-hibernatetools portname: java/eclipse-langpack broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-langpack portname: java/eclipse-pmd broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-pmd portname: java/eclipse-sqlexplorer broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sqlexplorer portname: java/eclipse-sysdeo-tomcat broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sysdeo-tomcat portname: java/eclipse-uml broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-uml portname: java/eclipse-vep broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep portname: java/eclipse-vep-examples broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep-examples portname: java/eclipse-viplugin broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-viplugin portname: mail/cucipop broken because: Dead patch site build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=cucipop portname: mail/mail-notification broken because: Run-time failure with Gnome 3 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=mail-notification portname: multimedia/bombono broken because: does not build on 10.x+ build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=bombono portname: multimedia/handbrake broken because: Fails to build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=handbrake portname: multimedia/streamanalyze broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=streamanalyze portname: net/nocatsplash broken because: Broken pkg-install script, should use USERS and UIDs build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=nocatsplash portname: sysutils/monitord broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=monitord portname: sysutils/sdd broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=sdd portname: textproc/py-xmltools broken because: LOGILAB has gone build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=py-xmltools portname: www/diamanda broken because: Does not work with current django build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=diamanda portname: www/py-feedfinder broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-feedfinder portname: www/py-openssl-proxy broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-openssl-proxy portname: www/py-webware broken because: Too creative build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-webware portname: x11-fonts/code2001 broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-fonts&portname=code2001 portname: x11-fonts/tmu broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-fonts&portname=tmu portname: x11-wm/ede broken because: Fails to link, tries to use internal fltk symbols build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-wm&portname=ede portname: x11/avant-window-navigator broken because: Fails to build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11&portname=avant-window-navigator portname: x11/xsel broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11&portname=xsel From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 08:29:31 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id C902E650 for ; Tue, 7 Apr 2015 08:29:31 +0000 (UTC) Received: from portsmon.freebsd.org (portsmon.freebsd.org [IPv6:2001:1900:2254:206a::50:3]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id B671B884 for ; Tue, 7 Apr 2015 08:29:31 +0000 (UTC) Received: from portsmon.freebsd.org ([127.0.1.104]) by portsmon.freebsd.org (8.14.9/8.14.9) with ESMTP id t378TVCu012077 for ; Tue, 7 Apr 2015 08:29:31 GMT (envelope-from linimon@FreeBSD.org) Date: Tue, 7 Apr 2015 08:29:31 GMT Message-Id: <201504070829.t378TVCu012077@portsmon.freebsd.org> From: linimon@FreeBSD.org To: ports@FreeBSD.org Reply-To: portmgr-feedback@FreeBSD.org Subject: FreeBSD ports which are currently marked broken X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 08:29:32 -0000 As part of an ongoing effort to reduce the number of problems in the FreeBSD ports system, we periodically notify users of ports that are marked as "broken" in their Makefiles. In many cases these ports are failing to compile on some subset of the FreeBSD build environments. One common problem is that recent versions of FreeBSD use clang instead of gcc by default. Another common problem is that the compiles succeed on the i386 and amd64 architecture (e.g. the common Intel PC), but fail on one or more of the other architectures due to assumptions about things such as size of various types, byte-alignment issues, and so forth. In occasional cases we see that the same port may have different errors in different build environments. The script that runs on the build cluster uses heuristics to try to 'guess' the error type to help you isolate problems, but it is only a rough guide. One more note: on occasion, there are transient build errors seen on the build farm. Unfortunately, there is not yet any way for this algorithm to tell the difference (humans are much, much better at this kind of thing.) The errors are listed below. In the case where the same problem exists on more than one build environment, the URL points to the latest errorlog for that type. (By 'build environment' here we mean 'combination of 8.x/9.x/10.x/-current with target architecture'.) portname: archivers/hlextract broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=hlextract portname: archivers/pecl-lzf broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=pecl-lzf portname: archivers/ruby-zip broken because: Does not build with Ruby 2.1 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=ruby-zip portname: archivers/wzip broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=wzip portname: archivers/zipmix broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=zipmix portname: astro/aa broken because: Checksum mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=aa portname: astro/dgpsip broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=dgpsip portname: astro/ephem broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=ephem portname: astro/gpstk broken because: Distfile size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=gpstk portname: astro/sky2000 broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=sky2000 portname: astro/wmglobe broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=astro&portname=wmglobe portname: audio/aacgain broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=aacgain portname: audio/amb-plugins broken because: Distfile size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=amb-plugins portname: audio/ampache broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=ampache portname: audio/amrcoder broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=amrcoder portname: audio/atunes broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=atunes portname: audio/aureal-kmod broken because: does not build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=aureal-kmod portname: audio/btc broken because: Ftp time out build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=btc portname: audio/cd2mp3 broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=cd2mp3 portname: audio/cmus-post.fm broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=cmus-post.fm portname: audio/cplay broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=cplay portname: audio/cripple broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=cripple portname: audio/cymbaline broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=cymbaline portname: audio/dvda-author broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=dvda-author portname: audio/festival broken because: debian patches fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=festival portname: audio/freealut broken because: Fails to fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=freealut portname: audio/gramofile broken because: Debian patches unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=gramofile portname: audio/kstreamripper broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=kstreamripper portname: audio/libbs2b broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=libbs2b portname: audio/libopenspc broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=libopenspc portname: audio/linux-fmodapi broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=linux-fmodapi portname: audio/linux-genpuid broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=linux-genpuid portname: audio/lmms broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=lmms portname: audio/mp3c broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=mp3c portname: audio/mpdscribble broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=mpdscribble portname: audio/musica broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=musica portname: audio/optimfrog broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=optimfrog portname: audio/padevchooser broken because: needs update to support pulseaudio 5.0 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=padevchooser portname: audio/pecl-id3 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=pecl-id3 portname: audio/praat broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=praat portname: audio/pure-audio broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=pure-audio portname: audio/rsynth broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=rsynth portname: audio/ruby-audiofile broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=ruby-audiofile portname: audio/ruby-mp3tag broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=ruby-mp3tag portname: audio/ruby-taglib broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=ruby-taglib portname: audio/scmpc broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=scmpc portname: audio/shoutcast broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=shoutcast portname: audio/snd broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=snd portname: audio/sonice broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=sonice portname: audio/sphinx broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=sphinx portname: audio/streamtranscoder broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=streamtranscoder portname: audio/taglib-extras broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=taglib-extras portname: audio/taglookup broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=taglookup portname: audio/tepsonic broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=tepsonic portname: audio/umurmur broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=umurmur portname: audio/wmmp broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=wmmp portname: audio/xmms-faad broken because: No MASTER_SITES build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=xmms-faad portname: audio/xmms-openspc broken because: does not build on FreeBSD 10.x and later build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=xmms-openspc portname: audio/xmradio broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=audio&portname=xmradio portname: benchmarks/dbench broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=dbench portname: benchmarks/fhourstones broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=fhourstones portname: benchmarks/flops broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=flops portname: benchmarks/geekbench broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=geekbench portname: benchmarks/netpipe broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=netpipe portname: benchmarks/nuttcp broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=nuttcp portname: benchmarks/pathload broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=pathload portname: benchmarks/pathrate broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=pathrate portname: benchmarks/pipebench broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=pipebench portname: benchmarks/unixbench broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=benchmarks&portname=unixbench portname: biology/consed broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=consed portname: biology/migrate broken because: unfetchable build errors: http://beefy2.isc.freebsd.org/bulk/84amd64-default/2015-03-20_06h25m48s/logs/errors/migrate-3.6.6.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=migrate portname: biology/ncbi-blast+ broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=ncbi-blast%2B portname: biology/njplot broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=njplot portname: biology/ortep3 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=ortep3 portname: biology/p5-Bio-ASN1-EntrezGene broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=p5-Bio-ASN1-EntrezGene portname: biology/paml broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=paml portname: biology/platon broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=platon portname: biology/povchem broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=povchem portname: biology/seaview broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=biology&portname=seaview portname: cad/brickutils broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=brickutils portname: cad/findhier broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=findhier portname: cad/geda-docs broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-docs portname: cad/geda-examples broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-examples portname: cad/geda-gattrib broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-gattrib portname: cad/geda-gschem broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-gschem portname: cad/geda-netlist broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-netlist portname: cad/geda-symbols broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-symbols portname: cad/geda-symcheck broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-symcheck portname: cad/geda-utils broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=geda-utils portname: cad/gmsh-occ broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=gmsh-occ portname: cad/ldraw broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=ldraw portname: cad/libgeda broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=libgeda portname: cad/slffea broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=slffea portname: cad/z88 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=cad&portname=z88 portname: chinese/bg5ps broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=bg5ps portname: chinese/cce broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=cce portname: chinese/cwtexttf broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=cwtexttf portname: chinese/fireflyttf broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=fireflyttf portname: chinese/gugod-clean broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=gugod-clean portname: chinese/libtabe broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=libtabe portname: chinese/oxim broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=oxim portname: chinese/p5-Lingua-ZH-BPMFConvert broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=p5-Lingua-ZH-BPMFConvert portname: chinese/sunpinyin broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=sunpinyin portname: comms/bforce broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=bforce portname: comms/birda broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=birda portname: comms/dabstick-radio broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=dabstick-radio portname: comms/dfu-util broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=dfu-util portname: comms/flrig broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=flrig portname: comms/gkermit broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=gkermit portname: comms/gpsk31 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=gpsk31 portname: comms/jsdr broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=jsdr portname: comms/mlan3 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=mlan3 portname: comms/nec2c broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=nec2c portname: comms/p5-SMS-SMS77 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=p5-SMS-SMS77 portname: comms/py-bulksms broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=py-bulksms portname: comms/qpage broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=qpage portname: comms/serialoverip broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=serialoverip portname: comms/seyon broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=seyon portname: comms/trustedqsl broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=trustedqsl portname: comms/zmtx-zmrx broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=comms&portname=zmtx-zmrx portname: converters/dumpasn1 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=dumpasn1 portname: converters/p5-String-SetUTF8 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=p5-String-SetUTF8 portname: converters/psiconv broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=psiconv portname: databases/mysql-connector-c broken because: Fails to configure build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=mysql-connector-c portname: databases/rubygem-bdb1 broken because: Does not build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=rubygem-bdb1 portname: databases/rubygem-memcache broken because: Does not build with Ruby 2.1 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=rubygem-memcache portname: deskutils/akamaru broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=akamaru portname: deskutils/bigyear broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=bigyear portname: deskutils/cdcat broken because: Fails to build with new p7zip build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=cdcat portname: deskutils/charmap broken because: Newer version does not work with recent objective C build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=charmap portname: deskutils/deskbar-applet broken because: Uses unknown GNOME components pygnomedesktop and evolutiondataserver build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=deskbar-applet portname: deskutils/displaycalibrator broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=displaycalibrator portname: deskutils/gimmie broken because: Uses unknown GNOME components pygnomedesktop and pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=gimmie portname: deskutils/glipper broken because: Uses unknown GNOME components pygnomedesktop and pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=glipper portname: deskutils/gnochm broken because: Uses unknown GNOME component pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=gnochm portname: deskutils/gnustep-notebook broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=gnustep-notebook portname: deskutils/gruler broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=gruler portname: deskutils/hamster-applet broken because: Uses unknown GNOME components pygnomedesktop and gnomecontrolcenter2 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=hamster-applet portname: deskutils/kupfer broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=kupfer portname: deskutils/libopensync-plugin-file broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=libopensync-plugin-file portname: deskutils/libopensync-plugin-python broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=libopensync-plugin-python portname: deskutils/libopensync-plugin-sunbird broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=libopensync-plugin-sunbird portname: deskutils/libopensync-plugin-vformat-devel broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=libopensync-plugin-vformat-devel portname: deskutils/mrundlg broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=mrundlg portname: deskutils/msynctool broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=msynctool portname: deskutils/ontv broken because: Uses unknown GNOME components pygnomedesktop and pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=ontv portname: deskutils/osynctool broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=osynctool portname: deskutils/timer-applet broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=timer-applet portname: deskutils/tomboy-plugin-wordcount broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=tomboy-plugin-wordcount portname: deskutils/x-tile broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=deskutils&portname=x-tile portname: devel/gettext-msghack broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=gettext-msghack portname: devel/gzstream broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=gzstream portname: devel/hgview broken because: Logilab mirrors have gone build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=hgview portname: devel/libphish broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=libphish portname: devel/p5-Cdk broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=p5-Cdk portname: devel/ruby-langscan broken because: Does not build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=ruby-langscan portname: devel/rubygem-debugger broken because: Does not build with Ruby 2.1 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=rubygem-debugger portname: devel/rubygem-igraph broken because: does not build with igraph-0.7.1 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=rubygem-igraph portname: devel/scala-ide broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=scala-ide portname: devel/subclipse broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=subclipse portname: devel/xtla broken because: Fails to package build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=xtla portname: dns/dnsmasq-devel broken because: Size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=dnsmasq-devel portname: dns/fastresolve broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=fastresolve portname: dns/firedns broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=firedns portname: dns/geta broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=geta portname: dns/p5-Net-DNS-ZoneCheck broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=p5-Net-DNS-ZoneCheck portname: dns/totd broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=totd portname: editors/bpatch broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=bpatch portname: editors/e93 broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=e93 portname: editors/nedit broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=nedit portname: editors/nvi-devel broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=nvi-devel portname: editors/scribes broken because: Uses unknown GNOME component pygnomeextras build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=scribes portname: editors/spe broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=spe portname: editors/yasnippet broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=editors&portname=yasnippet portname: emulators/kqemu-kmod broken because: KPI changes in 10 and up, use bhyve or vbox build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=emulators&portname=kqemu-kmod portname: emulators/xzx broken because: Unfetchable build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/xzx-4.6_4.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=emulators&portname=xzx portname: finance/openerp-web broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=finance&portname=openerp-web portname: french/alphabet_sounds_fr broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=french&portname=alphabet_sounds_fr portname: french/belote broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=french&portname=belote portname: french/dico broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=french&portname=dico portname: ftp/axel broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=axel portname: ftp/fmirror broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=fmirror portname: ftp/ftpsync broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=ftpsync portname: ftp/gnusget broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=gnusget portname: ftp/ncftp1 broken because: Unfetchable build errors: http://beefy1.isc.freebsd.org/bulk/101i386-default/2015-03-18_07h59m51s/logs/errors/ncftp1-1.9.5.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=ncftp1 portname: ftp/spegla broken because: Checksum mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=spegla portname: ftp/twoftpd broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=twoftpd portname: games/alephone-data broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=alephone-data portname: games/fortunate broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=fortunate portname: games/gtkradiant broken because: Does not support modern png build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=gtkradiant portname: games/linux-candycruncher-demo broken because: Does not fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=linux-candycruncher-demo portname: games/linux-coldwar-demo broken because: Does not fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=linux-coldwar-demo portname: games/linux-gorky17-demo broken because: Does not fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=linux-gorky17-demo portname: games/linux-hdb-demo broken because: Does not fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=linux-hdb-demo portname: games/linux-majesty-demo broken because: Does not fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=linux-majesty-demo portname: games/linux-ningpo-demo broken because: Does not fetch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=linux-ningpo-demo portname: games/py-pychess broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=py-pychess portname: games/spring broken because: Fails to build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=spring portname: games/wmfortune broken because: No public disfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=wmfortune portname: german/bsdpaste broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=german&portname=bsdpaste portname: german/wordpress broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=german&portname=wordpress portname: graphics/aeskulap broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=aeskulap portname: graphics/clutter-box2d broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=clutter-box2d portname: graphics/epdfview broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=epdfview portname: graphics/fli2gif broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=fli2gif portname: graphics/fotofix broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=fotofix portname: graphics/gimp-elsamuko-script broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gimp-elsamuko-script portname: graphics/gnash broken because: unable to link in libboost_system build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gnash portname: graphics/gpsmanshp broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gpsmanshp portname: graphics/grads broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=grads portname: graphics/gx broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=gx portname: graphics/icoconvert broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=icoconvert portname: graphics/jpeg2ps broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=jpeg2ps portname: graphics/kuickshow-kde4 broken because: depends on imlib build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=kuickshow-kde4 portname: graphics/linux-XnViewMP broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=linux-XnViewMP portname: graphics/opengtl broken because: Depends on deleted devel/llvm32 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=opengtl portname: graphics/optar broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=optar portname: graphics/pdf2svg broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=pdf2svg portname: graphics/php-magickwand broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=php-magickwand portname: graphics/picviz broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=picviz portname: graphics/png2html broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=png2html portname: graphics/pure-gl broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=pure-gl portname: graphics/pyro broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=pyro portname: graphics/qcread broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=qcread portname: graphics/ruby-gd broken because: Does not build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=ruby-gd portname: graphics/rubyphoto broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=rubyphoto portname: graphics/sketch broken because: Checksum and size mismatch build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=sketch portname: graphics/sng broken because: Does not support modern png build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=sng portname: graphics/xfractint broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=xfractint portname: japanese/netype broken because: depends on imlib build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=japanese&portname=netype portname: japanese/p5-Text-MeCab broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=japanese&portname=p5-Text-MeCab portname: java/commonclipse broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=commonclipse portname: java/eclipse-RDT broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-RDT portname: java/eclipse-aptana broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana portname: java/eclipse-aptana-radrails broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana-radrails portname: java/eclipse-aptana2 broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana2 portname: java/eclipse-checkstyle broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-checkstyle portname: java/eclipse-datatools broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-datatools portname: java/eclipse-emf broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-emf portname: java/eclipse-examples broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-examples portname: java/eclipse-gef broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-gef portname: java/eclipse-gef-examples broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-gef-examples portname: java/eclipse-hibernatetools broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-hibernatetools portname: java/eclipse-jad broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-jad portname: java/eclipse-langpack broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-langpack portname: java/eclipse-pmd broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-pmd portname: java/eclipse-propedit broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-propedit portname: java/eclipse-sqlexplorer broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sqlexplorer portname: java/eclipse-sysdeo-tomcat broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sysdeo-tomcat portname: java/eclipse-uml broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-uml portname: java/eclipse-vep broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep portname: java/eclipse-vep-examples broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep-examples portname: java/eclipse-viplugin broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-viplugin portname: java/eclipse-webtools broken because: plugin is obsolete or malfunctioning with latest eclipse build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-webtools portname: lang/pure broken because: Depends on deleted devel/llvm32 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=pure portname: mail/cucipop broken because: Dead patch site build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=cucipop portname: mail/mail-notification broken because: Run-time failure with Gnome 3 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=mail-notification portname: mail/maildirsync broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=maildirsync portname: mail/p5-MIME-Fast broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=p5-MIME-Fast portname: mail/qar-bufo broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=qar-bufo portname: math/R-cran-car broken because: Missing dependency build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=math&portname=R-cran-car portname: multimedia/arista broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=arista portname: multimedia/bombono broken because: does not build on 10.x+ build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=bombono portname: multimedia/handbrake broken because: Fails to build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=handbrake portname: multimedia/streamanalyze broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=streamanalyze portname: multimedia/subtitleeditor broken because: Does not compile on FreeBSD 10.0 and later build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=multimedia&portname=subtitleeditor portname: net-im/skype4 broken because: Skype 4.3 is missing several Linux syscalls. build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net-im&portname=skype4 portname: net-mgmt/netxms broken because: Fails to package build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net-mgmt&portname=netxms portname: net/cyphesis broken because: Does not compile on FreeBSD 10+ build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=cyphesis portname: net/gpxe broken because: does not build on FreeBSD 10.x and later build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=gpxe portname: net/mediatomb broken because: Fails to configure, does not use USERS/GROUPS build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/mediatomb-0.12.1_12.log http://beefy1.isc.freebsd.org/bulk/84i386-default/2015-03-20_09h18m03s/logs/errors/mediatomb-0.12.1_12.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=mediatomb portname: net/nocatsplash broken because: Broken pkg-install script, should use USERS and UIDs build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=nocatsplash portname: net/ntopng broken because: Fails to link build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=ntopng portname: net/openospfd broken because: requires old CARP implementation (interface layer) build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=openospfd portname: net/service-discovery-applet broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=service-discovery-applet portname: ports-mgmt/gnome-packagekit broken because: Uses unknown GNOME component gnomemenus build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ports-mgmt&portname=gnome-packagekit portname: ports-mgmt/portell broken because: does not fetch, https://lists.freebsd.org/pipermail/freebsd-ports/2015-March/098494.html build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ports-mgmt&portname=portell portname: print/gnome-specimen broken because: Uses unknown GNOME component pygnomedesktop build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=print&portname=gnome-specimen portname: science/rubygem-netcdf broken because: Does not build with new devel/ruby-gems build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=science&portname=rubygem-netcdf portname: security/p5-Crypt-GOST broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=p5-Crypt-GOST portname: security/p5-Crypt-TEA broken because: Does not build with Perl 5.18 or above build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=p5-Crypt-TEA portname: security/ruby-camellia broken because: Does not build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=ruby-camellia portname: sysutils/copytape broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=copytape portname: sysutils/monitord broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=monitord portname: sysutils/pcbsd-utils broken because: Fails to stage, has both build dependencies and NO_BUILD=yes build errors: http://beefy1.isc.freebsd.org/bulk/101i386-default/2015-03-18_07h59m51s/logs/errors/pcbsd-utils-1422974289.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=pcbsd-utils portname: sysutils/pesign broken because: build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=pesign portname: sysutils/puppet27 broken because: Does not work with Ruby 2.0 or Ruby 2.1 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=puppet27 portname: sysutils/py-salt-api broken because: Conflicts with py27-salt-2014.7.0 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=py-salt-api portname: sysutils/sdd broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=sdd portname: sysutils/xfce4-minicmd-plugin broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=xfce4-minicmd-plugin portname: textproc/aiksaurus-gtk broken because: does not link against GTK2 on FreeBSD 10+ build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=aiksaurus-gtk portname: textproc/p5-Groonga-API broken because: Fails to build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=p5-Groonga-API portname: textproc/pecl-cld broken because: Missing headers with cld 20150113 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=pecl-cld portname: textproc/py-xmltools broken because: LOGILAB has gone build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=py-xmltools portname: textproc/refdb broken because: Fails to link build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=refdb portname: www/diamanda broken because: Does not work with current django build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=diamanda portname: www/linux-libgtkembedmoz broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=linux-libgtkembedmoz portname: www/py-feedfinder broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-feedfinder portname: www/py-nevow broken because: Unfetchable build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-nevow portname: www/py-openssl-proxy broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-openssl-proxy portname: www/py-webware broken because: Too creative build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=py-webware portname: x11-fonts/code2001 broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-fonts&portname=code2001 portname: x11-fonts/tmu broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-fonts&portname=tmu portname: x11-themes/gtk-aqualightblue-theme broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-themes&portname=gtk-aqualightblue-theme portname: x11-themes/gtk-flat-theme2 broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-themes&portname=gtk-flat-theme2 portname: x11-wm/e-module-diskio broken because: Don't build with EFL 1.13.0 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-wm&portname=e-module-diskio portname: x11-wm/ede broken because: Fails to link, tries to use internal fltk symbols build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11-wm&portname=ede portname: x11/avant-window-navigator broken because: Fails to build build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11&portname=avant-window-navigator portname: x11/xsel broken because: No public distfiles build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11&portname=xsel From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 08:29:41 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 1A01F709 for ; Tue, 7 Apr 2015 08:29:41 +0000 (UTC) Received: from portsmon.freebsd.org (portsmon.freebsd.org [IPv6:2001:1900:2254:206a::50:3]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 087BE89B for ; Tue, 7 Apr 2015 08:29:41 +0000 (UTC) Received: from portsmon.freebsd.org ([127.0.1.104]) by portsmon.freebsd.org (8.14.9/8.14.9) with ESMTP id t378Tf6X013069 for ; Tue, 7 Apr 2015 08:29:41 GMT (envelope-from linimon@FreeBSD.org) Date: Tue, 7 Apr 2015 08:29:41 GMT Message-Id: <201504070829.t378Tf6X013069@portsmon.freebsd.org> From: linimon@FreeBSD.org To: ports@freebsd.org Reply-To: portmgr-feedback@FreeBSD.org Subject: FreeBSD unmaintained ports which are currently scheduled for deletion X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 08:29:41 -0000 As part of an ongoing effort to reduce the number of problems in the FreeBSD ports system, we periodically schedule removal of ports that have been judged to have outlived their usefulness. Often, this is due to a better alternative having become available and/or the cessation of development on the existing port. In some cases, ports are marked for removal because they fail to build and install correctly from their sources, or otherwise fail in operation. The ports, and the reason and date that they have been scheduled for removal, are listed below. If no one has stepped forward before that time to propose a way to fix the problems (such as via a PR), the ports will be deleted. portname: archivers/php53-bz2 description: The bz2 shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-bz2 portname: archivers/php53-phar description: The phar shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-phar portname: archivers/php53-zip description: The zip shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-zip portname: archivers/php53-zlib description: The zlib shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-zlib portname: chinese/joe description: Joe's Own Editor maintainer: ports@FreeBSD.org deprecated because: The difference with editors/joe is too trivial to warrant a separate port expiration date: 2015-09-27 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=joe portname: converters/php53-iconv description: The iconv shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=php53-iconv portname: converters/php53-mbstring description: The mbstring shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=php53-mbstring portname: converters/php53-recode description: The recode shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=php53-recode portname: databases/php53-dba description: The dba shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-dba portname: databases/php53-interbase description: The interbase shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-interbase portname: databases/php53-mssql description: The mssql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-mssql portname: databases/php53-mysql description: The mysql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-mysql portname: databases/php53-mysqli description: The mysqli shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-mysqli portname: databases/php53-odbc description: The odbc shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-odbc portname: databases/php53-pdo description: The pdo shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo portname: databases/php53-pdo_dblib description: The pdo_dblib shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_dblib portname: databases/php53-pdo_firebird description: The pdo_firebird shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_firebird portname: databases/php53-pdo_mysql description: The pdo_mysql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_mysql portname: databases/php53-pdo_odbc description: The pdo_odbc shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_odbc portname: databases/php53-pdo_pgsql description: The pdo_pgsql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_pgsql portname: databases/php53-pdo_sqlite description: The pdo_sqlite shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_sqlite portname: databases/php53-pgsql description: The pgsql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pgsql portname: databases/php53-redis description: PHP5-Extension for Redis maintainer: ports@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-redis portname: databases/php53-sqlite description: The sqlite shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-sqlite portname: databases/php53-sqlite3 description: The sqlite3 shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-sqlite3 portname: databases/php53-sybase_ct description: The sybase_ct shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-sybase_ct portname: databases/sqlitemanager description: Multilingual web based tool to manage SQLite database maintainer: ports@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=sqlitemanager portname: devel/cross-binutils description: GNU binutils port for cross-target development maintainer: ports@FreeBSD.org status: FORBIDDEN deprecated because: Obsolete. Migrate to devel/binutils based ports expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=cross-binutils portname: devel/mingw64-binutils description: GNU binutils port for cross-target development maintainer: ports@FreeBSD.org status: FORBIDDEN deprecated because: Obsolete. Migrate to devel/binutils based ports expiration date: 2015-04-15 build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/x86_64-pc-mingw32-binutils-2.23.2_1.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=mingw64-binutils portname: devel/php53-gettext description: The gettext shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-gettext portname: devel/php53-json description: The json shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-json portname: devel/php53-pcntl description: The pcntl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-pcntl portname: devel/php53-readline description: The readline shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-readline portname: devel/php53-shmop description: The shmop shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-shmop portname: devel/php53-sysvmsg description: The sysvmsg shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-sysvmsg portname: devel/php53-sysvsem description: The sysvsem shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-sysvsem portname: devel/php53-sysvshm description: The sysvshm shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-sysvshm portname: devel/php53-tokenizer description: The tokenizer shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-tokenizer portname: devel/subclipse description: Subversion plugin for the Eclipse IDE Framework maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=subclipse portname: ftp/php53-curl description: The curl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=php53-curl portname: ftp/php53-ftp description: The ftp shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=php53-ftp portname: games/airstrike description: 2d biplane dogfight game maintainer: ports@FreeBSD.org deprecated because: never completed, alpha quality, dev site and repo do not resolve expiration date: 2015-04-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=airstrike portname: games/wmfortune description: Dockapp that outputs fortune messages maintainer: ports@FreeBSD.org status: BROKEN deprecated because: Broken for more than 6 months expiration date: 2015-04-30 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=wmfortune portname: german/pecl-konto_check description: PHP module to check German and Austrian Bank Account Numbers maintainer: ports@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=german&portname=pecl-konto_check portname: graphics/php53-exif description: The exif shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=php53-exif portname: graphics/php53-gd description: The gd shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=php53-gd portname: java/eclipse-RDT description: RDT adds Ruby support to the Eclipse IDE Framework maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-RDT portname: java/eclipse-aptana-radrails description: IDE for Ruby and the Ruby on Rails framework (Eclipse plugin) maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana-radrails portname: java/eclipse-checkstyle description: Integrates the Checkstyle Java code auditor into Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-checkstyle portname: java/eclipse-examples description: Examples for the Eclipse IDE maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-examples portname: java/eclipse-gef-examples description: Graphical Editing Framework for the Eclipse IDE (examples) maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-gef-examples portname: java/eclipse-hibernatetools description: Hibernate3 Tools for the Eclipse IDE maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-hibernatetools portname: java/eclipse-langpack description: Eclipse Language Pack Feature maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-langpack portname: java/eclipse-pmd description: Scan Java source code and look for potential problems maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-pmd portname: java/eclipse-quantum description: Database access and SQL editor for the Eclipse IDE maintainer: ports@FreeBSD.org deprecated because: depends on deprecated java/eclipse-gef expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-quantum portname: java/eclipse-sqlexplorer description: Visual database query tool for Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sqlexplorer portname: java/eclipse-sysdeo-tomcat description: Sysdeo Tomcat Launcher plugin for Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sysdeo-tomcat portname: java/eclipse-uml description: Framework creating UML diagrams in Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-uml portname: java/eclipse-vep description: Framework for creating GUI builders for Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep portname: java/eclipse-vep-examples description: Visual Editor Project for the Eclipse IDE (examples) maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep-examples portname: java/eclipse-viplugin description: Vi like keybinding Eclipse plugin FREETRIAL Version maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-viplugin portname: lang/php53 description: PHP Scripting Language maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=php53 portname: lang/php53-extensions description: "meta-port" to install PHP extensions maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=php53-extensions portname: mail/php53-imap description: The imap shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=php53-imap portname: math/php53-bcmath description: The bcmath shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=math&portname=php53-bcmath portname: math/php53-gmp description: The gmp shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=math&portname=php53-gmp portname: misc/php53-calendar description: The calendar shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=misc&portname=php53-calendar portname: net-mgmt/php53-snmp description: The snmp shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net-mgmt&portname=php53-snmp portname: net/php53-ldap description: The ldap shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-ldap portname: net/php53-soap description: The soap shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-soap portname: net/php53-sockets description: The sockets shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-sockets portname: net/php53-xmlrpc description: The xmlrpc shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-xmlrpc portname: security/php53-filter description: The filter shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-filter portname: security/php53-hash description: The hash shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-hash portname: security/php53-mcrypt description: The mcrypt shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-mcrypt portname: security/php53-openssl description: The openssl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-openssl portname: sysutils/php53-fileinfo description: The fileinfo shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=php53-fileinfo portname: sysutils/php53-posix description: The posix shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=php53-posix portname: textproc/php53-ctype description: The ctype shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-ctype portname: textproc/php53-dom description: The dom shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-dom portname: textproc/php53-pspell description: The pspell shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-pspell portname: textproc/php53-simplexml description: The simplexml shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-simplexml portname: textproc/php53-wddx description: The wddx shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-wddx portname: textproc/php53-xml description: The xml shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xml portname: textproc/php53-xmlreader description: The xmlreader shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xmlreader portname: textproc/php53-xmlwriter description: The xmlwriter shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xmlwriter portname: textproc/php53-xsl description: The xsl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xsl portname: www/php53-session description: The session shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=php53-session portname: www/php53-tidy description: The tidy shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=php53-tidy portname: www/trac-batchmodify description: Enables users to modify several tickets together at once maintainer: ports@FreeBSD.org deprecated because: This functionality was merged into Trac since version 1.0 expiration date: 2015-04-08 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=trac-batchmodify From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 08:29:46 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 6B2227B6 for ; Tue, 7 Apr 2015 08:29:46 +0000 (UTC) Received: from portsmon.freebsd.org (portsmon.freebsd.org [IPv6:2001:1900:2254:206a::50:3]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 597668A3 for ; Tue, 7 Apr 2015 08:29:46 +0000 (UTC) Received: from portsmon.freebsd.org ([127.0.1.104]) by portsmon.freebsd.org (8.14.9/8.14.9) with ESMTP id t378Tk4t014095 for ; Tue, 7 Apr 2015 08:29:46 GMT (envelope-from linimon@FreeBSD.org) Date: Tue, 7 Apr 2015 08:29:46 GMT Message-Id: <201504070829.t378Tk4t014095@portsmon.freebsd.org> From: linimon@FreeBSD.org To: ports@FreeBSD.org Reply-To: portmgr-feedback@FreeBSD.org Subject: FreeBSD ports which are currently scheduled for deletion X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 08:29:46 -0000 As part of an ongoing effort to reduce the number of problems in the FreeBSD ports system, we periodically schedule removal of ports that have been judged to have outlived their usefulness. Often, this is due to a better alternative having become available and/or the cessation of development on the existing port. In some cases, ports are marked for removal because they fail to build and install correctly from their sources, or otherwise fail in operation. The ports, and the reason and date that they have been scheduled for removal, are listed below. If no one has stepped forward before that time to propose a way to fix the problems (such as via a PR), the ports will be deleted. portname: archivers/php53-bz2 description: The bz2 shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-bz2 portname: archivers/php53-phar description: The phar shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-phar portname: archivers/php53-zip description: The zip shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-zip portname: archivers/php53-zlib description: The zlib shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=archivers&portname=php53-zlib portname: chinese/joe description: Joe's Own Editor maintainer: ports@FreeBSD.org deprecated because: The difference with editors/joe is too trivial to warrant a separate port expiration date: 2015-09-27 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=chinese&portname=joe portname: converters/php53-iconv description: The iconv shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=php53-iconv portname: converters/php53-mbstring description: The mbstring shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=php53-mbstring portname: converters/php53-recode description: The recode shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=converters&portname=php53-recode portname: databases/db48 description: The Berkeley DB package, revision 4.8 maintainer: mandree@FreeBSD.org deprecated because: Please migrate to db5 or db6 expiration date: 2015-05-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=db48 portname: databases/php53-dba description: The dba shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-dba portname: databases/php53-interbase description: The interbase shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-interbase portname: databases/php53-mssql description: The mssql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-mssql portname: databases/php53-mysql description: The mysql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-mysql portname: databases/php53-mysqli description: The mysqli shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-mysqli portname: databases/php53-odbc description: The odbc shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-odbc portname: databases/php53-pdo description: The pdo shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo portname: databases/php53-pdo_dblib description: The pdo_dblib shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_dblib portname: databases/php53-pdo_firebird description: The pdo_firebird shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_firebird portname: databases/php53-pdo_mysql description: The pdo_mysql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_mysql portname: databases/php53-pdo_odbc description: The pdo_odbc shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_odbc portname: databases/php53-pdo_pgsql description: The pdo_pgsql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_pgsql portname: databases/php53-pdo_sqlite description: The pdo_sqlite shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pdo_sqlite portname: databases/php53-pgsql description: The pgsql shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-pgsql portname: databases/php53-redis description: PHP5-Extension for Redis maintainer: ports@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-redis portname: databases/php53-sqlite description: The sqlite shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-sqlite portname: databases/php53-sqlite3 description: The sqlite3 shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-sqlite3 portname: databases/php53-sybase_ct description: The sybase_ct shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=php53-sybase_ct portname: databases/postgresql84-client description: PostgreSQL database (client) maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-client portname: databases/postgresql84-contrib description: The contrib utilities from the PostgreSQL distribution maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-contrib portname: databases/postgresql84-docs description: The PostgreSQL documentation set maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-docs portname: databases/postgresql84-plperl description: Write SQL functions for PostgreSQL using Perl5 maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-plperl portname: databases/postgresql84-plpython description: Module for using Python to write SQL functions maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-plpython portname: databases/postgresql84-pltcl description: Module for using Tcl to write SQL functions maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-pltcl portname: databases/postgresql84-server description: The most advanced open-source database available anywhere maintainer: pgsql@FreeBSD.org deprecated because: EOL was reached in July 2014 expiration date: 2015-05-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=postgresql84-server portname: databases/sqlitemanager description: Multilingual web based tool to manage SQLite database maintainer: ports@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=databases&portname=sqlitemanager portname: devel/cross-binutils description: GNU binutils port for cross-target development maintainer: ports@FreeBSD.org status: FORBIDDEN deprecated because: Obsolete. Migrate to devel/binutils based ports expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=cross-binutils portname: devel/mingw64-binutils description: GNU binutils port for cross-target development maintainer: ports@FreeBSD.org status: FORBIDDEN deprecated because: Obsolete. Migrate to devel/binutils based ports expiration date: 2015-04-15 build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/x86_64-pc-mingw32-binutils-2.23.2_1.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=mingw64-binutils portname: devel/ocaml-equeue description: The Equeue library for OCaml maintainer: michipili@gmail.com deprecated because: Superseded by www/ocaml-net expiration date: 2015-08-20 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=ocaml-equeue portname: devel/p5-base description: Set of modules to operate with inheritance and class fields at runtime maintainer: perl@FreeBSD.org deprecated because: this port is outdated and base 2.18+ is already in all supported Perl releases expiration date: 2015-04-30 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=p5-base portname: devel/pecl-uuid description: UUID extension maintainer: jnlin@csie.nctu.edu.tw status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=pecl-uuid portname: devel/php53-gettext description: The gettext shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-gettext portname: devel/php53-json description: The json shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-json portname: devel/php53-pcntl description: The pcntl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-pcntl portname: devel/php53-readline description: The readline shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-readline portname: devel/php53-shmop description: The shmop shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-shmop portname: devel/php53-sysvmsg description: The sysvmsg shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-sysvmsg portname: devel/php53-sysvsem description: The sysvsem shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-sysvsem portname: devel/php53-sysvshm description: The sysvshm shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-sysvshm portname: devel/php53-tokenizer description: The tokenizer shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=php53-tokenizer portname: devel/scala-ide description: Scala plugin for the Eclipse IDE maintainer: ale@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=scala-ide portname: devel/subclipse description: Subversion plugin for the Eclipse IDE Framework maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=subclipse portname: dns/bind10 description: Development version of ISC BIND 10 DNS Suite maintainer: mat@FreeBSD.org status: IGNORE deprecated because: Is not developed any more, use dns/bundy expiration date: 2015-12-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=bind10 portname: dns/maradns1 description: DNS server with focus on security and simplicity maintainer: mat@FreeBSD.org deprecated because: MaraDNS 1 end-of-life: June 21, 2015, use dns/maradns expiration date: 2015-06-21 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=dns&portname=maradns1 portname: ftp/php53-curl description: The curl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=php53-curl portname: ftp/php53-ftp description: The ftp shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ftp&portname=php53-ftp portname: games/airstrike description: 2d biplane dogfight game maintainer: ports@FreeBSD.org deprecated because: never completed, alpha quality, dev site and repo do not resolve expiration date: 2015-04-10 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=airstrike portname: games/spring description: Project aiming to create a new and versatile RTS Engine maintainer: amdmi3@FreeBSD.org status: BROKEN deprecated because: Broken for more than 6 months expiration date: 2015-04-30 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=spring portname: games/springlobby description: Cross-platform lobby client for the Spring RTS project maintainer: amdmi3@FreeBSD.org deprecated because: Depends on expiring games/spring expiration date: 2015-04-30 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=springlobby portname: games/wmfortune description: Dockapp that outputs fortune messages maintainer: ports@FreeBSD.org status: BROKEN deprecated because: Broken for more than 6 months expiration date: 2015-04-30 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=games&portname=wmfortune portname: german/pecl-konto_check description: PHP module to check German and Austrian Bank Account Numbers maintainer: ports@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=german&portname=pecl-konto_check portname: graphics/pecl-imlib2 description: PECL extension if imlib2 maintainer: leeym@FreeBSD.org status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=pecl-imlib2 portname: graphics/php53-exif description: The exif shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=php53-exif portname: graphics/php53-gd description: The gd shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=graphics&portname=php53-gd portname: java/commonclipse description: Commonclipse is an eclipse plugin for jakarta commons-lang users maintainer: zhoushuqun@gmail.com status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=commonclipse portname: java/eclipse-RDT description: RDT adds Ruby support to the Eclipse IDE Framework maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-RDT portname: java/eclipse-aptana description: Aptana Web Development Tools (Eclipse plugin) maintainer: nivit@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana portname: java/eclipse-aptana-radrails description: IDE for Ruby and the Ruby on Rails framework (Eclipse plugin) maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana-radrails portname: java/eclipse-aptana2 description: Aptana Studio 2 Web Development Tools (Eclipse plugin) maintainer: nivit@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-aptana2 portname: java/eclipse-checkstyle description: Integrates the Checkstyle Java code auditor into Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-checkstyle portname: java/eclipse-datatools description: Data Tools Platform for the Eclipse IDE maintainer: ljboiler@gmail.com status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-datatools portname: java/eclipse-emf description: Eclipse Modeling Framework maintainer: kamikaze@bsdforen.de status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-emf portname: java/eclipse-examples description: Examples for the Eclipse IDE maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-examples portname: java/eclipse-gef description: Graphical Editing Framework for the Eclipse IDE maintainer: zhoushuqun@gmail.com status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-gef portname: java/eclipse-gef-examples description: Graphical Editing Framework for the Eclipse IDE (examples) maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-gef-examples portname: java/eclipse-hibernatetools description: Hibernate3 Tools for the Eclipse IDE maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-hibernatetools portname: java/eclipse-jad description: Jad Java decompiler plugin for the Eclipse IDE maintainer: ale@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-jad portname: java/eclipse-langpack description: Eclipse Language Pack Feature maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-langpack portname: java/eclipse-ocl description: Implementation of the OCL OMG standard for EMF-based models maintainer: vj562001@yahoo.de deprecated because: depends on deprecated java/eclipse-emf expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-ocl portname: java/eclipse-pmd description: Scan Java source code and look for potential problems maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-pmd portname: java/eclipse-propedit description: Properties editor for eclipse maintainer: zhoushuqun@gmail.com status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-propedit portname: java/eclipse-quantum description: Database access and SQL editor for the Eclipse IDE maintainer: ports@FreeBSD.org deprecated because: depends on deprecated java/eclipse-gef expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-quantum portname: java/eclipse-sqlexplorer description: Visual database query tool for Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sqlexplorer portname: java/eclipse-sysdeo-tomcat description: Sysdeo Tomcat Launcher plugin for Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-sysdeo-tomcat portname: java/eclipse-uml description: Framework creating UML diagrams in Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-uml portname: java/eclipse-vep description: Framework for creating GUI builders for Eclipse maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep portname: java/eclipse-vep-examples description: Visual Editor Project for the Eclipse IDE (examples) maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-vep-examples portname: java/eclipse-viplugin description: Vi like keybinding Eclipse plugin FREETRIAL Version maintainer: ports@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-viplugin portname: java/eclipse-webtools description: Webtools for eclipse maintainer: ale@FreeBSD.org status: BROKEN deprecated because: evaluation recommendation is to remove rather than update expiration date: 2015-04-18 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=java&portname=eclipse-webtools portname: lang/gcc47-aux description: Version of GCC 4.7 with full Ada support maintainer: marino@FreeBSD.org deprecated because: GCC 4.7 branch closed June 2014, move to lang/gcc-aux expiration date: 2015-05-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=gcc47-aux portname: lang/gnatdroid-armv5 description: C/Ada cross-compiler, target: Android ARMv5 maintainer: marino@FreeBSD.org status: IGNORE deprecated because: Nobody cares enough to fix sigtramp-android.c for ARMv5 expiration date: 2015-03-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=gnatdroid-armv5 portname: lang/perl5.16 description: Practical Extraction and Report Language maintainer: perl@FreeBSD.org deprecated because: Unsupported, please upgrade to a more recent version of Perl expiration date: 2015-07-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=perl5.16 portname: lang/php53 description: PHP Scripting Language maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=php53 portname: lang/php53-extensions description: "meta-port" to install PHP extensions maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=php53-extensions portname: lang/pure description: Modern-style functional programming language maintainer: lichray@gmail.com status: BROKEN deprecated because: Old revision of software, depends on deleted version of llvm expiration date: 2015-05-14 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=lang&portname=pure portname: mail/php53-imap description: The imap shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=mail&portname=php53-imap portname: math/php53-bcmath description: The bcmath shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=math&portname=php53-bcmath portname: math/php53-gmp description: The gmp shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=math&portname=php53-gmp portname: misc/kde4-l10n-si description: Sinhalese messages and documentation for KDE SC 4 maintainer: kde@FreeBSD.org status: IGNORE deprecated because: Upstream ceased maintainance of this translation expiration date: 2016-01-01 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=misc&portname=kde4-l10n-si portname: misc/kde4-l10n-tg description: Tajik messages and documentation for KDE SC 4 maintainer: kde@FreeBSD.org status: IGNORE deprecated because: Upstream ceased maintainance of this translation expiration date: 2016-01-01 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=misc&portname=kde4-l10n-tg portname: misc/kde4-l10n-th description: Thai messages and documentation for KDE SC 4 maintainer: kde@FreeBSD.org status: IGNORE deprecated because: Upstream ceased maintainance of this translation expiration date: 2016-01-01 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=misc&portname=kde4-l10n-th portname: misc/php53-calendar description: The calendar shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=misc&portname=php53-calendar portname: net-mgmt/php53-snmp description: The snmp shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net-mgmt&portname=php53-snmp portname: net/php53-ldap description: The ldap shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-ldap portname: net/php53-soap description: The soap shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-soap portname: net/php53-sockets description: The sockets shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-sockets portname: net/php53-xmlrpc description: The xmlrpc shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=net&portname=php53-xmlrpc portname: ports-mgmt/porteasy description: Tool for fetching and building ports maintainer: des@FreeBSD.org deprecated because: Does not support pkgng expiration date: 2015-03-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=ports-mgmt&portname=porteasy portname: print/pecl-ps description: PHP extension for pslib to generate postscript maintainer: alan@fromorbit.com status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=print&portname=pecl-ps portname: security/krb5-111 description: Authentication system developed at MIT, successor to Kerberos IV maintainer: cy@FreeBSD.org deprecated because: EOLed by MIT in December 2014. expiration date: 2015-08-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=krb5-111 portname: security/pecl-crack description: PECL extension to cracklib maintainer: wmoran@collaborativefusion.com status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=pecl-crack portname: security/php53-filter description: The filter shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-filter portname: security/php53-hash description: The hash shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-hash portname: security/php53-mcrypt description: The mcrypt shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-mcrypt portname: security/php53-openssl description: The openssl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=security&portname=php53-openssl portname: sysutils/php53-fileinfo description: The fileinfo shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=php53-fileinfo portname: sysutils/php53-posix description: The posix shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=php53-posix portname: sysutils/puppet27 description: Configuration management framework written in Ruby maintainer: swills@FreeBSD.org status: BROKEN deprecated because: Does not work with Ruby 2.x expiration date: 2015-03-28 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=puppet27 portname: sysutils/syslog-ng33 description: Powerful syslogd replacement maintainer: cy@FreeBSD.org deprecated because: No longer supported by Balabit cince November 2014. expiration date: 2015-08-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=sysutils&portname=syslog-ng33 portname: textproc/php53-ctype description: The ctype shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-ctype portname: textproc/php53-dom description: The dom shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-dom portname: textproc/php53-pspell description: The pspell shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-pspell portname: textproc/php53-simplexml description: The simplexml shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-simplexml portname: textproc/php53-wddx description: The wddx shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-wddx portname: textproc/php53-xml description: The xml shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xml portname: textproc/php53-xmlreader description: The xmlreader shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xmlreader portname: textproc/php53-xmlwriter description: The xmlwriter shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xmlwriter portname: textproc/php53-xsl description: The xsl shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=textproc&portname=php53-xsl portname: www/moodle26 description: Course management system based on social constructionism maintainer: wen@FreeBSD.org deprecated because: Deprecated by upstream, use www/moodle2{7,8} instead expiration date: 2015-04-17 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=moodle26 portname: www/p5-Google-Code-Upload description: Uploading files to a Google Code project maintainer: sunpoet@FreeBSD.org deprecated because: Google Code will be shutting down (http://google-opensource.blogspot.tw/2015/03/farewell-to-google-code.html) expiration date: 2015-04-30 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=p5-Google-Code-Upload portname: www/pecl-amfext description: Implements encoding and decoding of AMF and AMF3 messages maintainer: meritus@innervision.pl status: IGNORE deprecated because: requires php53, security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=pecl-amfext portname: www/php53-session description: The session shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=php53-session portname: www/php53-tidy description: The tidy shared extension for php maintainer: ports@FreeBSD.org deprecated because: security EOL reached 14 Aug 2014 expiration date: 2015-04-15 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=php53-tidy portname: www/rubygem-form_data description: Build form data request bodies maintainer: sunpoet@FreeBSD.org deprecated because: Use www/rubygem-http-form_data instead (renamed by upstream) expiration date: 2015-03-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=rubygem-form_data portname: www/trac-batchmodify description: Enables users to modify several tickets together at once maintainer: ports@FreeBSD.org deprecated because: This functionality was merged into Trac since version 1.0 expiration date: 2015-04-08 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=trac-batchmodify portname: www/typo345 description: The typo3 content management system maintainer: freebsd-ports@charlieroot.de deprecated because: Upgrade to www/typo3 or www/typo3-lts expiration date: 2015-03-31 build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=www&portname=typo345 From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 08:29:48 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 66A7A7BA for ; Tue, 7 Apr 2015 08:29:48 +0000 (UTC) Received: from portsmon.freebsd.org (portsmon.freebsd.org [IPv6:2001:1900:2254:206a::50:3]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 576B98A6 for ; Tue, 7 Apr 2015 08:29:48 +0000 (UTC) Received: from portsmon.freebsd.org ([127.0.1.104]) by portsmon.freebsd.org (8.14.9/8.14.9) with ESMTP id t378TmGT014121 for ; Tue, 7 Apr 2015 08:29:48 GMT (envelope-from linimon@FreeBSD.org) Date: Tue, 7 Apr 2015 08:29:48 GMT Message-Id: <201504070829.t378TmGT014121@portsmon.freebsd.org> From: linimon@FreeBSD.org To: ports@freebsd.org Reply-To: portmgr-feedback@FreeBSD.org Subject: FreeBSD unmaintained ports which are currently marked forbidden X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 08:29:48 -0000 As part of an ongoing effort to reduce the number of problems in the FreeBSD ports system, we periodically notify users about ports that are marked as "forbidden" in their Makefiles. Often, these ports are so marked due to security concerns, such as known exploits. An overview of each port, including errors seen on the build farm, is included below. portname: devel/cross-binutils forbidden because: Multiple vulnerbilities parsing PE and ihex files build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=cross-binutils portname: devel/mingw64-binutils forbidden because: Multiple vulnerbilities parsing PE and ihex files build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/x86_64-pc-mingw32-binutils-2.23.2_1.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=mingw64-binutils From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 08:29:48 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 7A85D7BB for ; Tue, 7 Apr 2015 08:29:48 +0000 (UTC) Received: from portsmon.freebsd.org (portsmon.freebsd.org [IPv6:2001:1900:2254:206a::50:3]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 6B86A8A7 for ; Tue, 7 Apr 2015 08:29:48 +0000 (UTC) Received: from portsmon.freebsd.org ([127.0.1.104]) by portsmon.freebsd.org (8.14.9/8.14.9) with ESMTP id t378TmHp014142 for ; Tue, 7 Apr 2015 08:29:48 GMT (envelope-from linimon@FreeBSD.org) Date: Tue, 7 Apr 2015 08:29:48 GMT Message-Id: <201504070829.t378TmHp014142@portsmon.freebsd.org> From: linimon@FreeBSD.org To: ports@FreeBSD.org Reply-To: portmgr-feedback@FreeBSD.org Subject: FreeBSD ports which are currently marked forbidden X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 08:29:48 -0000 As part of an ongoing effort to reduce the number of problems in the FreeBSD ports system, we periodically notify users about ports that are marked as "forbidden" in their Makefiles. Often, these ports are so marked due to security concerns, such as known exploits. An overview of each port, including errors seen on the build farm, is included below. portname: devel/cross-binutils forbidden because: Multiple vulnerbilities parsing PE and ihex files build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=cross-binutils portname: devel/mingw64-binutils forbidden because: Multiple vulnerbilities parsing PE and ihex files build errors: http://beefy2.isc.freebsd.org/bulk/head-amd64-default/2015-03-19_00h08m00s/logs/errors/x86_64-pc-mingw32-binutils-2.23.2_1.log overview: http://portsmon.FreeBSD.org/portoverview.py?category=devel&portname=mingw64-binutils portname: x11/nvidia-driver-173 forbidden because: vulnerable to denial of service or arbitrary code execution (CVE-2014-8298) build errors: none. overview: http://portsmon.FreeBSD.org/portoverview.py?category=x11&portname=nvidia-driver-173 From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 09:13:55 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id F1A8D21C for ; Tue, 7 Apr 2015 09:13:54 +0000 (UTC) Received: from mail-ie0-x22a.google.com (mail-ie0-x22a.google.com [IPv6:2607:f8b0:4001:c03::22a]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id B58B1E33 for ; Tue, 7 Apr 2015 09:13:54 +0000 (UTC) Received: by ierf6 with SMTP id f6so41183142ier.2 for ; Tue, 07 Apr 2015 02:13:54 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :content-type; bh=H7GJ7R7Ww52TZ15E99+vvaUcuBSjjRXAF66nti+CAxI=; b=YNPR4A/uEEEKUK9SNSwiEvBdIijZ4rE8v3OH2hRGu2bTrfAAkAvX9yKpAyD7J8NRMj aRwHaCnDeaQRYzgNJmnvQxUGsuXgQTjWuARvq/2OprFH0bLkIyOhSkJ4cNCEPmXXsCPm tR+JoBaRrlt/V8u19txqoNrgsuZrx0RV3u/qUGnuEpC+jUnZ88x1Y7dgCsYoi3JHsCxB rkRzv9XGhQFUMScVOmD/OmKLH/eWt2C5UhJ+03egs+AM6iBkTA69PHqoA4rucxF2Ny2M dSEbomFjg4WYp4y3DLQQqyotn0yee4UMsqf3RpE18D5o8dpPFD7nHk4/sw6cJoqmulmQ sntA== X-Received: by 10.43.6.65 with SMTP id oj1mr23899159icb.75.1428398034165; Tue, 07 Apr 2015 02:13:54 -0700 (PDT) MIME-Version: 1.0 References: <201504070547.t375lmtZ086740@beefy3.isc.freebsd.org> In-Reply-To: From: Ben Woods Date: Tue, 07 Apr 2015 09:13:53 +0000 Message-ID: Subject: Re: [package - head-i386-default][emulators/wine-compholio] Failed for wine-compholio-1.7.40,1 in build To: Gerald Pfeifer , ports@freebsd.org Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 09:13:55 -0000 It looks like this is a bug which has been reported upstream in the wine forums: https://forum.winehq.org/viewtopic.php?t=24430&p=99442 On Tue, 7 Apr 2015 at 1:53 pm Gerald Pfeifer wrote: > On Tue, 7 Apr 2015, pkg-fallout@FreeBSD.org wrote: > > Ident: $FreeBSD: head/emulators/wine-compholio/Makefile 375756 > 2014-12-28 20:39:48Z dbn $ > > Log URL: http://beefy3.isc.freebsd.org/data/head-i386-default/ > p383446_s281156/logs/wine-compholio-1.7.40,1.log > > Build URL: http://beefy3.isc.freebsd.org/ > build.html?mastername=head-i386-default&build=p383446_s281156 > > Log: > > > > ====>> Building emulators/wine-compholio > > build started at Tue Apr 7 04:55:12 UTC 2015 > > port directory: /usr/ports/emulators/wine-compholio > > building for: FreeBSD head-i386-default-job-13 11.0-CURRENT FreeBSD > 11.0-CURRENT #0 r279966: Fri Mar 13 22:02:53 UTC 2015 > peter@build-11.freebsd.org:/usr/obj/usr/src/sys/CLUSTER11 i386 > > maintained by: gerald@FreeBSD.org > > Makefile ident: $FreeBSD: head/emulators/wine-compholio/Makefile > 375756 2014-12-28 20:39:48Z dbn $ > > Poudriere version: 3.1.3 > > Host OSVERSION: 1100064 > > Jail OSVERSION: 1100067 > > > > !!! Jail is newer than host. (Jail: 1100067, Host: 1100064) !!! > > !!! This is not supported. !!! > > !!! Host kernel must be same or newer than jail. !!! > > !!! Expect build failures. !!! > > Apart from me wondering why those test results are shared if > build failures are to be expected.... > > > cc -c -o socket.o socket.c -I. -I../../include -D__WINESRC__ > -DUSE_WS_PREFIX -D_REENTRANT -fPIC -Wall \ > > -pipe -fno-strict-aliasing -Wdeclaration-after-statement -Wempty-body > -Wignored-qualifiers \ > > -Wstrict-prototypes -Wtype-limits -Wvla -Wwrite-strings > -Wpointer-arith -fno-omit-frame-pointer \ > > -I/usr/local/include -O2 -pipe -fstack-protector -fno-strict-aliasing > > socket.c:368:27: error: use of undeclared identifier 'WS_IPX_PTYPE' > > DEBUG_SOCKOPT(WS_IPX_PTYPE); > > ^ > > socket.c:330:32: note: expanded from macro 'DEBUG_SOCKOPT' > > #define DEBUG_SOCKOPT(x) case (x): stropt = #x; break > > ^ > > socket.c:369:27: error: use of undeclared identifier 'WS_IPX_FILTERPTYPE' > > DEBUG_SOCKOPT(WS_IPX_FILTERPTYPE); > > ^ > > socket.c:330:32: note: expanded from macro 'DEBUG_SOCKOPT' > > #define DEBUG_SOCKOPT(x) case (x): stropt = #x; break > > ^ > > socket.c:370:27: error: use of undeclared identifier 'WS_IPX_DSTYPE' > > DEBUG_SOCKOPT(WS_IPX_DSTYPE); > > ^ > > ...does anyone know what is going on in HEAD and what to do about > it? > > Or is this a temporary thing and we should ignore this on the ports > side? > > Gerald > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 09:18:15 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id CFDF443D for ; Tue, 7 Apr 2015 09:18:15 +0000 (UTC) Received: from portscout.freebsd.org (portscout.freebsd.org [IPv6:2001:1900:2254:206a::50:6]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id BB8DBE8C for ; Tue, 7 Apr 2015 09:18:15 +0000 (UTC) Received: from portscout.freebsd.org ([127.0.1.123]) by portscout.freebsd.org (8.14.9/8.14.9) with ESMTP id t379IFXm030870 for ; Tue, 7 Apr 2015 09:18:15 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.freebsd.org (8.14.9/8.14.9/Submit) id t379IFJs030869; Tue, 7 Apr 2015 09:18:15 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <201504070918.t379IFJs030869@portscout.freebsd.org> X-Authentication-Warning: portscout.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain MIME-Version: 1.0 Date: Tue, 7 Apr 2015 09:18:15 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: FreeBSD ports you maintain which are out of date X-Mailer: portscout/0.8.1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 09:18:15 -0000 Dear port maintainer, The portscout new distfile checker has detected that one or more of your ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. If any ports have already been updated, you can safely ignore the entry. You will not be e-mailed again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ irc/ngircd | 22 | 22.1 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Thanks. From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 17:40:59 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 9630D36D; Tue, 7 Apr 2015 17:40:59 +0000 (UTC) Received: from mail-wg0-x229.google.com (mail-wg0-x229.google.com [IPv6:2a00:1450:400c:c00::229]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 3FD57977; Tue, 7 Apr 2015 17:40:59 +0000 (UTC) Received: by wgbdm7 with SMTP id dm7so63884668wgb.1; Tue, 07 Apr 2015 10:40:57 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:date:message-id:subject:from:to:content-type; bh=LHDN23PW/BPN0S5rGg2eUe0MO278bffttOQeC0y4gRQ=; b=RDMNycgxmwsZGlHQnwrGJnZOuVaxpaQdzqttSqUT2kHKaFUzBWe92Bmt/D8rBPxm3b 6Q0c7UlR4n3z0kLNeicP4s8F0Br9nVH18OAqOr3sY/2Soae6ns9XnjkDIIw7OFZUwgll lT9ay3izD9ta3Vtnd4IkhYdi6sqArmKh0SM5ZT+JmUycD4V8ZUJI86ZiYSjNCRKVyqG6 Vsg6nrjlD62eBDp1iuA2S/gB69zA8oQB1/OoXiBByM3HBqcWFeVEte2VKCNDJnaLqYF8 yLKS8dLMG8D12SKAtr++gowy9qdTPHvKBwYtovcsfk3cwllW8urCim4nqTXZYhUHBjA3 8Kww== MIME-Version: 1.0 X-Received: by 10.194.134.234 with SMTP id pn10mr43075124wjb.84.1428428457715; Tue, 07 Apr 2015 10:40:57 -0700 (PDT) Received: by 10.194.76.7 with HTTP; Tue, 7 Apr 2015 10:40:57 -0700 (PDT) Date: Tue, 7 Apr 2015 20:40:57 +0300 Message-ID: Subject: Optional run-dependency fpc-gtk2 (russian/emkatic) From: Andrey Fesenko To: Alonso Cardenas Marquez , freebsd-ports@freebsd.org Content-Type: text/plain; charset=UTF-8 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 17:40:59 -0000 Hello, After https://reviews.freebsd.org/rP376735 port russian/emkatic began to require fpc-gtk2 as RUN_DEPENDS. Although it is actually it is for his work is not needed, and needed only BUILD_DEPENDS. I understand this is a consequence USE_FPC+= gtk2 USE_GNOME= gtk20 It is strictly necessary behavior or accident? since it leads to the setting in general is not required packages for users who do not BUILD this port. From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 18:17:33 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 825A47D6 for ; Tue, 7 Apr 2015 18:17:33 +0000 (UTC) Received: from mail.bein.link (bein.link [37.252.124.82]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 01F22D83 for ; Tue, 7 Apr 2015 18:17:32 +0000 (UTC) Received: from thinkpad.localnet (home.bein.link [172.16.32.6]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (No client certificate requested) by mail.bein.link (Postfix) with ESMTPSA id 70BFC1AF1A1 for ; Tue, 7 Apr 2015 18:17:28 +0000 (UTC) From: Maxim V Filimonov To: freebsd-ports@freebsd.org Reply-To: che@bein.link Subject: lang/lci fails and fails to build on -CURRENT Date: Tue, 07 Apr 2015 21:17:28 +0300 Message-ID: <6350057.ana7Yl94qF@thinkpad> User-Agent: KMail/4.14.3 (FreeBSD/10.1-RELEASE-p6; KDE/4.14.3; amd64; ; ) MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="nextPart1483251.KPsZPIPOM5" Content-Transfer-Encoding: 7Bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 18:17:33 -0000 This is a multi-part message in MIME format. --nextPart1483251.KPsZPIPOM5 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="us-ascii" Dear everyone, I keep receiving the attached mails. In short, it says that > readline/readline.h: not found What can I do to fix that behavior? -- wbr, Maxim Filimonov --nextPart1483251.KPsZPIPOM5 Content-Type: message/rfc822 Content-Disposition: inline; filename="forwarded message" Content-Description: pkg-fallout@FreeBSD.org: [package - head-amd64-default][lang/lci] Failed for lci-0.11.2 in build Return-Path: X-Original-To: che@bein.link Delivered-To: che@bein.link Received: from mx2.freebsd.org (mx2.freebsd.org [8.8.178.116]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by mail.bein.link (Postfix) with ESMTPS id 4DACE1AF193 for ; Tue, 7 Apr 2015 16:30:06 +0000 (UTC) Received: from hub.freebsd.org (hub.freebsd.org [8.8.178.136]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by mx2.freebsd.org (Postfix) with ESMTPS id A93A1389D for ; Tue, 7 Apr 2015 16:30:05 +0000 (UTC) Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id A724DC97 for ; Tue, 7 Apr 2015 16:30:05 +0000 (UTC) Received: from beefy4.isc.freebsd.org (beefy4.isc.freebsd.org [IPv6:2001:4f8:3:ffe0:4072:0:16:3b]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 92616E20; Tue, 7 Apr 2015 16:30:05 +0000 (UTC) Received: from beefy4.isc.freebsd.org (localhost [127.0.0.1]) by beefy4.isc.freebsd.org (8.14.9/8.14.9) with ESMTP id t37GU5Fl099499; Tue, 7 Apr 2015 16:30:05 GMT (envelope-from pkg-fallout@FreeBSD.org) Received: (from root@localhost) by beefy4.isc.freebsd.org (8.14.9/8.14.9/Submit) id t37GU5Qo099174; Tue, 7 Apr 2015 16:30:05 GMT (envelope-from pkg-fallout@FreeBSD.org) Date: Tue, 07 Apr 2015 16:30:05 +0000 From: pkg-fallout@FreeBSD.org Message-ID: <201504071630.t37GU5Qo099174@beefy4.isc.freebsd.org> To: che@bein.link Subject: [package - head-amd64-default][lang/lci] Failed for lci-0.11.2 in build Cc: pkg-fallout@FreeBSD.org X-Spamd-Result: default: False [-6.70 / 100.00] R_SPF_ALLOW(-1.10) RCVD_IN_DNSWL_HI(-5.00) RWL_MAILSPIKE_VERYGOOD(-0.60) X-Spamd-Server: localhost X-Spamd-Scan-Time: 1.40 X-Spamd-Queue-ID: 4DACE1AF193 MIME-Version: 1.0 You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: che@bein.link Last committer: xmj@FreeBSD.org Ident: $FreeBSD: head/lang/lci/Makefile 382295 2015-03-26 09:38:44Z xmj $ Log URL: http://beefy4.isc.freebsd.org/data/head-amd64-default/p383446_s281156/logs/lci-0.11.2.log Build URL: http://beefy4.isc.freebsd.org/build.html?mastername=head-amd64-default&build=p383446_s281156 Log: ====>> Building lang/lci build started at Tue Apr 7 16:29:53 UTC 2015 port directory: /usr/ports/lang/lci building for: FreeBSD head-amd64-default-job-19 11.0-CURRENT FreeBSD 11.0-CURRENT #0 r279966: Fri Mar 13 22:02:53 UTC 2015 peter@build-11.freebsd.org:/usr/obj/usr/src/sys/CLUSTER11 amd64 maintained by: che@bein.link Makefile ident: $FreeBSD: head/lang/lci/Makefile 382295 2015-03-26 09:38:44Z xmj $ Poudriere version: 3.1.3 Host OSVERSION: 1100064 Jail OSVERSION: 1100067 !!! Jail is newer than host. (Jail: 1100067, Host: 1100064) !!! !!! This is not supported. !!! !!! Host kernel must be same or newer than jail. !!! !!! Expect build failures. !!! ---Begin Environment--- BLOCKSIZE=K MAIL=/var/mail/root STATUS=1 SAVED_TERM=screen MASTERMNT=/usr/local/poudriere/data/.m/head-amd64-default/ref PATH=/sbin:/bin:/usr/sbin:/usr/bin:/usr/local/sbin:/usr/local/bin:/root/bin POUDRIERE_BUILD_TYPE=bulk PKGNAME=lci-0.11.2 OLDPWD=/ PWD=/usr/local/poudriere/data/.m/head-amd64-default/ref/.p/pool MASTERNAME=head-amd64-default USER=root HOME=/root POUDRIERE_VERSION=3.1.3 LOCALBASE=/usr/local PACKAGE_BUILDING=yes ---End Environment--- ---Begin OPTIONS List--- ---End OPTIONS List--- --CONFIGURE_ARGS-- --End CONFIGURE_ARGS-- --CONFIGURE_ENV-- XDG_DATA_HOME=/wrkdirs/usr/ports/lang/lci/work XDG_CONFIG_HOME=/wrkdirs/usr/ports/lang/lci/work HOME=/wrkdirs/usr/ports/lang/lci/work TMPDIR="/tmp" SHELL=/bin/sh CONFIG_SHELL=/bin/sh --End CONFIGURE_ENV-- --MAKE_ENV-- XDG_DATA_HOME=/wrkdirs/usr/ports/lang/lci/work XDG_CONFIG_HOME=/wrkdirs/usr/ports/lang/lci/work HOME=/wrkdirs/usr/ports/lang/lci/work TMPDIR="/tmp" NO_PIE=yes SHELL=/bin/sh NO_LINT=YES PREFIX=/usr/local LOCALBASE=/usr/local LIBDIR="/usr/lib" CC="cc" CFLAGS="-O2 -pipe -fstack-protector -fno-strict-aliasing" CPP="cpp" CPPFLAGS="-I/usr/local/include" LDFLAGS=" -L/usr/local/lib -fstack-protector" LIBS="" CXX="c++" CXXFLAGS="-O2 -pipe -fstack-protector -fno-strict-aliasing " MANPREFIX="/usr/local" BSD_INSTALL_PROGRAM="install -s -o root -g wheel -m 555" BSD_INSTALL_LIB="install -s -o root -g wheel -m 444" BSD_INSTALL_SCRIPT="install -o root -g wheel -m 555" BSD_INSTALL_DATA="install -o root -g wheel -m 0644" BSD_INSTALL_MAN="install -o root -g wheel -m 444" --End MAKE_ENV-- --PLIST_SUB-- CMAKE_BUILD_TYPE="release" OSREL=11.0 PREFIX=%D LOCALBASE=/usr/local RESETPREFIX=/usr/local PORTDOCS="" PORTEXAMPLES="" LIB32DIR=lib DOCSDIR="share/doc/lci" EXAMPLESDIR="share/examples/lci" DATADIR="share/lci" WWWDIR="www/lci" ETCDIR="etc/lci" --End PLIST_SUB-- --SUB_LIST-- PREFIX=/usr/local LOCALBASE=/usr/local DATADIR=/usr/local/share/lci DOCSDIR=/usr/local/share/doc/lci EXAMPLESDIR=/usr/local/share/examples/lci WWWDIR=/usr/local/www/lci ETCDIR=/usr/local/etc/lci --End SUB_LIST-- ---Begin make.conf--- USE_PACKAGE_DEPENDS=yes BATCH=yes WRKDIRPREFIX=/wrkdirs USE_PACKAGE_DEPENDS=yes BATCH=yes WRKDIRPREFIX=/wrkdirs PORTSDIR=/usr/ports PACKAGES=/packages DISTDIR=/distfiles #### /usr/local/etc/poudriere.d/make.conf #### MASTER_SITE_FREEBSD=yes DISABLE_MAKE_JOBS=poudriere ---End make.conf--- =================================================== ===> License GPLv3 accepted by the user =========================================================================== =================================================== ===> lci-0.11.2 depends on file: /usr/local/sbin/pkg - not found ===> Verifying install for /usr/local/sbin/pkg in /usr/ports/ports-mgmt/pkg ===> Installing existing package /packages/All/pkg-1.4.12.txz [head-amd64-default-job-19] Installing pkg-1.4.12... [head-amd64-default-job-19] Extracting pkg-1.4.12... done Message for pkg-1.4.12: If you are upgrading from the old package format, first run: # pkg2ng ===> Returning to build of lci-0.11.2 =========================================================================== =================================================== =========================================================================== =================================================== ===> License GPLv3 accepted by the user ===> Fetching all distfiles required by lci-0.11.2 for building =========================================================================== =================================================== ===> License GPLv3 accepted by the user ===> Fetching all distfiles required by lci-0.11.2 for building => SHA256 Checksum OK for justinmeza-lci-0.11.2-v0.11.2_GH0.tar.gz. =========================================================================== =================================================== =========================================================================== =================================================== ===> License GPLv3 accepted by the user ===> Fetching all distfiles required by lci-0.11.2 for building ===> Extracting for lci-0.11.2 => SHA256 Checksum OK for justinmeza-lci-0.11.2-v0.11.2_GH0.tar.gz. =========================================================================== =================================================== =========================================================================== =================================================== ===> Patching for lci-0.11.2 =========================================================================== =================================================== ===> lci-0.11.2 depends on file: /usr/local/bin/cmake - not found ===> Verifying install for /usr/local/bin/cmake in /usr/ports/devel/cmake ===> Installing existing package /packages/All/cmake-3.1.3.txz [head-amd64-default-job-19] Installing cmake-3.1.3... [head-amd64-default-job-19] `-- Installing cmake-modules-3.1.3... [head-amd64-default-job-19] `-- Extracting cmake-modules-3.1.3... done [head-amd64-default-job-19] `-- Installing curl-7.41.0... [head-amd64-default-job-19] | `-- Installing ca_root_nss-3.18... [head-amd64-default-job-19] | `-- Extracting ca_root_nss-3.18... done [head-amd64-default-job-19] `-- Extracting curl-7.41.0... done [head-amd64-default-job-19] `-- Installing expat-2.1.0_2... [head-amd64-default-job-19] `-- Extracting expat-2.1.0_2... done [head-amd64-default-job-19] Extracting cmake-3.1.3... done Message for ca_root_nss-3.18: ********************************* WARNING ********************************* FreeBSD does not, and can not warrant that the certificate authorities whose certificates are included in this package have in any way been audited for trustworthiness or RFC 3647 compliance. Assessment and verification of trust is the complete responsibility of the system administrator. *********************************** NOTE ********************************** This package installs symlinks to support root certificates discovery by default for software that uses OpenSSL. This enables SSL Certificate Verification by client software without manual intervention. If you prefer to do this manually, replace the following symlinks with either an empty file or your site-local certificate bundle. * /etc/ssl/cert.pem * /usr/local/etc/ssl/cert.pem * /usr/local/openssl/cert.pem *************************************************************************** ===> Returning to build of lci-0.11.2 =========================================================================== =================================================== ===> lci-0.11.2 depends on shared library: libreadline.so.6 - not found ===> Verifying for libreadline.so.6 in /usr/ports/devel/readline ===> Installing existing package /packages/All/readline-6.3.8.txz [head-amd64-default-job-19] Installing readline-6.3.8... [head-amd64-default-job-19] `-- Installing indexinfo-0.2.3... [head-amd64-default-job-19] `-- Extracting indexinfo-0.2.3... done [head-amd64-default-job-19] Extracting readline-6.3.8... done ===> Returning to build of lci-0.11.2 =========================================================================== =================================================== ===> Configuring for lci-0.11.2 ===> Performing in-source build /bin/mkdir -p /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 -- The C compiler identification is Clang 3.6.0 -- The CXX compiler identification is Clang 3.6.0 -- Check for working C compiler: /usr/bin/cc -- Check for working C compiler: /usr/bin/cc -- works -- Detecting C compiler ABI info -- Detecting C compiler ABI info - done -- Detecting C compile features -- Detecting C compile features - done -- Check for working CXX compiler: /usr/bin/c++ -- Check for working CXX compiler: /usr/bin/c++ -- works -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Detecting CXX compile features -- Detecting CXX compile features - done -- Could NOT find Doxygen (missing: DOXYGEN_EXECUTABLE) CMake Warning at CMakeLists.txt:63 (message): Couldn't find doxygen. You won't be able to generate documentation now -- Configuring done -- Generating done CMake Warning: Manually-specified variables were not used by the project: CMAKE_CXX_FLAGS_DEBUG CMAKE_CXX_FLAGS_RELEASE CMAKE_C_FLAGS_DEBUG CMAKE_MODULE_LINKER_FLAGS CMAKE_SHARED_LINKER_FLAGS THREADS_HAVE_PTHREAD_ARG -- Build files have been written to: /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 =========================================================================== =================================================== ===> Building for lci-0.11.2 /usr/local/bin/cmake -H/wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 -B/wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 --check-build-system CMakeFiles/Makefile.cmake 0 /usr/local/bin/cmake -E cmake_progress_start /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles/progress.marks /usr/bin/make -f CMakeFiles/Makefile2 all /usr/bin/make -f CMakeFiles/lci.dir/build.make CMakeFiles/lci.dir/depend cd /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 && /usr/local/bin/cmake -E cmake_depends "Unix Makefiles" /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles/lci.dir/DependInfo.cmake Scanning dependencies of target lci /usr/bin/make -f CMakeFiles/lci.dir/build.make CMakeFiles/lci.dir/build /usr/local/bin/cmake -E cmake_progress_report /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles 1 [ 11%] Building C object CMakeFiles/lci.dir/interpreter.c.o /usr/bin/cc -O2 -pipe -fstack-protector -fno-strict-aliasing -O2 -pipe -fstack-protector -fno-strict-aliasing -o CMakeFiles/lci.dir/interpreter.c.o -c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/interpreter.c /usr/local/bin/cmake -E cmake_progress_report /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles 2 [ 22%] Building C object CMakeFiles/lci.dir/lexer.c.o /usr/bin/cc -O2 -pipe -fstack-protector -fno-strict-aliasing -O2 -pipe -fstack-protector -fno-strict-aliasing -o CMakeFiles/lci.dir/lexer.c.o -c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/lexer.c /usr/local/bin/cmake -E cmake_progress_report /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles 3 [ 33%] Building C object CMakeFiles/lci.dir/main.c.o /usr/bin/cc -O2 -pipe -fstack-protector -fno-strict-aliasing -O2 -pipe -fstack-protector -fno-strict-aliasing -o CMakeFiles/lci.dir/main.c.o -c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/main.c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/main.c:112:10: fatal error: 'readline/readline.h' file not found #include ^ 1 error generated. *** Error code 1 Stop. make[3]: stopped in /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 *** Error code 1 Stop. make[2]: stopped in /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 *** Error code 1 Stop. make[1]: stopped in /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 *** Error code 1 Stop. make: stopped in /usr/ports/lang/lci --nextPart1483251.KPsZPIPOM5 Content-Type: message/rfc822 Content-Disposition: inline; filename="forwarded message" Content-Description: pkg-fallout@FreeBSD.org: [package - head-i386-default][lang/lci] Failed for lci-0.11.2 in build Return-Path: X-Original-To: che@bein.link Delivered-To: che@bein.link Received: from mx2.freebsd.org (mx2.freebsd.org [8.8.178.116]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by mail.bein.link (Postfix) with ESMTPS id F03CB1AF1B4 for ; Tue, 7 Apr 2015 15:35:10 +0000 (UTC) Received: from hub.freebsd.org (hub.freebsd.org [8.8.178.136]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by mx2.freebsd.org (Postfix) with ESMTPS id 7D8594A8C for ; Tue, 7 Apr 2015 15:35:07 +0000 (UTC) Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 61735CA3 for ; Tue, 7 Apr 2015 15:35:07 +0000 (UTC) Received: from beefy3.isc.freebsd.org (beefy3.isc.freebsd.org [IPv6:2001:4f8:3:ffe0:4072:0:16:3a]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4EF5F78A; Tue, 7 Apr 2015 15:35:07 +0000 (UTC) Received: from beefy3.isc.freebsd.org (localhost [127.0.0.1]) by beefy3.isc.freebsd.org (8.14.9/8.14.9) with ESMTP id t37FZ6nA040114; Tue, 7 Apr 2015 15:35:06 GMT (envelope-from pkg-fallout@FreeBSD.org) Received: (from root@localhost) by beefy3.isc.freebsd.org (8.14.9/8.14.9/Submit) id t37FZ6t2039907; Tue, 7 Apr 2015 15:35:06 GMT (envelope-from pkg-fallout@FreeBSD.org) Date: Tue, 07 Apr 2015 15:35:06 +0000 From: pkg-fallout@FreeBSD.org Message-ID: <201504071535.t37FZ6t2039907@beefy3.isc.freebsd.org> To: che@bein.link Subject: [package - head-i386-default][lang/lci] Failed for lci-0.11.2 in build Cc: pkg-fallout@FreeBSD.org X-Spamd-Result: default: False [-6.70 / 100.00] R_SPF_ALLOW(-1.10) RCVD_IN_DNSWL_HI(-5.00) RWL_MAILSPIKE_VERYGOOD(-0.60) X-Spamd-Server: localhost X-Spamd-Scan-Time: 0.48 X-Spamd-Queue-ID: F03CB1AF1B4 MIME-Version: 1.0 You are receiving this mail as a port that you maintain is failing to build on the FreeBSD package build server. Please investigate the failure and submit a PR to fix build. Maintainer: che@bein.link Last committer: xmj@FreeBSD.org Ident: $FreeBSD: head/lang/lci/Makefile 382295 2015-03-26 09:38:44Z xmj $ Log URL: http://beefy3.isc.freebsd.org/data/head-i386-default/p383446_s281156/logs/lci-0.11.2.log Build URL: http://beefy3.isc.freebsd.org/build.html?mastername=head-i386-default&build=p383446_s281156 Log: ====>> Building lang/lci build started at Tue Apr 7 15:34:55 UTC 2015 port directory: /usr/ports/lang/lci building for: FreeBSD head-i386-default-job-11 11.0-CURRENT FreeBSD 11.0-CURRENT #0 r279966: Fri Mar 13 22:02:53 UTC 2015 peter@build-11.freebsd.org:/usr/obj/usr/src/sys/CLUSTER11 i386 maintained by: che@bein.link Makefile ident: $FreeBSD: head/lang/lci/Makefile 382295 2015-03-26 09:38:44Z xmj $ Poudriere version: 3.1.3 Host OSVERSION: 1100064 Jail OSVERSION: 1100067 !!! Jail is newer than host. (Jail: 1100067, Host: 1100064) !!! !!! This is not supported. !!! !!! Host kernel must be same or newer than jail. !!! !!! Expect build failures. !!! ---Begin Environment--- BLOCKSIZE=K MAIL=/var/mail/root STATUS=1 SAVED_TERM=screen MASTERMNT=/usr/local/poudriere/data/.m/head-i386-default/ref PATH=/sbin:/bin:/usr/sbin:/usr/bin:/usr/local/sbin:/usr/local/bin:/root/bin POUDRIERE_BUILD_TYPE=bulk PKGNAME=lci-0.11.2 OLDPWD=/ PWD=/usr/local/poudriere/data/.m/head-i386-default/ref/.p/pool MASTERNAME=head-i386-default USER=root HOME=/root POUDRIERE_VERSION=3.1.3 LOCALBASE=/usr/local PACKAGE_BUILDING=yes ---End Environment--- ---Begin OPTIONS List--- ---End OPTIONS List--- --CONFIGURE_ARGS-- --End CONFIGURE_ARGS-- --CONFIGURE_ENV-- XDG_DATA_HOME=/wrkdirs/usr/ports/lang/lci/work XDG_CONFIG_HOME=/wrkdirs/usr/ports/lang/lci/work HOME=/wrkdirs/usr/ports/lang/lci/work TMPDIR="/tmp" SHELL=/bin/sh CONFIG_SHELL=/bin/sh --End CONFIGURE_ENV-- --MAKE_ENV-- XDG_DATA_HOME=/wrkdirs/usr/ports/lang/lci/work XDG_CONFIG_HOME=/wrkdirs/usr/ports/lang/lci/work HOME=/wrkdirs/usr/ports/lang/lci/work TMPDIR="/tmp" NO_PIE=yes SHELL=/bin/sh NO_LINT=YES PREFIX=/usr/local LOCALBASE=/usr/local LIBDIR="/usr/lib" CC="cc" CFLAGS="-O2 -pipe -fstack-protector -fno-strict-aliasing" CPP="cpp" CPPFLAGS="-I/usr/local/include" LDFLAGS=" -L/usr/local/lib -fstack-protector" LIBS="" CXX="c++" CXXFLAGS="-O2 -pipe -fstack-protector -fno-strict-aliasing " MANPREFIX="/usr/local" BSD_INSTALL_PROGRAM="install -s -o root -g wheel -m 555" BSD_INSTALL_LIB="install -s -o root -g wheel -m 444" BSD_INSTALL_SCRIPT="install -o root -g wheel -m 555" BSD_INSTALL_DATA="install -o root -g wheel -m 0644" BSD_INSTALL_MAN="install -o root -g wheel -m 444" --End MAKE_ENV-- --PLIST_SUB-- CMAKE_BUILD_TYPE="release" OSREL=11.0 PREFIX=%D LOCALBASE=/usr/local RESETPREFIX=/usr/local PORTDOCS="" PORTEXAMPLES="" LIB32DIR=lib DOCSDIR="share/doc/lci" EXAMPLESDIR="share/examples/lci" DATADIR="share/lci" WWWDIR="www/lci" ETCDIR="etc/lci" --End PLIST_SUB-- --SUB_LIST-- PREFIX=/usr/local LOCALBASE=/usr/local DATADIR=/usr/local/share/lci DOCSDIR=/usr/local/share/doc/lci EXAMPLESDIR=/usr/local/share/examples/lci WWWDIR=/usr/local/www/lci ETCDIR=/usr/local/etc/lci --End SUB_LIST-- ---Begin make.conf--- ARCH=i386 MACHINE=i386 MACHINE_ARCH=i386 USE_PACKAGE_DEPENDS=yes BATCH=yes WRKDIRPREFIX=/wrkdirs PORTSDIR=/usr/ports PACKAGES=/packages DISTDIR=/distfiles #### /usr/local/etc/poudriere.d/make.conf #### MASTER_SITE_FREEBSD=yes DISABLE_MAKE_JOBS=poudriere ---End make.conf--- =================================================== ===> License GPLv3 accepted by the user =========================================================================== =================================================== ===> lci-0.11.2 depends on file: /usr/local/sbin/pkg - not found ===> Verifying install for /usr/local/sbin/pkg in /usr/ports/ports-mgmt/pkg ===> Installing existing package /packages/All/pkg-1.4.12.txz [head-i386-default-job-11] Installing pkg-1.4.12... [head-i386-default-job-11] Extracting pkg-1.4.12... done Message for pkg-1.4.12: If you are upgrading from the old package format, first run: # pkg2ng ===> Returning to build of lci-0.11.2 =========================================================================== =================================================== =========================================================================== =================================================== ===> License GPLv3 accepted by the user ===> Fetching all distfiles required by lci-0.11.2 for building =========================================================================== =================================================== ===> License GPLv3 accepted by the user ===> Fetching all distfiles required by lci-0.11.2 for building => SHA256 Checksum OK for justinmeza-lci-0.11.2-v0.11.2_GH0.tar.gz. =========================================================================== =================================================== =========================================================================== =================================================== ===> License GPLv3 accepted by the user ===> Fetching all distfiles required by lci-0.11.2 for building ===> Extracting for lci-0.11.2 => SHA256 Checksum OK for justinmeza-lci-0.11.2-v0.11.2_GH0.tar.gz. =========================================================================== =================================================== =========================================================================== =================================================== ===> Patching for lci-0.11.2 =========================================================================== =================================================== ===> lci-0.11.2 depends on file: /usr/local/bin/cmake - not found ===> Verifying install for /usr/local/bin/cmake in /usr/ports/devel/cmake ===> Installing existing package /packages/All/cmake-3.1.3.txz [head-i386-default-job-11] Installing cmake-3.1.3... [head-i386-default-job-11] `-- Installing cmake-modules-3.1.3... [head-i386-default-job-11] `-- Extracting cmake-modules-3.1.3... done [head-i386-default-job-11] `-- Installing curl-7.41.0... [head-i386-default-job-11] | `-- Installing ca_root_nss-3.18... [head-i386-default-job-11] | `-- Extracting ca_root_nss-3.18... done [head-i386-default-job-11] `-- Extracting curl-7.41.0... done [head-i386-default-job-11] `-- Installing expat-2.1.0_2... [head-i386-default-job-11] `-- Extracting expat-2.1.0_2... done [head-i386-default-job-11] Extracting cmake-3.1.3... done Message for ca_root_nss-3.18: ********************************* WARNING ********************************* FreeBSD does not, and can not warrant that the certificate authorities whose certificates are included in this package have in any way been audited for trustworthiness or RFC 3647 compliance. Assessment and verification of trust is the complete responsibility of the system administrator. *********************************** NOTE ********************************** This package installs symlinks to support root certificates discovery by default for software that uses OpenSSL. This enables SSL Certificate Verification by client software without manual intervention. If you prefer to do this manually, replace the following symlinks with either an empty file or your site-local certificate bundle. * /etc/ssl/cert.pem * /usr/local/etc/ssl/cert.pem * /usr/local/openssl/cert.pem *************************************************************************** ===> Returning to build of lci-0.11.2 =========================================================================== =================================================== ===> lci-0.11.2 depends on shared library: libreadline.so.6 - not found ===> Verifying for libreadline.so.6 in /usr/ports/devel/readline ===> Installing existing package /packages/All/readline-6.3.8.txz [head-i386-default-job-11] Installing readline-6.3.8... [head-i386-default-job-11] `-- Installing indexinfo-0.2.3... [head-i386-default-job-11] `-- Extracting indexinfo-0.2.3... done [head-i386-default-job-11] Extracting readline-6.3.8... done ===> Returning to build of lci-0.11.2 =========================================================================== =================================================== ===> Configuring for lci-0.11.2 ===> Performing in-source build /bin/mkdir -p /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 -- The C compiler identification is Clang 3.6.0 -- The CXX compiler identification is Clang 3.6.0 -- Check for working C compiler: /usr/bin/cc -- Check for working C compiler: /usr/bin/cc -- works -- Detecting C compiler ABI info -- Detecting C compiler ABI info - done -- Detecting C compile features -- Detecting C compile features - done -- Check for working CXX compiler: /usr/bin/c++ -- Check for working CXX compiler: /usr/bin/c++ -- works -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Detecting CXX compile features -- Detecting CXX compile features - done -- Could NOT find Doxygen (missing: DOXYGEN_EXECUTABLE) CMake Warning at CMakeLists.txt:63 (message): Couldn't find doxygen. You won't be able to generate documentation now -- Configuring done -- Generating done CMake Warning: Manually-specified variables were not used by the project: CMAKE_CXX_FLAGS_DEBUG CMAKE_CXX_FLAGS_RELEASE CMAKE_C_FLAGS_DEBUG CMAKE_MODULE_LINKER_FLAGS CMAKE_SHARED_LINKER_FLAGS THREADS_HAVE_PTHREAD_ARG -- Build files have been written to: /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 =========================================================================== =================================================== ===> Building for lci-0.11.2 /usr/local/bin/cmake -H/wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 -B/wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 --check-build-system CMakeFiles/Makefile.cmake 0 /usr/local/bin/cmake -E cmake_progress_start /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles/progress.marks /usr/bin/make -f CMakeFiles/Makefile2 all /usr/bin/make -f CMakeFiles/lci.dir/build.make CMakeFiles/lci.dir/depend cd /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 && /usr/local/bin/cmake -E cmake_depends "Unix Makefiles" /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles/lci.dir/DependInfo.cmake Scanning dependencies of target lci /usr/bin/make -f CMakeFiles/lci.dir/build.make CMakeFiles/lci.dir/build /usr/local/bin/cmake -E cmake_progress_report /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles 1 [ 11%] Building C object CMakeFiles/lci.dir/interpreter.c.o /usr/bin/cc -O2 -pipe -fstack-protector -fno-strict-aliasing -O2 -pipe -fstack-protector -fno-strict-aliasing -o CMakeFiles/lci.dir/interpreter.c.o -c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/interpreter.c /usr/local/bin/cmake -E cmake_progress_report /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles 2 [ 22%] Building C object CMakeFiles/lci.dir/lexer.c.o /usr/bin/cc -O2 -pipe -fstack-protector -fno-strict-aliasing -O2 -pipe -fstack-protector -fno-strict-aliasing -o CMakeFiles/lci.dir/lexer.c.o -c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/lexer.c /usr/local/bin/cmake -E cmake_progress_report /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/CMakeFiles 3 [ 33%] Building C object CMakeFiles/lci.dir/main.c.o /usr/bin/cc -O2 -pipe -fstack-protector -fno-strict-aliasing -O2 -pipe -fstack-protector -fno-strict-aliasing -o CMakeFiles/lci.dir/main.c.o -c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/main.c /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2/main.c:112:10: fatal error: 'readline/readline.h' file not found #include ^ 1 error generated. *** Error code 1 Stop. make[3]: stopped in /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 *** Error code 1 Stop. make[2]: stopped in /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 *** Error code 1 Stop. make[1]: stopped in /wrkdirs/usr/ports/lang/lci/work/lci-0.11.2 *** Error code 1 Stop. make: stopped in /usr/ports/lang/lci --nextPart1483251.KPsZPIPOM5-- From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 18:37:25 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 61954BF3 for ; Tue, 7 Apr 2015 18:37:25 +0000 (UTC) Received: from ainaz.pair.com (ainaz.pair.com [209.68.2.66]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 3C4B0F6D for ; Tue, 7 Apr 2015 18:37:24 +0000 (UTC) Received: from [192.168.0.133] (vie-91-186-144-236.dsl.sil.at [91.186.144.236]) by ainaz.pair.com (Postfix) with ESMTPSA id 831BC3F423; Tue, 7 Apr 2015 14:37:21 -0400 (EDT) Date: Tue, 7 Apr 2015 20:37:17 +0200 (CEST) From: Gerald Pfeifer To: Ben Woods Subject: Re: [package - head-i386-default][emulators/wine-compholio] Failed for wine-compholio-1.7.40,1 in build In-Reply-To: Message-ID: References: <201504070547.t375lmtZ086740@beefy3.isc.freebsd.org> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Cc: ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 18:37:25 -0000 On Tue, 7 Apr 2015, Ben Woods wrote: > It looks like this is a bug which has been reported upstream in the wine > forums: > https://forum.winehq.org/viewtopic.php?t=24430&p=99442 Interestingly it only happens on FreeBSD head, though; all other version appear fine. Gerald From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 21:03:02 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 89ED1C42 for ; Tue, 7 Apr 2015 21:03:02 +0000 (UTC) Received: from ns55.4gbhost.com (ns55.4gbhost.com [210.1.58.197]) by mx1.freebsd.org (Postfix) with ESMTP id 0DF19A6B for ; Tue, 7 Apr 2015 21:02:58 +0000 (UTC) Received: from WIN-UHUFEIKGSK8 ([127.0.0.1]) by ns55.4gbhost.com with MailEnable ESMTP; Wed, 8 Apr 2015 04:01:43 +0700 Subject: Guaranteed weight loss results To: ports@freebsd.org X-PHP-Originating-Script: 0:test94.php(1505) : eval()'d code Date: Wed, 8 Apr 2015 04:01:43 +0700 From: Jayden Dejesus Message-ID: X-Priority: 3 X-Mailer: PHPMailer 5.2.9 (https://github.com/PHPMailer/PHPMailer/) MIME-Version: 1.0 X-ME-Bayesian: 40.000000 Content-Type: text/plain; charset=us-ascii X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 21:03:02 -0000 Greetings! What makes you gain weight? [ http://urbaniulian.ro/info.php?o=8 ] You need to try this. Best regards. ---VIDEO: Could tech help save the bee? The tech which could help to unlock the secrets of the hive. From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 21:53:23 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 860C7F6A; Tue, 7 Apr 2015 21:53:23 +0000 (UTC) Received: from smtp02.lnh.mail.rcn.net (smtp02.lnh.mail.rcn.net [207.172.157.102]) by mx1.freebsd.org (Postfix) with ESMTP id 3AB2EC4; Tue, 7 Apr 2015 21:53:22 +0000 (UTC) X-Auth-ID: anat Received: from devlanhide.timeinc.net (HELO utka.zajac) ([209.251.200.245]) by smtp02.lnh.mail.rcn.net with ESMTP; 07 Apr 2015 17:53:23 -0400 Message-ID: <552451D1.4020102@aldan.algebra.com> Date: Tue, 07 Apr 2015 17:53:21 -0400 From: "Mikhail T." User-Agent: Mozilla/5.0 (X11; FreeBSD i386; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: Matthew Seaman Subject: Re: databases/mysql-connector-java: Looks broken to me References: <20150401173142.1b36d256@rsbsd.rsb> <551C2260.5050904@freebsd.org> <55226070.1060909@FreeBSD.org> <55228EFF.6090904@aldan.algebra.com> <5522E5CF.3090902@FreeBSD.org> <5522F796.10709@aldan.algebra.com> <55237C20.7060406@FreeBSD.org> In-Reply-To: <55237C20.7060406@FreeBSD.org> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 21:53:23 -0000 On 07.04.2015 02:41, Matthew Seaman wrote: > So anyone using JDBC3 would be disappointed by our chopping it out. I > have precisely zero idea how many people that might be, or indeed how > much call there is for JDBC3 adaptors in general. If the difference between JDBC3 and 4 is the compiler-version used to compile them, then JDBC3 must only be of interest to those, who still use Java-1.5 for whatever reason. These would not be new FreeBSD installations... Various other packages have stopped supporting JDBC3 long ago . I'd recommend dropping it too. But if you think, we should not drop it, there is still no need for the older JDKs. Any newer javac can be asked to generate older bytecode. For example: javac -source 1.5 -target 1.5 ... Yours, -mi From owner-freebsd-ports@FreeBSD.ORG Tue Apr 7 23:50:31 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 5D7A3C34 for ; Tue, 7 Apr 2015 23:50:31 +0000 (UTC) Received: from mail-vn0-x230.google.com (mail-vn0-x230.google.com [IPv6:2607:f8b0:400c:c0f::230]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 11F2280 for ; Tue, 7 Apr 2015 23:50:31 +0000 (UTC) Received: by vnbg62 with SMTP id g62so11467854vnb.7 for ; Tue, 07 Apr 2015 16:50:30 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:in-reply-to:references:date:message-id:subject:from:to :content-type; bh=wxpfRTkiPUlKzyDNORdUwkZd2p7W5LbyzFHLK9u6C3k=; b=tZRhGNLYJR3lTHLH/MwmYetgJMg2MGBDF+cFwOQy7c++MjTC8N7TqS+Zt7PYev7p1h UTVT6lW9A0C6ICx2oCzJXN5B+NVBtzlavCqEHH0rAKEzKMfXhUaGygpgo2W0kdfs3KDn MvLj/KxCqgX0ukSA1MUjdEVG9r1gNsORCNtGZZHPyr4STOqC4LjRjI8+KPXWt+dDWdgR rUC+RQC4PeF8FUJxR7kQGVp0a3SzTBzfb7nHmo72fBSKdmpb1WJAjPl39P1X+mMGkZ6q bg2+1txER80GFjrHj+eqxPkJpFA73KqeRjFYl+HbTnxDkeZmZ4Tpx+WOlCscSoYUgB8Q nRrA== MIME-Version: 1.0 X-Received: by 10.52.107.7 with SMTP id gy7mr15614292vdb.47.1428450630252; Tue, 07 Apr 2015 16:50:30 -0700 (PDT) Received: by 10.52.255.133 with HTTP; Tue, 7 Apr 2015 16:50:30 -0700 (PDT) Received: by 10.52.255.133 with HTTP; Tue, 7 Apr 2015 16:50:30 -0700 (PDT) In-Reply-To: References: Date: Wed, 8 Apr 2015 01:50:30 +0200 Message-ID: Subject: From: Karin Chale To: ports@freebsd.org Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 07 Apr 2015 23:50:31 -0000 http://www.get-a- http://www.wecuddle.de/images/wecuddle_images_new/ http://www.wecuddle.de/images/wecuddle_images_new/text/free_teaser_landing.png /free_teaser_landing.png -tonight.com http://www.wecuddle.de/images/wecuddle_images_new/text/free_teaser_landing.png /lp/adsi/de/web/justd_19120/files/images/ Karin Chale From owner-freebsd-ports@FreeBSD.ORG Wed Apr 8 09:55:53 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 75D4B52F for ; Wed, 8 Apr 2015 09:55:53 +0000 (UTC) Received: from portscout.freebsd.org (portscout.freebsd.org [IPv6:2001:1900:2254:206a::50:6]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 61FC6BF9 for ; Wed, 8 Apr 2015 09:55:53 +0000 (UTC) Received: from portscout.freebsd.org ([127.0.1.123]) by portscout.freebsd.org (8.14.9/8.14.9) with ESMTP id t389trFE056293 for ; Wed, 8 Apr 2015 09:55:53 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.freebsd.org (8.14.9/8.14.9/Submit) id t389trMO056292; Wed, 8 Apr 2015 09:55:53 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <201504080955.t389trMO056292@portscout.freebsd.org> X-Authentication-Warning: portscout.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain MIME-Version: 1.0 Date: Wed, 8 Apr 2015 09:55:53 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: FreeBSD ports you maintain which are out of date X-Mailer: portscout/0.8.1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 08 Apr 2015 09:55:53 -0000 Dear port maintainer, The portscout new distfile checker has detected that one or more of your ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. If any ports have already been updated, you can safely ignore the entry. You will not be e-mailed again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ textproc/py-jaxml | 3.02 | 20.01 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Thanks. From owner-freebsd-ports@FreeBSD.ORG Wed Apr 8 12:28:06 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 02B19587 for ; Wed, 8 Apr 2015 12:28:06 +0000 (UTC) Received: from mx02.posteo.de (mx02.posteo.de [89.146.194.165]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id B93F9EB3 for ; Wed, 8 Apr 2015 12:28:05 +0000 (UTC) Received: from dovecot03.posteo.de (unknown [185.67.36.28]) by mx02.posteo.de (Postfix) with ESMTPS id D077625A3DCF for ; Wed, 8 Apr 2015 14:27:55 +0200 (CEST) Received: from mail.posteo.de (localhost [127.0.0.1]) by dovecot03.posteo.de (Postfix) with ESMTPSA id 3lMPyM3vVVz5vNC for ; Wed, 8 Apr 2015 14:27:55 +0200 (CEST) Date: Wed, 8 Apr 2015 14:26:05 +0200 From: Marco =?UTF-8?B?QnLDtmRlcg==?= To: freebsd-ports@freebsd.org Subject: [@ ports committers] Security update for devel/dulwich (Bugzilla 199162) Message-ID: <20150408142605.1ea9496c@localhost> Reply-To: marco.broeder@posteo.eu MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; boundary="Sig_/um5IIWG2DPwmo13+VlqSVY5"; protocol="application/pgp-signature" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 08 Apr 2015 12:28:06 -0000 --Sig_/um5IIWG2DPwmo13+VlqSVY5 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hi, could someone take it, please? It is a security update. https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D199162 I am uncertain about the vuxml entry correctness. Thanks! --=20 Regards, Marco --Sig_/um5IIWG2DPwmo13+VlqSVY5 Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQIcBAEBCgAGBQJVJR5fAAoJEEjQ6Txo1AoU8UIP/1JY0wQcrL+EZU1Il590NlvO z+dB/zeuXEoJgvik6Cv+DCgymbLxLiaviHC8Jj38+1PLBq8LU1imz+zWOYurSIRr G5llGKeHcD2gOGTAwsrA1SmzhItajEEigXft0H540kxvbCh83DH4mDRXpvBplnUd XjwHB61n4UfB7bE19VCHNqwkxetmPpxvNsfApjqu1YbweoH0fXFa4BzL5V1IZDry LvQvQamfSnPuAk3MekISl2AVqzyMGILPWo7AcECNIOpEufMRR3O8jtSMVMX5QaX9 s5NV2BNeheNKzL5FTinFUF+nbm04hF0iB7YIQVbb+p0l3Yud5bptLOSScAW3k73i 2bwMJJGOSHIEIzV2SOTK1e8Ca/ks7Ra85UvwtqWYPdDRg/Jg8pPwJCqzOpqJYPd7 1WoFgQ90OP9PMziilj4xKe3YoxmN2nDmkzBPlwwEnp8EY09dXn/Q9TPDJvK7MRo0 RyBA1r+hQaBkSDUQaxyreYH7Yllm7CRw3+hx4WN/w3tXqmsHtSNwyo8NSsxfEIaN z7oqfgW4ipVz7ab6iM0WzLs1Rtze1rU3A1be2UYmw6YqbLe76W98tTfzRXqtYNG5 1FhHGt87mNTRda9DM3KgPtYGDufQkfEYCdIJzmBsEkBQZ0xUOOO5ul/9Cmnvgt3g BY7jvka965V+2mEC+aSY =YDRQ -----END PGP SIGNATURE----- --Sig_/um5IIWG2DPwmo13+VlqSVY5-- From owner-freebsd-ports@FreeBSD.ORG Wed Apr 8 16:48:27 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id A0DE484D; Wed, 8 Apr 2015 16:48:27 +0000 (UTC) Received: from mail.xtaz.uk (tao.xtaz.uk [IPv6:2001:8b0:202::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 64890686; Wed, 8 Apr 2015 16:48:27 +0000 (UTC) Received: by mail.xtaz.uk (Postfix, from userid 1001) id 5C859209AF21; Wed, 8 Apr 2015 17:48:25 +0100 (BST) Date: Wed, 8 Apr 2015 17:48:25 +0100 From: Matt Smith To: ports@freebsd.org, stable@freebsd.org Subject: ports/base ntpd rc.d script with WITHOUT_NTP=yes Message-ID: <20150408164825.GB1280@xtaz.uk> Mail-Followup-To: Matt Smith , ports@freebsd.org, stable@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline User-Agent: Mutt/1.5.23 (2014-03-12) X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 08 Apr 2015 16:48:27 -0000 Hi, I just upgraded my server to 10.1-STABLE r281264 and when I ran mergemaster it told me that /etc/rc.d/ntpd was stale and would I like to delete it. It's never done this before. I've figured out it's because I have WITHOUT_NTP=yes in /etc/src.conf. I did this because I use the ports version of ntpd and thus wanted to remove the base installed version so that when I run commands like ntpq it's using my possibly newer port installed version and not the older one. However, the port version doesn't have its own rc script. It usually uses the base version with ntpd_program and ntpd_config set. With this latest change it means I have to have the base version installed again. Is it possible to get the port version to have its own rc script? -- Matt From owner-freebsd-ports@FreeBSD.ORG Wed Apr 8 20:27:22 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 03D21A1D for ; Wed, 8 Apr 2015 20:27:22 +0000 (UTC) Received: from mail-in-16.arcor-online.net (mail-in-16.arcor-online.net [151.189.21.56]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client CN "mx.arcor.de", Issuer "Thawte SSL CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id A8F5D375 for ; Wed, 8 Apr 2015 20:27:20 +0000 (UTC) Received: from mail-in-05-z2.arcor-online.net (mail-in-05-z2.arcor-online.net [151.189.8.17]) by mx.arcor.de (Postfix) with ESMTP id 3lMbvJ6BcnzDyX for ; Wed, 8 Apr 2015 21:55:56 +0200 (CEST) Received: from mail-in-02.arcor-online.net (mail-in-02.arcor-online.net [151.189.21.42]) by mail-in-05-z2.arcor-online.net (Postfix) with ESMTP id D0C1D11AFF8 for ; Wed, 8 Apr 2015 21:55:56 +0200 (CEST) X-Greylist: Passed host: 188.98.153.28 X-DKIM: Sendmail DKIM Filter v2.8.2 mail-in-02.arcor-online.net 3lMbvJ4jDWz1T0C Received: from lorvorc.mips.inka.de (dslb-188-098-153-028.188.098.pools.vodafone-ip.de [188.98.153.28]) by mail-in-02.arcor-online.net (Postfix) with ESMTPS id 3lMbvJ4jDWz1T0C for ; Wed, 8 Apr 2015 21:55:56 +0200 (CEST) Received: from lorvorc.mips.inka.de (localhost [127.0.0.1]) by lorvorc.mips.inka.de (8.14.9/8.14.9) with ESMTP id t38JuB32085549 for ; Wed, 8 Apr 2015 21:56:11 +0200 (CEST) (envelope-from news@lorvorc.mips.inka.de) Received: (from news@localhost) by lorvorc.mips.inka.de (8.14.9/8.14.9/Submit) id t38JuBgB085548 for freebsd-ports@freebsd.org; Wed, 8 Apr 2015 21:56:11 +0200 (CEST) (envelope-from news) To: freebsd-ports@freebsd.org From: Christian Weisgerber Newsgroups: list.freebsd.ports Subject: LibreSSL infects ports, causes problems Date: Wed, 8 Apr 2015 19:56:11 +0000 (UTC) Lines: 36 Message-ID: X-Trace: lorvorc.mips.inka.de 1428522971 85343 ::1 (8 Apr 2015 19:56:11 GMT) X-Complaints-To: usenet@mips.inka.de User-Agent: slrn/1.0.2 (FreeBSD) X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 08 Apr 2015 20:27:22 -0000 It looks like our already complicated situation with base OpenSSL and ports OpenSSL got even messier with the addition of LibreSSL. I recently installed security/libressl for the pending net/openntpd update (*). Now when I try to pkg delete it again, I get this: Installed packages to be REMOVED: libressl-2.1.6 openntpd-5.7p4,2 xorg-server-1.14.7_4,1 git-lite-2.3.5 mutt-1.5.23_8 xf86-video-mach64-6.9.4_5 xf86-video-nv-2.1.20_6 xf86-video-openchrome-0.3.3_5 xf86-video-r128-6.9.2_5 xf86-video-vesa-2.3.3_5 xf86-input-keyboard-1.8.0_7 xf86-input-mouse-1.9.0_6 xf86-video-ati-7.5.0_2 xf86-video-intel-2.21.15_7 xorg-drivers-7.7_3 xorg-7.7_2 Obviously LibreSSL has "infected" various other ports that happened to be recompiled while it was installed on the system. I'm glad that pkg(1) detects this, but the situation is certainly a surprise. Why did I want to remove LibreSSL, you ask? Because lang/python27 also picks it up, fails to build the _ssl module due to a missing RAND_egd(), and finally errors out on install. *) There is an interoperability problem with LibreSSL and ca_root_nss, which causes OpenNTPD's new https constraints feature to fail, which is why I haven't updated the net/openntpd yet. -- Christian "naddy" Weisgerber naddy@mips.inka.de From owner-freebsd-ports@FreeBSD.ORG Wed Apr 8 21:02:14 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 1EB7E442 for ; Wed, 8 Apr 2015 21:02:14 +0000 (UTC) Received: from fs.denninger.net (wsip-70-169-168-7.pn.at.cox.net [70.169.168.7]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "NewFS.denninger.net", Issuer "NewFS.denninger.net" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id BE72699B for ; Wed, 8 Apr 2015 21:02:12 +0000 (UTC) Received: from [192.168.1.40] (localhost [127.0.0.1]) by fs.denninger.net (8.14.9/8.14.8) with ESMTP id t38L25NU024656 for ; Wed, 8 Apr 2015 16:02:05 -0500 (CDT) (envelope-from karl@denninger.net) Received: from [192.168.1.40] (TLS/SSL) [192.168.1.40] by Spamblock-sys (LOCAL/AUTH); Wed Apr 8 16:02:05 2015 Message-ID: <55259726.5030301@denninger.net> Date: Wed, 08 Apr 2015 16:01:26 -0500 From: Karl Denninger User-Agent: Mozilla/5.0 (Windows NT 6.1; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Zarafa? Content-Type: multipart/signed; protocol="application/pkcs7-signature"; micalg=sha1; boundary="------------ms010404010507060304010609" X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 08 Apr 2015 21:02:14 -0000 This is a cryptographically signed message in MIME format. --------------ms010404010507060304010609 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: quoted-printable There is both a "We want this" listing on the WantedPorts Wiki section=20 for wiki.freebsd.org and there is _*also*_ a port listed under the wiki=20 under /Zarafa.... but I can't find the bits in the Ports tree. So..... was this "in process" and then abandoned, is the in-process part = available anywhere, etc..... (The goal is to find some way to provide ExchangeActiveSync style mail=20 and related services on 10.1-STABLE, incidentally, and this appears to=20 be one of the potential paths.) --=20 Karl Denninger karl@denninger.net /The Market Ticker/ --------------ms010404010507060304010609 Content-Type: application/pkcs7-signature; name="smime.p7s" Content-Transfer-Encoding: base64 Content-Disposition: attachment; filename="smime.p7s" Content-Description: S/MIME Cryptographic Signature MIAGCSqGSIb3DQEHAqCAMIACAQExCzAJBgUrDgMCGgUAMIAGCSqGSIb3DQEHAQAAoIIGWTCC BlUwggQ9oAMCAQICARowDQYJKoZIhvcNAQELBQAwgZAxCzAJBgNVBAYTAlVTMRAwDgYDVQQI EwdGbG9yaWRhMRIwEAYDVQQHEwlOaWNldmlsbGUxGTAXBgNVBAoTEEN1ZGEgU3lzdGVtcyBM TEMxHDAaBgNVBAMTE0N1ZGEgU3lzdGVtcyBMTEMgQ0ExIjAgBgkqhkiG9w0BCQEWE0N1ZGEg U3lzdGVtcyBMTEMgQ0EwHhcNMTUwMzI1MTMxMDIwWhcNMjAwMzIzMTMxMDIwWjBTMQswCQYD VQQGEwJVUzEQMA4GA1UECBMHRmxvcmlkYTEZMBcGA1UEChMQQ3VkYSBTeXN0ZW1zIExMQzEX MBUGA1UEAxMOS2FybCBEZW5uaW5nZXIwggIiMA0GCSqGSIb3DQEBAQUAA4ICDwAwggIKAoIC AQCmk+jIznE3HgHbh4JU2s86dKGDs4f3ZdED6vCQx9+LnJl7GgT2aAUAARqNnH5dDuC4w/4h K1qb8sXu3yYWlXLLs+vw3oLnx284o0kSZZs/FQ9W90gVTeZ1iTybscN7iXkaf83g1jueBNby n4v1bJEwX/xe94NW0IwBPluOzzXVIMskaZWhqGLtSaiSo4PYUnYMXPRNG7NAWQ2VAZXJkIM2 AM0B3LfyTyZw+NDNJMMQLZBDqS5vHuS78UODXpyyliSsBgaa04KVRsrcz6S2aYxk9ZjU3yD2 JJ7ezlKnZ4j/pc+16rv5fPfJWZAmG3v3kMiMzoDMS+d6CsSYxyQYHDGt+2If0cGpFv3D7Xr6 jxHouLKtipMQ/pPd+T+lugdEj3JfRu0nIM38j+dQh1N+wdiCEgFo0XuPIWW9g7VGwk8n29KR LAT10QZH9ADYbQqwXeXe9xWXjMAXHm6NTXyxpYyuNAV5zwsT5N4fZRwxKn828XZAKLLyeDGg 2lSBKdnT3osk668Yi5hclZH3UX8JikOWzixQ7T1/lWYGAGbElwFUC3xKRv/TI8E6ZYYYbQVN 3JXLKNIfQ7I9fpqrQeMVe03zXGGsXcE1krA8M4VP1ipoDfGD0/Pt8k2mTLUc4PY9eKZJfVlY WWJ/RHPp+N+MFD1sKirYrDvCHaeWyyLDx2dcIwIDAQABo4H1MIHyMAkGA1UdEwQCMAAwEQYJ YIZIAYb4QgEBBAQDAgWgMAsGA1UdDwQEAwIF4DAsBglghkgBhvhCAQ0EHxYdT3BlblNTTCBH ZW5lcmF0ZWQgQ2VydGlmaWNhdGUwHQYDVR0OBBYEFCMvNiXRuCcqulq6cUWK8SNwo7vhMB8G A1UdIwQYMBaAFCRxm52Fffzd3b2wypKUA6H60201MB0GA1UdEQQWMBSBEmthcmxAZGVubmlu Z2VyLm5ldDA4BglghkgBhvhCAQMEKxYpaHR0cHM6Ly9jdWRhc3lzdGVtcy5uZXQ6MTE0NDMv cmV2b2tlZC5jcmwwDQYJKoZIhvcNAQELBQADggIBAHAUwvyHIJw3LTLqpF4apSzuIm5sBqyH rYg1mk7vPkgPFSrsr3AmmtR2iifN7fgAG6NzrL7SddhTiIMbW7mL32Tuklx9sUXM6iEyuiL/ /TRZ95ob7BtM58x2R6y2p00OKOfUCmjyqWy/pAjUAk7c5m9uLr6rVQUj0lGuvCMZEo1lnG6S +EUZ1Mi2mz9HrZBR2GhNPb5UgNVsX91So+uEF+1pRg1mQO6KvX4E84MOPe++qM76o+NvlEIw IU9tYHjSgjqWrqUQgEesMjahWEblfT+XPvPwy9WtICESMQGdGzVgDBgwoFrFnS2GyKlve0rj LKBs5ZtMrsASnbSvWX5uYy6Fb0Gv/F2neStmAyxL6Kupu4D28QpbtG1nxl3pN3SyQiUfXvVm LC3JvS6r6eQsG8Q/6fxCvUNQg8AjvVSMYTspAm3O0rihPQWX1GTAWS9fIxYlo5Y3NY8SpTXD 7RU5QzbQnK/mMJkuuysQeFAmK58El/7GcUy4zt2akuTBD0YroH2FHjfNUJej0lwHgxkNU3zG quKn+Llw1/u/+cncRiVPVatbqhUtXk2a0Y6OKrcAmFwzXlAi//hzofp3Sd1sWW0SUKQIizl7 xSxyu0cnYbxiBLDn3bmCTYCowUHLm6vBDc+3l6jxOM5fWOdJwq4hakYmrGonoI0pRTG732P9 Jf5/MYIE4zCCBN8CAQEwgZYwgZAxCzAJBgNVBAYTAlVTMRAwDgYDVQQIEwdGbG9yaWRhMRIw EAYDVQQHEwlOaWNldmlsbGUxGTAXBgNVBAoTEEN1ZGEgU3lzdGVtcyBMTEMxHDAaBgNVBAMT E0N1ZGEgU3lzdGVtcyBMTEMgQ0ExIjAgBgkqhkiG9w0BCQEWE0N1ZGEgU3lzdGVtcyBMTEMg Q0ECARowCQYFKw4DAhoFAKCCAiEwGAYJKoZIhvcNAQkDMQsGCSqGSIb3DQEHATAcBgkqhkiG 9w0BCQUxDxcNMTUwNDA4MjEwMTI2WjAjBgkqhkiG9w0BCQQxFgQUDDLJeGk5t8ttCnTfiIsd WbInyy0wbAYJKoZIhvcNAQkPMV8wXTALBglghkgBZQMEASowCwYJYIZIAWUDBAECMAoGCCqG SIb3DQMHMA4GCCqGSIb3DQMCAgIAgDANBggqhkiG9w0DAgIBQDAHBgUrDgMCBzANBggqhkiG 9w0DAgIBKDCBpwYJKwYBBAGCNxAEMYGZMIGWMIGQMQswCQYDVQQGEwJVUzEQMA4GA1UECBMH RmxvcmlkYTESMBAGA1UEBxMJTmljZXZpbGxlMRkwFwYDVQQKExBDdWRhIFN5c3RlbXMgTExD MRwwGgYDVQQDExNDdWRhIFN5c3RlbXMgTExDIENBMSIwIAYJKoZIhvcNAQkBFhNDdWRhIFN5 c3RlbXMgTExDIENBAgEaMIGpBgsqhkiG9w0BCRACCzGBmaCBljCBkDELMAkGA1UEBhMCVVMx EDAOBgNVBAgTB0Zsb3JpZGExEjAQBgNVBAcTCU5pY2V2aWxsZTEZMBcGA1UEChMQQ3VkYSBT eXN0ZW1zIExMQzEcMBoGA1UEAxMTQ3VkYSBTeXN0ZW1zIExMQyBDQTEiMCAGCSqGSIb3DQEJ ARYTQ3VkYSBTeXN0ZW1zIExMQyBDQQIBGjANBgkqhkiG9w0BAQEFAASCAgBYk26rSVZ/TDFw RPCTf0uf+FYAYlNsJd5+JQTaff95f8JKGWdmuThGCiB4AoXWn4dAMlRldLb0S/JBuTbjBnGT 0WcavTdwhZwIWNWKV/5m7nQcKiUsQ46YnX3CYm2Cib8tpeOjyPg65JlMO5z2Uhwqhg0+Rlni eLtSGk7H4lNBvSz3P25tW/SVS2WEzHy13VTQw3tYjUwNpii3YKD49LLuZSBZ0yl+HyVK4ETN 1YJqAvKZao3DEcbcSlcPm4n8SoVEywHDA1DWBcud/PofuCUUh3kydf4ZqMpWoi1X7IhyylTu xQ0x1aJOU3ABFQ1fnBl9pZm1gUh5l7HkLRCjfpQ1FWjwg/f89AccsBz6s7WYfWpEKXSgt2VI O57EfE86K/YZLKvK6sVswqF19e/fct8y1bgxRkYH6wmVIu0ttLtHDypy5jWvoTWaXJY6AwfQ 2R2fBa+zppxddjRLDyCJOlTyaTEX+ESfRMefVtGIry/dDuNPL2PN92uip2YtFbFdG1Zqkyld g2/ZQsThqCrYtrPuqfD0TDibxJPb4/6jcgjU/Zch9drFg9+dWZhe9+kmdUjhwE3yiAVll/gC eQvxcdVpLa4vZXegdFCHhFFtbm+JReVamfi99Zpy2khhRjRr04PaCCpFq6TLJvrmokQazriW kU8GaIzAln5XGY62+NVz8QAAAAAAAA== --------------ms010404010507060304010609-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 02:37:59 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 51E52A69 for ; Thu, 9 Apr 2015 02:37:59 +0000 (UTC) Received: from freefall.freebsd.org (freefall.freebsd.org [IPv6:2001:1900:2254:206c::16:87]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 32EC2F8F for ; Thu, 9 Apr 2015 02:37:59 +0000 (UTC) Received: from freefall.freebsd.org (localhost [127.0.0.1]) by freefall.freebsd.org (8.14.9/8.14.9) with ESMTP id t392bwvQ031049 for ; Thu, 9 Apr 2015 02:37:58 GMT (envelope-from bdrewery@freefall.freebsd.org) Received: (from bdrewery@localhost) by freefall.freebsd.org (8.14.9/8.14.9/Submit) id t392bwFt031047 for freebsd-ports@freebsd.org; Thu, 9 Apr 2015 02:37:58 GMT (envelope-from bdrewery) Received: (qmail 94805 invoked from network); 8 Apr 2015 21:37:56 -0500 Received: from unknown (HELO ?10.10.1.139?) (freebsd@shatow.net@10.10.1.139) by sweb.xzibition.com with ESMTPA; 8 Apr 2015 21:37:56 -0500 Message-ID: <5525E609.70402@FreeBSD.org> Date: Wed, 08 Apr 2015 21:38:01 -0500 From: Bryan Drewery Organization: FreeBSD User-Agent: Mozilla/5.0 (Windows NT 6.3; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: Christian Weisgerber , freebsd-ports@freebsd.org Subject: Re: LibreSSL infects ports, causes problems References: In-Reply-To: OpenPGP: id=F9173CB2C3AAEA7A5C8A1F0935D771BB6E4697CF; url=http://www.shatow.net/bryan/bryan2.asc Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="d63j9GCCJ4dUVUR2LrTPEUsumeT5xKhNo" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 02:37:59 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --d63j9GCCJ4dUVUR2LrTPEUsumeT5xKhNo Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: quoted-printable On 4/8/2015 2:56 PM, Christian Weisgerber wrote: > It looks like our already complicated situation with base OpenSSL > and ports OpenSSL got even messier with the addition of LibreSSL. > I recently installed security/libressl for the pending net/openntpd > update (*). Now when I try to pkg delete it again, I get this: >=20 > Installed packages to be REMOVED: > libressl-2.1.6 > openntpd-5.7p4,2 > xorg-server-1.14.7_4,1 > git-lite-2.3.5 > mutt-1.5.23_8 > xf86-video-mach64-6.9.4_5 > xf86-video-nv-2.1.20_6 > xf86-video-openchrome-0.3.3_5 > xf86-video-r128-6.9.2_5 > xf86-video-vesa-2.3.3_5 > xf86-input-keyboard-1.8.0_7 > xf86-input-mouse-1.9.0_6 > xf86-video-ati-7.5.0_2 > xf86-video-intel-2.21.15_7 > xorg-drivers-7.7_3 > xorg-7.7_2 >=20 > Obviously LibreSSL has "infected" various other ports that happened > to be recompiled while it was installed on the system. I'm glad > that pkg(1) detects this, but the situation is certainly a surprise. > Why did I want to remove LibreSSL, you ask? Because lang/python27 > also picks it up, fails to build the _ssl module due to a missing > RAND_egd(), and finally errors out on install. >=20 >=20 > *) There is an interoperability problem with LibreSSL and ca_root_nss, > which causes OpenNTPD's new https constraints feature to fail, which= > is why I haven't updated the net/openntpd yet. >=20 Are you mixing ports and packages? --=20 Regards, Bryan Drewery --d63j9GCCJ4dUVUR2LrTPEUsumeT5xKhNo Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQEcBAEBAgAGBQJVJeYJAAoJEDXXcbtuRpfPDGgIAJFieug+9OxcXuDw1pXV256L Y69kSf+PAxs3tupGnQrdpIPD/MRUk8thJA1T8swyakOmpiP6OaFzpjodkTEFzrz8 bb/smKgaeQq1dMtGwEbrx2FPZRPE+r6DTTaqiBQrP2DcU0T5JDsq0bDaoILAz22R XOzh5KKbMhepcduZiw5A2QxWOz6cMFR7vEAdCzyP/BaO9g7Kh+LXGaViR9oe/7Fa lUlYYr489AzB2NDBA87ikTKOdm5yYpyhptmR0DSTUs3YRnip07x+AMhwg+d2o8PU 8+bvnaeRKnbOUeckHwubZcWAv/bXcQZXtTQSc+hQ32z1LEX2VFVnrUiKFPq+7CA= =n2RI -----END PGP SIGNATURE----- --d63j9GCCJ4dUVUR2LrTPEUsumeT5xKhNo-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 07:24:47 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id BA4C2671; Thu, 9 Apr 2015 07:24:47 +0000 (UTC) Received: from mail.bemsoft.pl (bemsoft.pl [IPv6:2a02:ee0:2:aaaa::714:c1a5]) by mx1.freebsd.org (Postfix) with ESMTP id 78A2034E; Thu, 9 Apr 2015 07:24:45 +0000 (UTC) Received: from [89.74.130.42] (89-74-130-42.dynamic.chello.pl [89.74.130.42]) by mail.bemsoft.pl (Postfix) with ESMTPSA id 6B8CA51353; Thu, 9 Apr 2015 09:24:38 +0200 (CEST) Authentication-Results: mail.bemsoft.pl; dmarc=fail header.from=bemsoft.pl DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=bemsoft.pl; s=bemsoft; t=1428564279; bh=ILtfWXqkZ82XyDgFmR+oLrybRuarmsQ19Swktn4u2bY=; h=Date:From:To:CC:Subject; b=LNfBo605DC2UY8S06WvohMgQ6YxikEY0rNbxKog1VJ8echsfn2Wgh5ulilRts89uw Uw9DMF6iLLcoWKl+1lPvX/TnIVIZi/SkbYAfTGboK3Sd13TCwzWajPB4rB1ohDfv3r yEz7wJVe8ov6BNPy+F/g0ShzZNc5rADne1a/+bkk= Message-ID: <55262937.2070509@bemsoft.pl> Date: Thu, 09 Apr 2015 09:24:39 +0200 From: Dominik Lisiak User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: kuriyama@FreeBSD.org Subject: FreeBSD Port: phantomjs-1.9.8 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 7bit X-Greylist: Sender succeeded SMTP AUTH, not delayed by milter-greylist-4.4.3 (mail.bemsoft.pl); Thu, 09 Apr 2015 09:24:39 +0200 (CEST) Cc: ports@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 07:24:47 -0000 Hello, I have noticed a problem running phantomjs both from package and port. The error is: /usr/lib/libstdc++.so.6: version GLIBCXX_3.4.11 required by /usr/local/bin/phantomjs not found The cause is different version of libstdc++ used by gcc and by FreeBSD. I solved the problem by using: patchelf --set-rpath /usr/local/lib/gcc48 /usr/local/bin/phantomjs but I don't know how to fix the port. I am using: FreeBSD xxx 10.1-RELEASE-p9 FreeBSD 10.1-RELEASE-p9 #0: Tue Apr 7 01:09:46 UTC 2015 root@amd64-builder.daemonology.net:/usr/obj/usr/src/sys/GENERIC amd64 Regards, Dominik Lisiak From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 09:49:53 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 8DD067A3 for ; Thu, 9 Apr 2015 09:49:53 +0000 (UTC) Received: from smtp.mimar.rs (smtp.mimar.rs [193.53.106.135]) by mx1.freebsd.org (Postfix) with ESMTP id 3D097943 for ; Thu, 9 Apr 2015 09:49:52 +0000 (UTC) Received: from vscan.mimar.rs (vscan.mimar.rs [193.53.106.134]) by smtp.mimar.rs (Postfix) with ESMTP id 6870C898E6 for ; Thu, 9 Apr 2015 11:44:38 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=mimar.rs; h= content-transfer-encoding:content-type:content-type:mime-version :x-mailer:organization:message-id:subject:subject:from:from:date :date:received:received; s=mimar-0901; t=1428572667; x= 1430387068; bh=ZNymJTnE3BU7xnG40ikjhxujrr45CDzgU8zCgFwKqLQ=; b=o XFSHOdSJz0HcUVVOtH7NZLdU8FpPmtmy6KKvyYX+SeMxHx+45ue2SnYDquifxomt VEoGgA9ANMnQCw+GOVCEYUZ+nSsn1D1PSfobNFHvSNojbTva1ZkEUE6DiXjzOs1N qIGP/wNiFRGQUWqkqEnx6xP+2AKy4FMbo3GNwO+5Cg= X-Virus-Scanned: amavisd-new at mimar.rs Received: from smtp.mimar.rs ([193.53.106.135]) by vscan.mimar.rs (vscan.mimar.rs [193.53.106.134]) (amavisd-new, port 10026) with ESMTP id HJlpVGply4XU for ; Thu, 9 Apr 2015 11:44:27 +0200 (CEST) Received: from efreet (unknown [193.53.106.34]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) (Authenticated sender: marko.cupac@mimar.rs) by smtp.mimar.rs (Postfix) with ESMTPSA id 7AE84898E4 for ; Thu, 9 Apr 2015 11:44:27 +0200 (CEST) Date: Thu, 9 Apr 2015 11:44:26 +0200 From: Marko =?UTF-8?B?Q3VwYcSH?= To: freebsd-ports@freebsd.org Subject: is it safe to run net/haproxy as root? Message-ID: <20150409114426.0081485b@efreet> Organization: Mimar X-Mailer: Claws Mail 3.9.3 (GTK+ 2.24.23; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 09:49:53 -0000 Hi, I am setting up haproxy for the first time, and of course my first OS choice is FreeBSD. Most services I am familiar with use their own service accounts which are created when port is installed (squid, ejabberd, mysql, clamav, vscan etc.). But haproxy does not create account, and there is no pkg-message, or any other reference which suggests I should create separate account, and also whether it needs shell, homedir etc. On the other hand, most web 'works for me' howtos mention running it under separate account. So, my question is the one from this mail's subject: Is it safe to run haproxy under root account? If not, what is the best practice regarding its user account's shell and homedir? Is there a recommendation for UID/GID? Thank you in advance, --=20 Marko Cupa=C4=87 https://www.mimar.rs From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 10:04:38 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id C29B0248; Thu, 9 Apr 2015 10:04:38 +0000 (UTC) Received: from mail-pa0-x229.google.com (mail-pa0-x229.google.com [IPv6:2607:f8b0:400e:c03::229]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 8CCD2C42; Thu, 9 Apr 2015 10:04:38 +0000 (UTC) Received: by pacyx8 with SMTP id yx8so144670836pac.1; Thu, 09 Apr 2015 03:04:38 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:reply-to:subject:references:to:cc:from:message-id:date :user-agent:mime-version:in-reply-to:content-type :content-transfer-encoding; bh=Usq6LaxPiuj0grNdGuUhP1tb60xYTOTyYtbVGTZVsus=; b=nBV+aQ8PQeoKjKFLwYUjZjcn6X4mY8rAZhLWDbtnfrvJfkItffAFpnxbCCwjv3DhD1 U95Qi0CoL0T0OSR/ghXO6KR7b72J0+0Q+2cgK04ziio5BVu6552H3ddrQeW/9MmRE9LH vSua6vw84TYc0EjGMS7fxSldHnz7WYWWs1Qm9BXnAsVQEZPBmqUVZysT2uCOTkbCIOti sU4RmpjQWk6CaS67hjEfepfB/fl3Ix/dNnn4yXTpC7PJPorlxtbGGHi5o7f4CGYVL/le WeQVaEldfIDLTpqHo+WwWodFWXzSIkDjBP4PgQI0LUCUMra8i7tljt+sogccbz82Ughv itFg== X-Received: by 10.70.45.16 with SMTP id i16mr23970758pdm.51.1428573878217; Thu, 09 Apr 2015 03:04:38 -0700 (PDT) Received: from [192.168.1.107] (ppp59-167-128-11.static.internode.on.net. [59.167.128.11]) by mx.google.com with ESMTPSA id qv9sm14172220pab.27.2015.04.09.03.04.35 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 03:04:37 -0700 (PDT) Sender: Kubilay Kocak Reply-To: koobs@FreeBSD.org Subject: Re: [@ ports committers] Security update for devel/dulwich (Bugzilla 199162) references: <20150408142605.1ea9496c@localhost> To: marco.broeder@posteo.eu, freebsd-ports@freebsd.org From: Kubilay Kocak message-id: <55264EAD.3040604@FreeBSD.org> Date: Thu, 9 Apr 2015 20:04:29 +1000 user-agent: Mozilla/5.0 (Windows NT 6.1; WOW64; rv:37.0) Gecko/20100101 Thunderbird/37.0 mime-version: 1.0 in-reply-to: <20150408142605.1ea9496c@localhost> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Cc: python@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 10:04:38 -0000 On 8/04/2015 10:26 PM, Marco Bröder wrote: > Hi, > > could someone take it, please? It is a security update. > > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=199162 > > I am uncertain about the vuxml entry correctness. > > Thanks! > Hi Marco, I've triaged the issue and added a few requests for additional QA results and information on how to validate VuXML. If you can take care of those, it should help in progressing it quickly. Thanks! ./koobs From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 10:09:39 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 6F79CA22; Thu, 9 Apr 2015 10:09:39 +0000 (UTC) Received: from mail-pa0-x22d.google.com (mail-pa0-x22d.google.com [IPv6:2607:f8b0:400e:c03::22d]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 39540CA0; Thu, 9 Apr 2015 10:09:39 +0000 (UTC) Received: by pabtp1 with SMTP id tp1so39523796pab.2; Thu, 09 Apr 2015 03:09:39 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:reply-to:subject:references:to:cc:from:message-id:date :user-agent:mime-version:in-reply-to:content-type :content-transfer-encoding; bh=t1HgbRvuDYKV2dX0czov4JVrGiF4gX8Mdjdlkcqf0MU=; b=qSzaqNwvX1lgBQbXZNlYFYlHgkS62OrF5cOhmS8s9ZTo8P0rcdpwLGs8hpswjy8/gM Qj8rGEPsae26r/v5U4qGquGNVBCAXjRtogeIznc33lBWu4ne03xhAczhk+dzbrVVGDW8 HZzd2kDV2pqo+sBFUtt8sNbGVKLYoUddRJ3BXiaaxsuWeDKFNZ0jS8OXlcM3PDAqJi35 F/MhESRmgfqCuLHBMeupb/5d1Ibx7UPBdPtZlOzuVHANb75nNh/q0OSzVwehKXHGyZvO beWECTXfKDwU47gdcMyik3HFFN6lufBJtJVyx89mmXYpjEkSd4k+16uh4dgKKQqOy3sb 0sLQ== X-Received: by 10.70.38.225 with SMTP id j1mr28857871pdk.14.1428574178948; Thu, 09 Apr 2015 03:09:38 -0700 (PDT) Received: from [192.168.1.107] (ppp59-167-128-11.static.internode.on.net. [59.167.128.11]) by mx.google.com with ESMTPSA id q3sm14018244pds.49.2015.04.09.03.09.36 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 03:09:38 -0700 (PDT) Sender: Kubilay Kocak Reply-To: koobs@FreeBSD.org Subject: Re: ports/base ntpd rc.d script with WITHOUT_NTP=yes references: <20150408164825.GB1280@xtaz.uk> To: Matt Smith , ports@freebsd.org, stable@freebsd.org From: Kubilay Kocak message-id: <55264FD9.409@FreeBSD.org> Date: Thu, 9 Apr 2015 20:09:29 +1000 user-agent: Mozilla/5.0 (Windows NT 6.1; WOW64; rv:37.0) Gecko/20100101 Thunderbird/37.0 mime-version: 1.0 in-reply-to: <20150408164825.GB1280@xtaz.uk> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 7bit Cc: Cy Schubert X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 10:09:39 -0000 On 9/04/2015 2:48 AM, Matt Smith wrote: > Hi, > > I just upgraded my server to 10.1-STABLE r281264 and when I ran > mergemaster it told me that /etc/rc.d/ntpd was stale and would I like to > delete it. It's never done this before. I've figured out it's because I > have WITHOUT_NTP=yes in /etc/src.conf. I did this because I use the > ports version of ntpd and thus wanted to remove the base installed > version so that when I run commands like ntpq it's using my possibly > newer port installed version and not the older one. > > However, the port version doesn't have its own rc script. It usually > uses the base version with ntpd_program and ntpd_config set. With this > latest change it means I have to have the base version installed again. > Is it possible to get the port version to have its own rc script? > Hi Matt, It is certainly *possible*, and best addressed with an enhancement request (via Bugzilla) to the NTP port maintainer, who I've CC'd here. I like the idea as it improves user experience, removes a POLA violation, and further decouples ports/pkg from base (which we like) ./koobs From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 10:14:43 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id CF0F11AB for ; Thu, 9 Apr 2015 10:14:43 +0000 (UTC) Received: from portscout.freebsd.org (portscout.freebsd.org [IPv6:2001:1900:2254:206a::50:6]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id BA929D9D for ; Thu, 9 Apr 2015 10:14:43 +0000 (UTC) Received: from portscout.freebsd.org ([127.0.1.123]) by portscout.freebsd.org (8.14.9/8.14.9) with ESMTP id t39AEhuj053020 for ; Thu, 9 Apr 2015 10:14:43 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.freebsd.org (8.14.9/8.14.9/Submit) id t39AEhr3053019; Thu, 9 Apr 2015 10:14:43 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <201504091014.t39AEhr3053019@portscout.freebsd.org> X-Authentication-Warning: portscout.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain MIME-Version: 1.0 Date: Thu, 9 Apr 2015 10:14:43 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: FreeBSD ports you maintain which are out of date X-Mailer: portscout/0.8.1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 10:14:43 -0000 Dear port maintainer, The portscout new distfile checker has detected that one or more of your ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. If any ports have already been updated, you can safely ignore the entry. You will not be e-mailed again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ biology/libsbml | 5.11.0 | 5.11.4 ------------------------------------------------+-----------------+------------ databases/pear-DB_DataObject | 1.11.3 | 1.11.4 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Thanks. From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 11:17:13 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id BD201B26 for ; Thu, 9 Apr 2015 11:17:13 +0000 (UTC) Received: from mwork.nabble.com (mwork.nabble.com [162.253.133.43]) by mx1.freebsd.org (Postfix) with ESMTP id A63EB68A for ; Thu, 9 Apr 2015 11:17:13 +0000 (UTC) Received: from msam.nabble.com (unknown [162.253.133.85]) by mwork.nabble.com (Postfix) with ESMTP id 698801A447AC for ; Thu, 9 Apr 2015 04:17:05 -0700 (PDT) Date: Thu, 9 Apr 2015 04:16:37 -0700 (MST) From: timp To: freebsd-ports@freebsd.org Message-ID: <1428578197193-6003766.post@n5.nabble.com> In-Reply-To: <551AF171.1040208@mail.lifanov.com> References: <551AF171.1040208@mail.lifanov.com> Subject: Re: Galera ports MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 11:17:13 -0000 Excuse me, are there any news? -- View this message in context: http://freebsd.1045724.n5.nabble.com/Galera-ports-tp6001219p6003766.html Sent from the freebsd-ports mailing list archive at Nabble.com. From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 11:20:08 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 4D287CD3 for ; Thu, 9 Apr 2015 11:20:08 +0000 (UTC) Received: from mail15.tpgi.com.au (smtp-out15.tpgi.com.au [220.244.226.125]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.tpg.com.au", Issuer "RapidSSL CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id C910A6A2 for ; Thu, 9 Apr 2015 11:20:06 +0000 (UTC) X-TPG-Junk-Status: Message not scanned X-TPG-Antivirus: Passed X-TPG-Abuse: host=[202.161.115.54]; ip=202.161.115.54; date=Thu, 9 Apr 2015 21:05:42 +1000 Received: from fish.ish.com.au (202-161-115-54.static.tpgi.com.au [202.161.115.54] (may be forged)) by mail15.tpgi.com.au (envelope-from ari@ish.com.au) (8.14.3/8.14.3) with ESMTP id t39B5egg004867 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-SHA bits=256 verify=NO) for ; Thu, 9 Apr 2015 21:05:42 +1000 Received: from ip-211.ish.com.au ([203.29.62.211]:45300 helo=ish.com.au) by fish.ish.com.au with esmtp (Exim 4.82_1-5b7a7c0-XX) (envelope-from ) id 1Yg9vE-0008PZ-0c for freebsd-ports@freebsd.org; Thu, 09 Apr 2015 20:42:56 +1000 Received: from [203.29.62.136] (HELO ip-136.ish.com.au) by ish.com.au (CommuniGate Pro SMTP 6.1.2) with ESMTPS id 18041949 for freebsd-ports@freebsd.org; Thu, 09 Apr 2015 20:42:56 +1000 To: FreeBSD Mailing List Subject: openssl and bash libcrypto From: Aristedes Maniatis message-id: <552657AC.1020802@ish.com.au> Date: Thu, 9 Apr 2015 20:42:52 +1000 user-agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:37.0) Gecko/20100101 Thunderbird/37.0 mime-version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="S96oEGXdmw5OSqareE8EF3psmdHHqoe1C" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 11:20:08 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --S96oEGXdmw5OSqareE8EF3psmdHHqoe1C Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Starting in the last week or so, several different applications are exhib= iting the same symptoms of broken libcrypto libraries. (gdb) core bash.core Core was generated by `bash'. Program terminated with signal 11, Segmentation fault. (gdb) bt #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/libcr= ypto.so.8 #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7= #2 0x00000008032d584e in _init () from /lib/libcrypto.so.7 #3 0x00007fffffffd7c0 in ?? () #4 0x00000008006d66bf in r_debug_state () from /libexec/ld-elf.so.1 #5 0x00000008006dad87 in _rtld_get_stack_prot () from /libexec/ld-elf.so= =2E1 #6 0x00000008006d7ad3 in dlopen () from /libexec/ld-elf.so.1 #7 0x0000000800e5c436 in _nsdbtaddsrc () from /lib/libc.so.7 #8 0x0000000800e563c9 in _nsyyparse () from /lib/libc.so.7 #9 0x0000000800e5cab1 in nsdispatch () from /lib/libc.so.7 #10 0x0000000800e49ebe in getpwuid () from /lib/libc.so.7 #11 0x0000000800e49cbf in getpwnam () from /lib/libc.so.7 Although that symptom is in bash, I've got the exact same symptoms in ast= erisk. The builds are done in poudriere with the make flags: WITH_OPENSSL_PORT=3Dyes I've tried updating to the latest 10.1-RELEASE-p6, although it is possibl= e that that is exactly what caused the problem in the first place when th= e poudriere jail was updated to that release. The function calls mention ia32 but this box is purely 64bit. I've seen recent discussions about the problems that confusion between co= re openssl and ports openssl can cause. But I can't for the life of me fi= gure how to avoid this problem. * Should bash be built with "Build static executables and/or libraries"? * Should I stop trying to use openssl from ports until this is fixed? * Why is /lib/libcrypto.so.7 calling /usr/local/lib/libcrypto.so.8 ? I've tried so many different combinations of settings, I don't know what = to try next. Thanks Ari --=20 --------------------------> Aristedes Maniatis ish http://www.ish.com.au Level 1, 30 Wilson Street Newtown 2042 Australia phone +61 2 9550 5001 fax +61 2 9550 4001 GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A --S96oEGXdmw5OSqareE8EF3psmdHHqoe1C Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- iEYEARECAAYFAlUmV7AACgkQ72p9Lj5JECrOSwCfaaCwlltkO+re2rPJkUhgkDFU v3YAnjA0f+Ypf3AXwvGkJQNgJVnXh8jQ =oKlS -----END PGP SIGNATURE----- --S96oEGXdmw5OSqareE8EF3psmdHHqoe1C-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 11:32:46 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 4C102FED for ; Thu, 9 Apr 2015 11:32:46 +0000 (UTC) Received: from na01-by2-obe.outbound.protection.outlook.com (mail-by2on0115.outbound.protection.outlook.com [207.46.100.115]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "MSIT Machine Auth CA 2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 1F3FB8C9 for ; Thu, 9 Apr 2015 11:32:45 +0000 (UTC) Received: from BY1PR0501MB1621.namprd05.prod.outlook.com (25.160.206.17) by BY1PR0501MB1621.namprd05.prod.outlook.com (25.160.206.17) with Microsoft SMTP Server (TLS) id 15.1.130.23; Thu, 9 Apr 2015 11:17:34 +0000 Received: from BY1PR0501MB1621.namprd05.prod.outlook.com ([25.160.206.17]) by BY1PR0501MB1621.namprd05.prod.outlook.com ([25.160.206.17]) with mapi id 15.01.0130.020; Thu, 9 Apr 2015 11:17:34 +0000 From: Pracheth Javali To: "ports@FreeBSD.org" Subject: FreeBSD Port: valgrind-3.10.0.20150126_1,1 Thread-Topic: FreeBSD Port: valgrind-3.10.0.20150126_1,1 Thread-Index: AdBytN5DQSa6v01WTfm/Rk8NHTVuLA== Date: Thu, 9 Apr 2015 11:17:34 +0000 Message-ID: Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-originating-ip: [116.197.184.13] authentication-results: FreeBSD.org; dkim=none (message not signed) header.d=none; x-microsoft-antispam: UriScan:;BCL:0;PCL:0;RULEID:;SRVR:BY1PR0501MB1621; x-forefront-antispam-report: BMV:1; SFV:NSPM; SFS:(10019020)(6009001)(54356999)(99286002)(102836002)(74316001)(92566002)(122556002)(2656002)(15975445007)(50986999)(2900100001)(62966003)(40100003)(77156002)(450100001)(46102003)(86362001)(19580395003)(76576001)(66066001)(87936001)(229853001)(2351001)(33656002)(107886001)(110136001)(2501003); DIR:OUT; SFP:1102; SCL:1; SRVR:BY1PR0501MB1621; H:BY1PR0501MB1621.namprd05.prod.outlook.com; FPR:; SPF:None; MLV:sfv; LANG:en; x-microsoft-antispam-prvs: x-exchange-antispam-report-test: UriScan:; x-exchange-antispam-report-cfa-test: BCL:0; PCL:0; RULEID:(601004)(5002010)(5005006); SRVR:BY1PR0501MB1621; BCL:0; PCL:0; RULEID:; SRVR:BY1PR0501MB1621; x-forefront-prvs: 0541031FF6 MIME-Version: 1.0 X-OriginatorOrg: juniper.net X-MS-Exchange-CrossTenant-originalarrivaltime: 09 Apr 2015 11:17:34.2382 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: bea78b3c-4cdb-4130-854a-1d193232e5f4 X-MS-Exchange-Transport-CrossTenantHeadersStamped: BY1PR0501MB1621 Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 11:32:46 -0000 Hey, Is there a valgrind port for mips64/freebsd platform? Regards, Pracheth From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 12:02:44 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 4DF0CF48 for ; Thu, 9 Apr 2015 12:02:44 +0000 (UTC) Received: from mail-lb0-x234.google.com (mail-lb0-x234.google.com [IPv6:2a00:1450:4010:c04::234]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id C4FECC9C for ; Thu, 9 Apr 2015 12:02:43 +0000 (UTC) Received: by lbbuc2 with SMTP id uc2so85772656lbb.2 for ; Thu, 09 Apr 2015 05:02:42 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:in-reply-to:references:date:message-id:subject:from:to :cc:content-type:content-transfer-encoding; bh=DP2qGZWEf3yqIeRaBthGN/iomcI6m9Eld8LRol53KhA=; b=AR2EV2B6aq5yi4FF0xvkp7LNyL/5Ho+/Rz1L2++Kxvnd0J02Z/kbEKuCfncxYLGMTH Cc7JZmCfGNRH7qdW3xCIPqCBTXfeP8d92iFaClxD3BgVNcxJolXECvm8hoyBKlTR/7la BS1NLx9rbOCWJSFEIQXAeK97/Fii/hZpxOn42PgUHo2YkDsa6i6aAWTpqOC0PS1CsJnk GjgnEyMgdKxjcaUqt5FqVHlCjauLp06xERyFKizGpP3eSEZx8q2hO4jqjybVb1SuQYAZ v5yMJfes/vZC7nKTagjj5p6nad3CXCG1B2phn3igcsq8LjCAxIS+UVlTZ2KECgWTLxZq 7EUQ== MIME-Version: 1.0 X-Received: by 10.112.166.36 with SMTP id zd4mr28179812lbb.59.1428580961941; Thu, 09 Apr 2015 05:02:41 -0700 (PDT) Received: by 10.152.18.226 with HTTP; Thu, 9 Apr 2015 05:02:41 -0700 (PDT) In-Reply-To: <552657AC.1020802@ish.com.au> References: <552657AC.1020802@ish.com.au> Date: Thu, 9 Apr 2015 15:02:41 +0300 Message-ID: Subject: Re: openssl and bash libcrypto From: Kimmo Paasiala To: Aristedes Maniatis Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Cc: FreeBSD Mailing List X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 12:02:44 -0000 On Thu, Apr 9, 2015 at 1:42 PM, Aristedes Maniatis wrote: > Starting in the last week or so, several different applications are exhib= iting the same symptoms of broken libcrypto libraries. > > (gdb) core bash.core > Core was generated by `bash'. > Program terminated with signal 11, Segmentation fault. > > (gdb) bt > #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/libcr= ypto.so.8 > #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7 > #2 0x00000008032d584e in _init () from /lib/libcrypto.so.7 > #3 0x00007fffffffd7c0 in ?? () > #4 0x00000008006d66bf in r_debug_state () from /libexec/ld-elf.so.1 > #5 0x00000008006dad87 in _rtld_get_stack_prot () from /libexec/ld-elf.so= .1 > #6 0x00000008006d7ad3 in dlopen () from /libexec/ld-elf.so.1 > #7 0x0000000800e5c436 in _nsdbtaddsrc () from /lib/libc.so.7 > #8 0x0000000800e563c9 in _nsyyparse () from /lib/libc.so.7 > #9 0x0000000800e5cab1 in nsdispatch () from /lib/libc.so.7 > #10 0x0000000800e49ebe in getpwuid () from /lib/libc.so.7 > #11 0x0000000800e49cbf in getpwnam () from /lib/libc.so.7 > > > Although that symptom is in bash, I've got the exact same symptoms in ast= erisk. The builds are done in poudriere with the make flags: > > WITH_OPENSSL_PORT=3Dyes > > > I've tried updating to the latest 10.1-RELEASE-p6, although it is possibl= e that that is exactly what caused the problem in the first place when the = poudriere jail was updated to that release. > > The function calls mention ia32 but this box is purely 64bit. > > > I've seen recent discussions about the problems that confusion between co= re openssl and ports openssl can cause. But I can't for the life of me figu= re how to avoid this problem. > > * Should bash be built with "Build static executables and/or libraries"? > * Should I stop trying to use openssl from ports until this is fixed? > * Why is /lib/libcrypto.so.7 calling /usr/local/lib/libcrypto.so.8 ? > > I've tried so many different combinations of settings, I don't know what = to try next. > > Thanks > Ari > > > -- > --------------------------> > Aristedes Maniatis > ish > http://www.ish.com.au > Level 1, 30 Wilson Street Newtown 2042 Australia > phone +61 2 9550 5001 fax +61 2 9550 4001 > GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A > You could build world with WITHOUT_OPENSSL but that would also disable some other needed pieces such as OpenSSH and you'd have to install them from ports. WITHOUT_OPENSSL Set to not build OpenSSL. When set, it also enforces the foll= ow=E2=80=90 ing options: WITHOUT_KERBEROS WITHOUT_KERBEROS_SUPPORT WITHOUT_OPENSSH When set, the following options are also in effect: WITHOUT_GSSAPI (unless WITH_GSSAPI is set explicitly) From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 12:31:20 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id AB352B2A; Thu, 9 Apr 2015 12:31:20 +0000 (UTC) Received: from mail-in-08.arcor-online.net (mail-in-08.arcor-online.net [151.189.21.48]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client CN "mx.arcor.de", Issuer "Thawte SSL CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 5F1C879; Thu, 9 Apr 2015 12:31:19 +0000 (UTC) Received: from mail-in-02-z2.arcor-online.net (mail-in-02-z2.arcor-online.net [151.189.8.14]) by mx.arcor.de (Postfix) with ESMTP id 3lN1HN13c0zBk2x; Thu, 9 Apr 2015 13:59:44 +0200 (CEST) Received: from mail-in-09.arcor-online.net (mail-in-09.arcor-online.net [151.189.21.49]) by mail-in-02-z2.arcor-online.net (Postfix) with ESMTP id 0D0DE526E4C; Thu, 9 Apr 2015 13:59:44 +0200 (CEST) X-Greylist: Passed host: 188.98.158.188 X-DKIM: Sendmail DKIM Filter v2.8.2 mail-in-09.arcor-online.net 3lN1HM6ZrtzDYnJ X-Greylist: Passed host: 188.98.158.188 Received: from lorvorc.mips.inka.de (dslb-188-098-158-188.188.098.pools.vodafone-ip.de [188.98.158.188]) by mail-in-09.arcor-online.net (Postfix) with ESMTPS id 3lN1HM6ZrtzDYnJ; Thu, 9 Apr 2015 13:59:43 +0200 (CEST) Received: from lorvorc.mips.inka.de (localhost [127.0.0.1]) by lorvorc.mips.inka.de (8.14.9/8.14.9) with ESMTP id t39BxhEN081295; Thu, 9 Apr 2015 13:59:43 +0200 (CEST) (envelope-from naddy@lorvorc.mips.inka.de) Received: (from naddy@localhost) by lorvorc.mips.inka.de (8.14.9/8.14.9/Submit) id t39BxgNw081294; Thu, 9 Apr 2015 13:59:42 +0200 (CEST) (envelope-from naddy) Date: Thu, 9 Apr 2015 13:59:42 +0200 From: Christian Weisgerber To: Bryan Drewery Subject: Re: LibreSSL infects ports, causes problems Message-ID: <20150409115942.GA81282@lorvorc.mips.inka.de> References: <5525E609.70402@FreeBSD.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <5525E609.70402@FreeBSD.org> User-Agent: Mutt/1.5.23 (2014-03-12) Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 12:31:20 -0000 Bryan Drewery: > Are you mixing ports and packages? No. Ports only. -- Christian "naddy" Weisgerber naddy@mips.inka.de From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 13:00:33 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 0B417164 for ; Thu, 9 Apr 2015 13:00:33 +0000 (UTC) Received: from mail.gemius.pl (mail.gemius.pl [85.232.225.147]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 8BB10347 for ; Thu, 9 Apr 2015 13:00:31 +0000 (UTC) Received: from mail.gemius.pl ([85.232.225.147] helo=hp.ct.lan) by mail.gemius.pl with esmtpa (Exim 4.80.1 (FreeBSD)) (envelope-from ) id 1YgBQe-0002e3-9W; Thu, 09 Apr 2015 14:19:29 +0200 From: Piotr Robert Konopelko To: FreeBSD Ports Subject: MooseFS Ports for versions 2.0 and 3.0 Date: Thu, 09 Apr 2015 14:19:28 +0200 Message-ID: <2694094.4JmStLgM3m@hp> Organization: MooseFS User-Agent: KMail/4.14.1 (Linux/3.16.0-33-generic; KDE/4.14.1; x86_64; ; ) MIME-Version: 1.0 X-Authorized: Piotr Robert Konopelko Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 7Bit X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: MooseFS Technical Support Department , Jakub Kruszona-Zawadzki X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 13:00:33 -0000 Dear FreeBSD Ports team, On FreeBSD Ports site only ports for MooseFS 1.6.27-5 are available: https://www.freebsd.org/cgi/ports.cgi?query=moosefs&stype=all[1] Longer than a half year ago MooseFS 2.0 has been released and few days ago - MooseFS 3.0. We would like to inform, that we have prepared ports for MooseFS versions 2.0 and 3.0. How is the way to upgrade them in FreeBSD ports tree? Is there a possibility to make our team the maintainer of the MooseFS FreeBSD Ports? -- Best regards, Piotr Robert Konopelko *MooseFS Technical Support Engineer* | moosefs.com[2] -------- [1] https://www.freebsd.org/cgi/ports.cgi?query=moosefs&stype=all [2] http://moosefs.com From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 13:01:04 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id B36401FE for ; Thu, 9 Apr 2015 13:01:04 +0000 (UTC) Received: from hermes.heuristicsystems.com.au (hermes.heuristicsystems.com.au [203.41.22.115]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client CN "hermes.heuristicsystems.com.au", Issuer "Heuristic Systems Type 4 Host CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4C792357 for ; Thu, 9 Apr 2015 13:01:03 +0000 (UTC) Received: from [10.0.5.3] (ewsw01.hs [10.0.5.3]) (authenticated bits=0) by hermes.heuristicsystems.com.au (8.14.5/8.13.6) with ESMTP id t39ChaJE042723 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES128-SHA bits=128 verify=NOT) for ; Thu, 9 Apr 2015 22:43:50 +1000 (EST) (envelope-from dewayne.geraghty@heuristicsystems.com.au) Message-ID: <552673F7.70102@heuristicsystems.com.au> Date: Thu, 09 Apr 2015 22:43:35 +1000 From: Dewayne Geraghty User-Agent: Mozilla/5.0 (Windows NT 6.1; rv:31.0) Gecko/20100101 Thunderbird/31.5.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: openssl and bash libcrypto References: <552657AC.1020802@ish.com.au> In-Reply-To: Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 13:01:04 -0000 On 9/04/2015 10:02 PM, Kimmo Paasiala wrote: > On Thu, Apr 9, 2015 at 1:42 PM, Aristedes Maniatis wrote: >> Starting in the last week or so, several different applications are exhibiting the same symptoms of broken libcrypto libraries. >> >> (gdb) core bash.core >> Core was generated by `bash'. >> Program terminated with signal 11, Segmentation fault. >> >> (gdb) bt >> #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/libcrypto.so.8 >> #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7 >> #2 0x00000008032d584e in _init () from /lib/libcrypto.so.7 >> #3 0x00007fffffffd7c0 in ?? () >> #4 0x00000008006d66bf in r_debug_state () from /libexec/ld-elf.so.1 >> #5 0x00000008006dad87 in _rtld_get_stack_prot () from /libexec/ld-elf.so.1 >> #6 0x00000008006d7ad3 in dlopen () from /libexec/ld-elf.so.1 >> #7 0x0000000800e5c436 in _nsdbtaddsrc () from /lib/libc.so.7 >> #8 0x0000000800e563c9 in _nsyyparse () from /lib/libc.so.7 >> #9 0x0000000800e5cab1 in nsdispatch () from /lib/libc.so.7 >> #10 0x0000000800e49ebe in getpwuid () from /lib/libc.so.7 >> #11 0x0000000800e49cbf in getpwnam () from /lib/libc.so.7 >> >> >> Although that symptom is in bash, I've got the exact same symptoms in asterisk. The builds are done in poudriere with the make flags: >> >> WITH_OPENSSL_PORT=yes >> >> >> I've tried updating to the latest 10.1-RELEASE-p6, although it is possible that that is exactly what caused the problem in the first place when the poudriere jail was updated to that release. >> >> The function calls mention ia32 but this box is purely 64bit. >> >> >> I've seen recent discussions about the problems that confusion between core openssl and ports openssl can cause. But I can't for the life of me figure how to avoid this problem. >> >> * Should bash be built with "Build static executables and/or libraries"? >> * Should I stop trying to use openssl from ports until this is fixed? >> * Why is /lib/libcrypto.so.7 calling /usr/local/lib/libcrypto.so.8 ? >> >> I've tried so many different combinations of settings, I don't know what to try next. >> >> Thanks >> Ari >> >> >> -- >> --------------------------> >> Aristedes Maniatis >> ish >> http://www.ish.com.au >> Level 1, 30 Wilson Street Newtown 2042 Australia >> phone +61 2 9550 5001 fax +61 2 9550 4001 >> GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A >> > You could build world with WITHOUT_OPENSSL but that would also disable > some other needed pieces such as OpenSSH and you'd have to install > them from ports. > > WITHOUT_OPENSSL > Set to not build OpenSSL. When set, it also enforces the follow‐ > ing options: > > WITHOUT_KERBEROS > WITHOUT_KERBEROS_SUPPORT > WITHOUT_OPENSSH > > When set, the following options are also in effect: > > WITHOUT_GSSAPI (unless WITH_GSSAPI is set explicitly) > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > > > Take care, as: geli, pkg and tar will fail to build, the latter due to libarchive, and libfetch as also being affected. I went down this path a few years ago, but stopped when the ability to install security/openssl into /usr was instituted. (geli only needs openssl headers). As an FYI, I build all ports using security/openssl though heimdal and a few others are a challenge because they try/tried to use base openssl libcom_err.so. I'd suggest making a backup of the openssl libs (crypto, ssl), pkg-static and verify /rescue/tar is available, so that you have a recovery route. From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 13:05:28 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 4E66B546; Thu, 9 Apr 2015 13:05:28 +0000 (UTC) Received: from mail-vn0-x22c.google.com (mail-vn0-x22c.google.com [IPv6:2607:f8b0:400c:c0f::22c]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id F0B43634; Thu, 9 Apr 2015 13:05:27 +0000 (UTC) Received: by vnbg190 with SMTP id g190so20788310vnb.12; Thu, 09 Apr 2015 06:05:27 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:date:from:to:cc:subject:message-id:references:mime-version :content-type:content-disposition:in-reply-to:user-agent; bh=q55M9wArlQft9VW8ojhvER28jdCEL3TRf6A6gta0VlA=; b=DWMvMYDCxceEsCreGk3XG9jq1bF83+RucMfanABKYf+bh9dMqotGaZk4lFZo3k0HQU fS7kcUgsokCthijAjcFUJ4P5D+wQVdNNzgGULXT2w6sfUyB9HSloDD8KSkAKyxvM9ZUh f191LJ690QshxE1EdsYkaMrgSCURpNV1ZgmDp9B+tsDAzVZtLmdeoBDsLwpkuRFcya2O fNvYv03wvatOxb1OPom7EzssuhOm2H/wuQVssVQg2PSZe6aw0UXgJAjlFTM4Drd+m29E HyA9cVBBiWSYdZVxN4VGyABl0Z4oif666kOpOq7/CLifk0YA+TUx4DHjBspxUPm9lo6T yG1w== X-Received: by 10.52.184.230 with SMTP id ex6mr2753225vdc.70.1428584727077; Thu, 09 Apr 2015 06:05:27 -0700 (PDT) Received: from ivaldir.etoilebsd.net ([2001:41d0:8:db4c::1]) by mx.google.com with ESMTPSA id ug16sm1511091vdb.14.2015.04.09.06.05.24 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 06:05:25 -0700 (PDT) Sender: Baptiste Daroussin Date: Thu, 9 Apr 2015 15:05:22 +0200 From: Baptiste Daroussin To: Christian Weisgerber Subject: Re: LibreSSL infects ports, causes problems Message-ID: <20150409130521.GQ95321@ivaldir.etoilebsd.net> References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="xYeFQzU4VZLrHqxU" Content-Disposition: inline In-Reply-To: <20150409115942.GA81282@lorvorc.mips.inka.de> User-Agent: Mutt/1.5.23 (2014-03-12) Cc: freebsd-ports@freebsd.org, Bryan Drewery X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 13:05:28 -0000 --xYeFQzU4VZLrHqxU Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Apr 09, 2015 at 01:59:42PM +0200, Christian Weisgerber wrote: > Bryan Drewery: >=20 > > Are you mixing ports and packages? >=20 > No. Ports only. >=20 Some how you have mixed up things between base openssl and libressl, when starting to activate libressl if you are using ports only you have to be ex= tra careful, (same goes with ncurses or ports openssl) just installing those po= rts is enough to "pollute" nearly anything you build after with a dependency on= it (well anything that does link to libssl, libcrypto) If it very complicated = and error prone to cherry pick "only take base openssl here, only ports openssl there" the only "safe" way to solve this situation and being consistent is = to always skip the version from base and enforce the version for ports. (the otherway around is impossible - very complicated) That is the price of building in place... Regards, Bapt --xYeFQzU4VZLrHqxU Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1 iEYEARECAAYFAlUmeREACgkQ8kTtMUmk6EwL4QCgkxRbRaC146BZAFTHH7aCRHPH IxcAoMI31mtSzFwwVLkYCIJUK5RZZiv+ =/yZ5 -----END PGP SIGNATURE----- --xYeFQzU4VZLrHqxU-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 13:11:56 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 63ABCAB1 for ; Thu, 9 Apr 2015 13:11:56 +0000 (UTC) Received: from mail-wi0-x232.google.com (mail-wi0-x232.google.com [IPv6:2a00:1450:400c:c05::232]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id E7FA7795 for ; Thu, 9 Apr 2015 13:11:55 +0000 (UTC) Received: by widdi4 with SMTP id di4so91670285wid.0 for ; Thu, 09 Apr 2015 06:11:54 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:in-reply-to:references:date:message-id:subject:from:to :cc:content-type; bh=cvbQy7TvR4anDj6zQnKmy/KnYzZvO3X1dofdLMaBgzQ=; b=O9zw89+nFeGJKu3VPaNRCWx9rBVg75wa2ztMKXgQTlQ1S2d1CAttGHT4OFDABhlmQ7 HJzLSo5aoNLd85vVymWxJ82M8qLcf02Zshgpkw3pB7Ig0gASw4m/MHcbHMFZv981JmPA sl+onXri3/hET6J5lgxzvd07v106vN+TW7Y+YdHi+8McF6UmG+HslbuDLwBuu09WQJDo kivc83S0czt3H0UMB4QrUIIqwWk7uqdcKDD0p6H4GLCREdqSVPLhgDBnlRphFMXHgPR0 MJIktlHRF4APOidzTbStvu5DooCHcDMwn4WgYB6xnXu+7okc0gIhMtfljMUkxy3Pv1LZ QmnA== MIME-Version: 1.0 X-Received: by 10.194.200.194 with SMTP id ju2mr51770931wjc.61.1428585114385; Thu, 09 Apr 2015 06:11:54 -0700 (PDT) Received: by 10.180.4.41 with HTTP; Thu, 9 Apr 2015 06:11:53 -0700 (PDT) Received: by 10.180.4.41 with HTTP; Thu, 9 Apr 2015 06:11:53 -0700 (PDT) In-Reply-To: <2694094.4JmStLgM3m@hp> References: <2694094.4JmStLgM3m@hp> Date: Thu, 9 Apr 2015 15:11:53 +0200 Message-ID: Subject: Re: MooseFS Ports for versions 2.0 and 3.0 From: =?UTF-8?Q?Fernando_Apestegu=C3=ADa?= To: Piotr Robert Konopelko Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: ports FreeBSD , MooseFS Technical Support Department , Jakub Kruszona-Zawadzki X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 13:11:56 -0000 El 09/04/2015 15:00, "Piotr Robert Konopelko" escribi=C3=B3: > > Dear FreeBSD Ports team, > > On FreeBSD Ports site only ports for MooseFS 1.6.27-5 are available: > https://www.freebsd.org/cgi/ports.cgi?query=3Dmoosefs&stype=3Dall[1] > > Longer than a half year ago MooseFS 2.0 has been released and few days ago - MooseFS > 3.0. > > We would like to inform, that we have prepared ports for MooseFS versions 2.0 and 3.0. > > How is the way to upgrade them in FreeBSD ports tree? You can start here: https://bugs.freebsd.org/bugzilla/ And file a request > Is there a possibility to make our team the maintainer of the MooseFS FreeBSD Ports? Since ports@ is the current maintainer, you could file another request and see if they are willing to drop mantainership in your favor or ask here :) > > > -- > Best regards, > Piotr Robert Konopelko > *MooseFS Technical Support Engineer* | moosefs.com[2] > > > -------- > [1] https://www.freebsd.org/cgi/ports.cgi?query=3Dmoosefs&stype=3Dall > [2] http://moosefs.com > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 13:26:40 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 88ED0E96 for ; Thu, 9 Apr 2015 13:26:40 +0000 (UTC) Received: from mail.ijs.si (mail.ijs.si [IPv6:2001:1470:ff80::25]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 37D7D908 for ; Thu, 9 Apr 2015 13:26:40 +0000 (UTC) Received: from amavis-proxy-ori.ijs.si (localhost [IPv6:::1]) by mail.ijs.si (Postfix) with ESMTP id 3lN3Cb6TRpz1MK for ; Thu, 9 Apr 2015 15:26:35 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=ijs.si; h= user-agent:message-id:references:in-reply-to:organization :subject:subject:from:from:date:date:content-transfer-encoding :content-type:content-type:mime-version:received:received :received:received; s=jakla4; t=1428585993; x=1431177994; bh=uUZ W9OguccS0BAzWW7X19fDM7UUWrG5BdgzkiYYmPls=; b=kT9mbpqgkWcCeR45CU+ Zo5/0+k7InpH+G5rJwmkrzl0taeEN4sFWaT+eIk49vaJ0G8jRy5BUrz81YXwtdsq YeJMnGJ3mByR6XNe6cvrZ4BJxUE8e13fjY2nOiApzn4S3fyRe+G2JeU2XfiHX/ry l0jU1//YFZvBlF9xKjSBs7cA= X-Virus-Scanned: amavisd-new at ijs.si Received: from mail.ijs.si ([IPv6:::1]) by amavis-proxy-ori.ijs.si (mail.ijs.si [IPv6:::1]) (amavisd-new, port 10012) with ESMTP id WzbC1OJYNqqf for ; Thu, 9 Apr 2015 15:26:33 +0200 (CEST) Received: from mildred.ijs.si (mailbox.ijs.si [IPv6:2001:1470:ff80::143:1]) by mail.ijs.si (Postfix) with ESMTP for ; Thu, 9 Apr 2015 15:26:33 +0200 (CEST) Received: from neli.ijs.si (neli.ijs.si [IPv6:2001:1470:ff80:88:21c:c0ff:feb1:8c91]) by mildred.ijs.si (Postfix) with ESMTP id 3lN3CY1cWbz5g for ; Thu, 9 Apr 2015 15:26:33 +0200 (CEST) Received: from neli.ijs.si ([2001:1470:ff80:88:21c:c0ff:feb1:8c91]) by neli.ijs.si with HTTP (HTTP/1.1 POST); Thu, 09 Apr 2015 15:26:32 +0200 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: quoted-printable Date: Thu, 09 Apr 2015 15:26:32 +0200 From: Mark Martinec To: freebsd-ports@freebsd.org Subject: Re: is it safe to run net/haproxy as root? Organization: J. Stefan Institute In-Reply-To: <20150409114426.0081485b@efreet> References: <20150409114426.0081485b@efreet> Message-ID: X-Sender: Mark.Martinec+freebsd@ijs.si User-Agent: Roundcube Webmail/1.1.1 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 13:26:40 -0000 Marko Cupa=C4=87 wrote: > I am setting up haproxy for the first time, and of course my first OS > choice is FreeBSD. >=20 > Most services I am familiar with use their own service accounts which > are created when port is installed (squid, ejabberd, mysql, clamav, > vscan etc.). But haproxy does not create account, and there is no > pkg-message, or any other reference which suggests I should create > separate account, and also whether it needs shell, homedir etc. On the > other hand, most web 'works for me' howtos mention running it under > separate account. >=20 > So, my question is the one from this mail's subject: > Is it safe to run haproxy under root account? If not, what is the best > practice regarding its user account's shell and homedir? Is there a > recommendation for UID/GID? It might be safe, but there is no compelling reason to run it as root, and a common sense advises against it. Even if it needs to bind to a low port number, haproxy is capable of dropping privilege after binding to a socket, and continues running under some other uid/gid, e.g.: /usr/local/etc/haproxy.conf global daemon user www group www [...] Apparently there isn't any standard FreeBSD uid assigned for this purpose. Either make up one, or it may be good enough to re-use one of the existing ones, perhaps the www account. Perhaps the haproxy port maintainer can be persuaded to assign some account entry for this purpose. Mark From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 14:05:27 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id C087775B for ; Thu, 9 Apr 2015 14:05:27 +0000 (UTC) Received: from new2-smtp.messagingengine.com (new2-smtp.messagingengine.com [66.111.4.224]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 901A0D61 for ; Thu, 9 Apr 2015 14:05:27 +0000 (UTC) Received: from compute6.internal (compute6.nyi.internal [10.202.2.46]) by mailnew.nyi.internal (Postfix) with ESMTP id D0D181458 for ; Thu, 9 Apr 2015 10:05:15 -0400 (EDT) Received: from web3 ([10.202.2.213]) by compute6.internal (MEProxy); Thu, 09 Apr 2015 10:05:19 -0400 DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:content-type :date:from:in-reply-to:message-id:mime-version:references :subject:to:x-sasl-enc:x-sasl-enc; s=smtpout; bh=uG7ZBTDQ6zJ1Drr xqDfKjAx1yvk=; b=X5OEgeW0WMWKa410IMWI/QacyYkd2FwcnET6iuLCUX+HwCE uYeF/05H6NaxGq0sXX5N5/RMbpCp2kddsf6Vmgpv9CHVSo7Ac5xCcQffRY33zoDj oSCHvVrtp8/PCoxXbLRfTgs/6Mg7uDxbAIuFTdf6Ac3MHjySp1kurd2arg+k= Received: by web3.nyi.internal (Postfix, from userid 99) id 94E40112FC1; Thu, 9 Apr 2015 10:05:19 -0400 (EDT) Message-Id: <1428588319.1982383.251264557.2FD824BC@webmail.messagingengine.com> X-Sasl-Enc: YidrFO/vUTAkCsr62PECCKd/qQuQQPFDajS3RM4zHIau 1428588319 From: Mark Felder To: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Transfer-Encoding: 7bit Content-Type: text/plain X-Mailer: MessagingEngine.com Webmail Interface - ajax-0b3c2300 In-Reply-To: References: <20150409114426.0081485b@efreet> Subject: Re: is it safe to run net/haproxy as root? Date: Thu, 09 Apr 2015 09:05:19 -0500 X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 14:05:27 -0000 On Thu, Apr 9, 2015, at 08:26, Mark Martinec wrote: > > Perhaps the haproxy port maintainer can be persuaded to assign > some account entry for this purpose. > This wouldn't be a perfect solution. If you're going to be proxying port 80 and 443 you need to initially run as root, but perhaps by default in the config file we could drop privs to the haproxy user? Sounds like we need some better documentation on best practices, too. From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 14:27:19 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 0BE3EF65 for ; Thu, 9 Apr 2015 14:27:19 +0000 (UTC) Received: from smtp.mimar.rs (smtp.mimar.rs [193.53.106.135]) by mx1.freebsd.org (Postfix) with ESMTP id AAD25FA5 for ; Thu, 9 Apr 2015 14:27:17 +0000 (UTC) Received: from vscan.mimar.rs (vscan.mimar.rs [193.53.106.134]) by smtp.mimar.rs (Postfix) with ESMTP id DC727898E4 for ; Thu, 9 Apr 2015 16:27:15 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=mimar.rs; h= content-transfer-encoding:content-type:content-type:mime-version :x-mailer:organization:references:in-reply-to:message-id:subject :subject:from:from:date:date:received:received; s=mimar-0901; t= 1428589628; x=1430404029; bh=m9o19i5+F2G13pEHqbp50y5D9XnyCz5Z9FA iW4yld9Q=; b=t5REdIIAN0e5v8EnBRrU9rjhuoxYdIIaYoR6utKSn7KQL0zDSxt zGii9CgQjneosFg9tx7QEPnv7NIfrITXYtOQTQGWzvbmQC6YomlsFDSlNa33wdPp 3MAJ6OcFKPwwh5gS8r33WN0Ch+uhHYzv2lWd5Z7j5oWWqTLJPxaE2o3A= X-Virus-Scanned: amavisd-new at mimar.rs Received: from smtp.mimar.rs ([193.53.106.135]) by vscan.mimar.rs (vscan.mimar.rs [193.53.106.134]) (amavisd-new, port 10026) with ESMTP id GpqeI9IWi0qx for ; Thu, 9 Apr 2015 16:27:08 +0200 (CEST) Received: from efreet (unknown [193.53.106.34]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) (Authenticated sender: marko.cupac@mimar.rs) by smtp.mimar.rs (Postfix) with ESMTPSA id 6AFFD898DF for ; Thu, 9 Apr 2015 16:27:08 +0200 (CEST) Date: Thu, 9 Apr 2015 16:27:07 +0200 From: Marko =?UTF-8?B?Q3VwYcSH?= To: freebsd-ports@freebsd.org Subject: Re: is it safe to run net/haproxy as root? Message-ID: <20150409162707.19890da8@efreet> In-Reply-To: <1428588319.1982383.251264557.2FD824BC@webmail.messagingengine.com> References: <20150409114426.0081485b@efreet> <1428588319.1982383.251264557.2FD824BC@webmail.messagingengine.com> Organization: Mimar X-Mailer: Claws Mail 3.9.3 (GTK+ 2.24.23; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 14:27:19 -0000 On Thu, 09 Apr 2015 09:05:19 -0500 Mark Felder wrote: >=20 >=20 > On Thu, Apr 9, 2015, at 08:26, Mark Martinec wrote: > >=20 > > Perhaps the haproxy port maintainer can be persuaded to assign > > some account entry for this purpose. > >=20 >=20 > This wouldn't be a perfect solution. If you're going to be proxying > port 80 and 443 you need to initially run as root, but perhaps by > default in the config file we could drop privs to the haproxy user? I am now testing proxying http(s) 80 and 443 to apache servers, but also tcp 3306 to mysql servers. I use separate profiles (which spawn separate instances if I understand well). Maybe it would be good to drop http(s) to www user/group, and tcp 3306 to mysql user/group? www user/group comes with default FreeBSD installation, and I would need to create mysql user/group manually with same parameters as mysql port creates them (no problem). Does this sound reasonable? --=20 Marko Cupa=C4=87 https://www.mimar.rs From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 14:52:33 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id A904CB3A for ; Thu, 9 Apr 2015 14:52:33 +0000 (UTC) Received: from mail-ig0-x231.google.com (mail-ig0-x231.google.com [IPv6:2607:f8b0:4001:c05::231]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 69BFB372 for ; Thu, 9 Apr 2015 14:52:33 +0000 (UTC) Received: by igblo3 with SMTP id lo3so68577875igb.1 for ; Thu, 09 Apr 2015 07:52:32 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc:content-type; bh=W+8tjZEUEsdCRMj4VGX7rF8h8FKTEhaKXjV6PTqh0Qk=; b=gWOSkqrnjheiDGDFpYrhroxSBZ9DWc1T+hrMyReS6bv7Hhl+2+JTDrB2BaTz08aSdQ w6k/UmGwj5gHVyVJ2/xf7LJ9Xkz1jTN0y0txQtRSulEUnhT2zix3FsQ/2JRr5eUmxSNz piRwT3zKzXoVmLwCHlEtSXR/0/BQgn4g1wgm5Loj/oeGwuA6GJNxb3MQ9jlG+q6i14/B KGX87X67pXLVK78SnU/UuRNRCM7Mlu0yfWPuOMISIsza3OuaAv/R0bkhZRyAu0DFSs7T ADdeqIkJZS8Pv8yoEpH1ddr6PRX4ArbIE3+EY0Qr0RL0wrRw9ierTAu3Y/8W+ejAtj9i kS6A== X-Received: by 10.50.97.41 with SMTP id dx9mr20386636igb.1.1428591152719; Thu, 09 Apr 2015 07:52:32 -0700 (PDT) MIME-Version: 1.0 References: <2694094.4JmStLgM3m@hp> In-Reply-To: From: Ben Woods Date: Thu, 09 Apr 2015 14:52:32 +0000 Message-ID: Subject: Re: MooseFS Ports for versions 2.0 and 3.0 To: =?UTF-8?Q?Fernando_Apestegu=C3=ADa?= , Piotr Robert Konopelko Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: ports FreeBSD , MooseFS Technical Support Department , Jakub Kruszona-Zawadzki X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 14:52:33 -0000 Those ports currently have their maintainer fields set to "ports@freebsd.or= g", meaning there is no maintainer. When you submit the bug report and attach your patch to update the port, simply ensure the maintainer email address is updated to your own. You will then be volunteering as the maintainer for those ports. Regards, Ben On Thu, 9 Apr 2015 at 9:12 pm Fernando Apestegu=C3=ADa < fernando.apesteguia@gmail.com> wrote: > El 09/04/2015 15:00, "Piotr Robert Konopelko" > > escribi=C3=B3: > > > > Dear FreeBSD Ports team, > > > > On FreeBSD Ports site only ports for MooseFS 1.6.27-5 are available: > > https://www.freebsd.org/cgi/ports.cgi?query=3Dmoosefs&stype=3Dall[1] > > > > Longer than a half year ago MooseFS 2.0 has been released and few days > ago - MooseFS > > 3.0. > > > > We would like to inform, that we have prepared ports for MooseFS versio= ns > 2.0 and 3.0. > > > > How is the way to upgrade them in FreeBSD ports tree? > > You can start here: > > https://bugs.freebsd.org/bugzilla/ > > And file a request > > > Is there a possibility to make our team the maintainer of the MooseFS > FreeBSD Ports? > > Since ports@ is the current maintainer, you could file another request an= d > see if they are willing to drop mantainership in your favor or ask here := ) > > > > > > > -- > > Best regards, > > Piotr Robert Konopelko > > *MooseFS Technical Support Engineer* | moosefs.com[2] > > > > > > -------- > > [1] https://www.freebsd.org/cgi/ports.cgi?query=3Dmoosefs&stype=3Dall > > [2] http://moosefs.com > > _______________________________________________ > > freebsd-ports@freebsd.org mailing list > > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org= " > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 14:52:50 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 903B3C8B for ; Thu, 9 Apr 2015 14:52:50 +0000 (UTC) Received: from mail-la0-x22b.google.com (mail-la0-x22b.google.com [IPv6:2a00:1450:4010:c03::22b]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 106E4379 for ; Thu, 9 Apr 2015 14:52:50 +0000 (UTC) Received: by labbd9 with SMTP id bd9so80046278lab.2 for ; Thu, 09 Apr 2015 07:52:48 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:in-reply-to:references:date:message-id:subject:from:to :cc:content-type:content-transfer-encoding; bh=0V9GV7LpGtmmlZHNhuxVuyTTP5wHVQIs7tHxMOboXyE=; b=vVc21xd+d07Oy0nyIrIL9TFST2JPY5xoaiIhEUn30sZu4EA9U/xJx7fZtVKqTCg+RS otytmc+9zdJxF0AJFQ7oItYdBM+7vqIAbSm4g4TZ09NpGBYrCNwWAu3diwLC9JMK6+WV jREWlCkYrE9t9iY3tvgmPAYB8Xy1G0MSokiE07sOVobZ1m8wF+Ti85fr0EHFzSQ1hamE 4NOMaS+KsqdR/sZGD8UZDMEAZbesoIzbKd6oHPmifAl6YvgdB0AWEVgWkjEvROH+ibOj lst/wamOEsNz2EtjPhxEWFsJfRy0Gcishrq3fPOUHg1XqrV+ZtSEFQ3tVM/SrLaz37mW X0xA== MIME-Version: 1.0 X-Received: by 10.112.98.234 with SMTP id el10mr28469685lbb.28.1428591168237; Thu, 09 Apr 2015 07:52:48 -0700 (PDT) Received: by 10.152.18.226 with HTTP; Thu, 9 Apr 2015 07:52:48 -0700 (PDT) In-Reply-To: <552673F7.70102@heuristicsystems.com.au> References: <552657AC.1020802@ish.com.au> <552673F7.70102@heuristicsystems.com.au> Date: Thu, 9 Apr 2015 17:52:48 +0300 Message-ID: Subject: Re: openssl and bash libcrypto From: Kimmo Paasiala To: Dewayne Geraghty Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Cc: freebsd-ports X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 14:52:50 -0000 On Thu, Apr 9, 2015 at 3:43 PM, Dewayne Geraghty wrote: > > On 9/04/2015 10:02 PM, Kimmo Paasiala wrote: >> On Thu, Apr 9, 2015 at 1:42 PM, Aristedes Maniatis wrot= e: >>> Starting in the last week or so, several different applications are exh= ibiting the same symptoms of broken libcrypto libraries. >>> >>> (gdb) core bash.core >>> Core was generated by `bash'. >>> Program terminated with signal 11, Segmentation fault. >>> >>> (gdb) bt >>> #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/lib= crypto.so.8 >>> #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so= .7 >>> #2 0x00000008032d584e in _init () from /lib/libcrypto.so.7 >>> #3 0x00007fffffffd7c0 in ?? () >>> #4 0x00000008006d66bf in r_debug_state () from /libexec/ld-elf.so.1 >>> #5 0x00000008006dad87 in _rtld_get_stack_prot () from /libexec/ld-elf.= so.1 >>> #6 0x00000008006d7ad3 in dlopen () from /libexec/ld-elf.so.1 >>> #7 0x0000000800e5c436 in _nsdbtaddsrc () from /lib/libc.so.7 >>> #8 0x0000000800e563c9 in _nsyyparse () from /lib/libc.so.7 >>> #9 0x0000000800e5cab1 in nsdispatch () from /lib/libc.so.7 >>> #10 0x0000000800e49ebe in getpwuid () from /lib/libc.so.7 >>> #11 0x0000000800e49cbf in getpwnam () from /lib/libc.so.7 >>> >>> >>> Although that symptom is in bash, I've got the exact same symptoms in a= sterisk. The builds are done in poudriere with the make flags: >>> >>> WITH_OPENSSL_PORT=3Dyes >>> >>> >>> I've tried updating to the latest 10.1-RELEASE-p6, although it is possi= ble that that is exactly what caused the problem in the first place when th= e poudriere jail was updated to that release. >>> >>> The function calls mention ia32 but this box is purely 64bit. >>> >>> >>> I've seen recent discussions about the problems that confusion between = core openssl and ports openssl can cause. But I can't for the life of me fi= gure how to avoid this problem. >>> >>> * Should bash be built with "Build static executables and/or libraries"= ? >>> * Should I stop trying to use openssl from ports until this is fixed? >>> * Why is /lib/libcrypto.so.7 calling /usr/local/lib/libcrypto.so.8 ? >>> >>> I've tried so many different combinations of settings, I don't know wha= t to try next. >>> >>> Thanks >>> Ari >>> >>> >>> -- >>> --------------------------> >>> Aristedes Maniatis >>> ish >>> http://www.ish.com.au >>> Level 1, 30 Wilson Street Newtown 2042 Australia >>> phone +61 2 9550 5001 fax +61 2 9550 4001 >>> GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A >>> >> You could build world with WITHOUT_OPENSSL but that would also disable >> some other needed pieces such as OpenSSH and you'd have to install >> them from ports. >> >> WITHOUT_OPENSSL >> Set to not build OpenSSL. When set, it also enforces the f= ollow=E2=80=90 >> ing options: >> >> WITHOUT_KERBEROS >> WITHOUT_KERBEROS_SUPPORT >> WITHOUT_OPENSSH >> >> When set, the following options are also in effect: >> >> WITHOUT_GSSAPI (unless WITH_GSSAPI is set explicitly) >> _______________________________________________ >> freebsd-ports@freebsd.org mailing list >> http://lists.freebsd.org/mailman/listinfo/freebsd-ports >> To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" >> >> >> > Take care, as: geli, pkg and tar will fail to build, the latter due to > libarchive, and libfetch as also being affected. I went down this path > a few years ago, but stopped when the ability to install > security/openssl into /usr was instituted. (geli only needs openssl > headers). As an FYI, I build all ports using security/openssl though > heimdal and a few others are a challenge because they try/tried to use > base openssl libcom_err.so. > I'd suggest making a backup of the openssl libs (crypto, ssl), > pkg-static and verify /rescue/tar is available, so that you have a > recovery route. > Aah yes, it's no-go then if it breaks pkg(8)... One solution that comes to my mind would be to use two-level namespaces for symbol resolution. The first part would be the module name and the second part the symbol name. Any shared libraries produced by ports(7) would be required to prepend 'ports-' to the module name. This would eliminate any possibility of dynamic symbol clashes between ports and the base system. -Kimmo From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 15:15:25 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 88B69806 for ; Thu, 9 Apr 2015 15:15:25 +0000 (UTC) Received: from mail-vn0-x22f.google.com (mail-vn0-x22f.google.com [IPv6:2607:f8b0:400c:c0f::22f]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 333BD860 for ; Thu, 9 Apr 2015 15:15:25 +0000 (UTC) Received: by vnbf129 with SMTP id f129so21609230vnb.9 for ; Thu, 09 Apr 2015 08:15:23 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:date:from:to:cc:subject:message-id:references:mime-version :content-type:content-disposition:in-reply-to:user-agent; bh=n3BHuE6TdOI1ROKgvMNU2c1ZV7sCkDkdcncNsMVo2zE=; b=EnsmMCSkw/pBUx31oFq5Bq6Jjfw9D4wJNJ2yByonDb3xlddxuvFxmGFN+PoiNiqL0M PG6kj18LnnaBlPtws+4vCVsUDEMsVttzNICbyzfL2UQIqLcZgnC/TtiIp9Jebyh3vsB9 524T4XBUwoSTMEEYKl9e5Gm+3GeD9FEBpHjQttRFOfaD93+i9sOXUl93q7gQ7acwPBG0 VS8AQzZheCKZQIVOLIUb8gUaFI6W7iZTe3tlH1+i7L8MvJFgzfK3Y/RqTa1PUJtFsQp7 tipm/qLoMKrJNVZ/hlG0k0RrPjXeC5mUMtmHLpU1cBA0tbRKHBXA6A+KoaZaxM/XIKX0 Lp0w== X-Received: by 10.52.26.47 with SMTP id i15mr5490987vdg.56.1428592523788; Thu, 09 Apr 2015 08:15:23 -0700 (PDT) Received: from ivaldir.etoilebsd.net ([2001:41d0:8:db4c::1]) by mx.google.com with ESMTPSA id p12sm2626814vds.23.2015.04.09.08.15.20 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 08:15:22 -0700 (PDT) Sender: Baptiste Daroussin Date: Thu, 9 Apr 2015 17:15:18 +0200 From: Baptiste Daroussin To: Kimmo Paasiala Subject: Re: openssl and bash libcrypto Message-ID: <20150409151518.GS95321@ivaldir.etoilebsd.net> References: <552657AC.1020802@ish.com.au> <552673F7.70102@heuristicsystems.com.au> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="4ZVTVymsHR1TEBjP" Content-Disposition: inline In-Reply-To: User-Agent: Mutt/1.5.23 (2014-03-12) Cc: freebsd-ports , Dewayne Geraghty X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 15:15:25 -0000 --4ZVTVymsHR1TEBjP Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Apr 09, 2015 at 05:52:48PM +0300, Kimmo Paasiala wrote: > On Thu, Apr 9, 2015 at 3:43 PM, Dewayne Geraghty > wrote: > > > > On 9/04/2015 10:02 PM, Kimmo Paasiala wrote: > >> On Thu, Apr 9, 2015 at 1:42 PM, Aristedes Maniatis wr= ote: > >>> Starting in the last week or so, several different applications are e= xhibiting the same symptoms of broken libcrypto libraries. > >>> > >>> (gdb) core bash.core > >>> Core was generated by `bash'. > >>> Program terminated with signal 11, Segmentation fault. > >>> > >>> (gdb) bt > >>> #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/l= ibcrypto.so.8 > >>> #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.= so.7 > >>> #2 0x00000008032d584e in _init () from /lib/libcrypto.so.7 > >>> #3 0x00007fffffffd7c0 in ?? () > >>> #4 0x00000008006d66bf in r_debug_state () from /libexec/ld-elf.so.1 > >>> #5 0x00000008006dad87 in _rtld_get_stack_prot () from /libexec/ld-el= f.so.1 > >>> #6 0x00000008006d7ad3 in dlopen () from /libexec/ld-elf.so.1 > >>> #7 0x0000000800e5c436 in _nsdbtaddsrc () from /lib/libc.so.7 > >>> #8 0x0000000800e563c9 in _nsyyparse () from /lib/libc.so.7 > >>> #9 0x0000000800e5cab1 in nsdispatch () from /lib/libc.so.7 > >>> #10 0x0000000800e49ebe in getpwuid () from /lib/libc.so.7 > >>> #11 0x0000000800e49cbf in getpwnam () from /lib/libc.so.7 > >>> > >>> > >>> Although that symptom is in bash, I've got the exact same symptoms in= asterisk. The builds are done in poudriere with the make flags: > >>> > >>> WITH_OPENSSL_PORT=3Dyes > >>> > >>> > >>> I've tried updating to the latest 10.1-RELEASE-p6, although it is pos= sible that that is exactly what caused the problem in the first place when = the poudriere jail was updated to that release. > >>> > >>> The function calls mention ia32 but this box is purely 64bit. > >>> > >>> > >>> I've seen recent discussions about the problems that confusion betwee= n core openssl and ports openssl can cause. But I can't for the life of me = figure how to avoid this problem. > >>> > >>> * Should bash be built with "Build static executables and/or librarie= s"? > >>> * Should I stop trying to use openssl from ports until this is fixed? > >>> * Why is /lib/libcrypto.so.7 calling /usr/local/lib/libcrypto.so.8 ? > >>> > >>> I've tried so many different combinations of settings, I don't know w= hat to try next. > >>> > >>> Thanks > >>> Ari > >>> > >>> > >>> -- > >>> --------------------------> > >>> Aristedes Maniatis > >>> ish > >>> http://www.ish.com.au > >>> Level 1, 30 Wilson Street Newtown 2042 Australia > >>> phone +61 2 9550 5001 fax +61 2 9550 4001 > >>> GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A > >>> > >> You could build world with WITHOUT_OPENSSL but that would also disable > >> some other needed pieces such as OpenSSH and you'd have to install > >> them from ports. > >> > >> WITHOUT_OPENSSL > >> Set to not build OpenSSL. When set, it also enforces the= follow=E2=80=90 > >> ing options: > >> > >> WITHOUT_KERBEROS > >> WITHOUT_KERBEROS_SUPPORT > >> WITHOUT_OPENSSH > >> > >> When set, the following options are also in effect: > >> > >> WITHOUT_GSSAPI (unless WITH_GSSAPI is set explicitly) > >> _______________________________________________ > >> freebsd-ports@freebsd.org mailing list > >> http://lists.freebsd.org/mailman/listinfo/freebsd-ports > >> To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.or= g" > >> > >> > >> > > Take care, as: geli, pkg and tar will fail to build, the latter due to > > libarchive, and libfetch as also being affected. I went down this path > > a few years ago, but stopped when the ability to install > > security/openssl into /usr was instituted. (geli only needs openssl > > headers). As an FYI, I build all ports using security/openssl though > > heimdal and a few others are a challenge because they try/tried to use > > base openssl libcom_err.so. > > I'd suggest making a backup of the openssl libs (crypto, ssl), > > pkg-static and verify /rescue/tar is available, so that you have a > > recovery route. > > >=20 > Aah yes, it's no-go then if it breaks pkg(8)... >=20 > One solution that comes to my mind would be to use two-level > namespaces for symbol resolution. The first part would be the module > name and the second part the symbol name. Any shared libraries > produced by ports(7) would be required to prepend 'ports-' to the > module name. This would eliminate any possibility of dynamic symbol > clashes between ports and the base system. >=20 There is an ongoing work to enforce libcrypto/libssl from ports for anythin= g but pkg(8) we hope to be able to make that happen soon, but of cour $soon is undefined :) Best regards, Bapt --4ZVTVymsHR1TEBjP Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1 iEYEARECAAYFAlUml4YACgkQ8kTtMUmk6Ex/dwCguYazWqakOgUvI+ao0KppsqPw eIwAnAk40gETyTJ37MhO+732Y7Mvyknl =Ds5y -----END PGP SIGNATURE----- --4ZVTVymsHR1TEBjP-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 15:21:03 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 57673D34 for ; Thu, 9 Apr 2015 15:21:03 +0000 (UTC) Received: from new2-smtp.messagingengine.com (new2-smtp.messagingengine.com [66.111.4.224]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 268F9964 for ; Thu, 9 Apr 2015 15:21:03 +0000 (UTC) Received: from compute6.internal (compute6.nyi.internal [10.202.2.46]) by mailnew.nyi.internal (Postfix) with ESMTP id 742BC1C99 for ; Thu, 9 Apr 2015 11:20:58 -0400 (EDT) Received: from web3 ([10.202.2.213]) by compute6.internal (MEProxy); Thu, 09 Apr 2015 11:21:02 -0400 DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; d= messagingengine.com; h=content-transfer-encoding:content-type :date:from:in-reply-to:message-id:mime-version:references :subject:to:x-sasl-enc:x-sasl-enc; s=smtpout; bh=0pN5OL1RxtrVIWd p9esH4ncDWSw=; b=rUi/lWZe/okv+oo6wSrd6tkqUB53YUFEMeJYnipr/sUcf8p a1/N24po9KKxlA0l2Mk1CVtSjJyB/NuT4u4+XUlgQehXuATXnRgXq6bLRsdkfCMC LSCeYM70zAH1b5NN5X26wLResHKC5dFM67MoMYWx9sXFPHGUGI4XHUi7IK8w= Received: by web3.nyi.internal (Postfix, from userid 99) id 2E1ED1154B8; Thu, 9 Apr 2015 11:21:02 -0400 (EDT) Message-Id: <1428592862.2001231.251298669.2B516C1B@webmail.messagingengine.com> X-Sasl-Enc: It2s1X3GUdYBrP4lN4xFyQ3r4EmCp9ph3YVm83fswRz5 1428592862 From: Mark Felder To: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="utf-8" X-Mailer: MessagingEngine.com Webmail Interface - ajax-0b3c2300 Subject: Re: is it safe to run net/haproxy as root? Date: Thu, 09 Apr 2015 10:21:02 -0500 In-Reply-To: <20150409162707.19890da8@efreet> References: <20150409114426.0081485b@efreet> <1428588319.1982383.251264557.2FD824BC@webmail.messagingengine.com> <20150409162707.19890da8@efreet> X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 15:21:03 -0000 On Thu, Apr 9, 2015, at 09:27, Marko Cupa=C4=87 wrote: > On Thu, 09 Apr 2015 09:05:19 -0500 > Mark Felder wrote: >=20 > >=20 > >=20 > > On Thu, Apr 9, 2015, at 08:26, Mark Martinec wrote: > > >=20 > > > Perhaps the haproxy port maintainer can be persuaded to assign > > > some account entry for this purpose. > > >=20 > >=20 > > This wouldn't be a perfect solution. If you're going to be proxying > > port 80 and 443 you need to initially run as root, but perhaps by > > default in the config file we could drop privs to the haproxy user? >=20 > I am now testing proxying http(s) 80 and 443 to apache servers, but > also tcp 3306 to mysql servers. I use separate profiles (which spawn > separate instances if I understand well). >=20 > Maybe it would be good to drop http(s) to www user/group, and tcp 3306 > to mysql user/group? www user/group comes with default FreeBSD > installation, and I would need to create mysql user/group manually with > same parameters as mysql port creates them (no problem). >=20 > Does this sound reasonable? > That seems to be a solid idea for your environment. I'm working on a patch for the port that introduces an haproxy user and also installs an example config file with the uid and gid already set as well as chroot being enabled by default. That should alleviate the issue for new installations. https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D199314 From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 15:53:51 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 4AE8D92D; Thu, 9 Apr 2015 15:53:51 +0000 (UTC) Received: from mail-in-16.arcor-online.net (mail-in-16.arcor-online.net [151.189.21.56]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client CN "mx.arcor.de", Issuer "Thawte SSL CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 880EFD19; Thu, 9 Apr 2015 15:53:50 +0000 (UTC) Received: from mail-in-12-z2.arcor-online.net (mail-in-12-z2.arcor-online.net [151.189.8.29]) by mx.arcor.de (Postfix) with ESMTP id 3lN6TR2b1NzDxV; Thu, 9 Apr 2015 17:53:47 +0200 (CEST) Received: from mail-in-16.arcor-online.net (mail-in-16.arcor-online.net [151.189.21.56]) by mail-in-12-z2.arcor-online.net (Postfix) with ESMTP id 54F09CF1DD; Thu, 9 Apr 2015 17:53:47 +0200 (CEST) X-Greylist: Passed host: 188.98.158.188 X-DKIM: Sendmail DKIM Filter v2.8.2 mail-in-16.arcor-online.net 3lN6TR12TKzDxV X-Greylist: Passed host: 188.98.158.188 X-Greylist: Passed host: 188.98.158.188 Received: from lorvorc.mips.inka.de (dslb-188-098-158-188.188.098.pools.vodafone-ip.de [188.98.158.188]) by mail-in-16.arcor-online.net (Postfix) with ESMTPS id 3lN6TR12TKzDxV; Thu, 9 Apr 2015 17:53:47 +0200 (CEST) Received: from lorvorc.mips.inka.de (localhost [127.0.0.1]) by lorvorc.mips.inka.de (8.14.9/8.14.9) with ESMTP id t39FrjCW087883; Thu, 9 Apr 2015 17:53:45 +0200 (CEST) (envelope-from naddy@lorvorc.mips.inka.de) Received: (from naddy@localhost) by lorvorc.mips.inka.de (8.14.9/8.14.9/Submit) id t39Frjes087882; Thu, 9 Apr 2015 17:53:45 +0200 (CEST) (envelope-from naddy) Date: Thu, 9 Apr 2015 17:53:45 +0200 From: Christian Weisgerber To: Baptiste Daroussin Subject: Re: LibreSSL infects ports, causes problems Message-ID: <20150409155345.GA87497@lorvorc.mips.inka.de> References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20150409130521.GQ95321@ivaldir.etoilebsd.net> User-Agent: Mutt/1.5.23 (2014-03-12) Cc: freebsd-ports@freebsd.org, Bryan Drewery X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 15:53:51 -0000 Baptiste Daroussin: > Some how you have mixed up things between base openssl and libressl, when > starting to activate libressl if you are using ports only you have to be extra > careful, (same goes with ncurses or ports openssl) just installing those ports > is enough to "pollute" nearly anything you build after with a dependency on it > (well anything that does link to libssl, libcrypto) Well, yes, that's what I said. It's a bug. > If it very complicated and > error prone to cherry pick "only take base openssl here, only ports openssl > there" the only "safe" way to solve this situation and being consistent is to > always skip the version from base and enforce the version for ports. (the > otherway around is impossible - very complicated) And the addition of LibreSSL as a not-quite-equivalent alternative to ports OpenSSL makes this even more complicated. You can expect things coming out of OpenBSD (like new versions of net/openntpd) to require LibreSSL, because it includes a new library libtls that doesn't exist in OpenSSL. In the meantime, LibreSSL has removed some of the more horrific APIs of OpenSSL, which means some ports will not build against LibreSSL as is. Like python27. Fixes for these problems can be picked from the OpenBSD ports tree, if we want to. It's kind of hard to fix such problems if there is no clear policy how things are supposed to work in the first place. -- Christian "naddy" Weisgerber naddy@mips.inka.de From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 15:56:56 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 7A328BED; Thu, 9 Apr 2015 15:56:56 +0000 (UTC) Received: from mail-vn0-x22a.google.com (mail-vn0-x22a.google.com [IPv6:2607:f8b0:400c:c0f::22a]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 27A8ED51; Thu, 9 Apr 2015 15:56:56 +0000 (UTC) Received: by vnbg190 with SMTP id g190so21823027vnb.12; Thu, 09 Apr 2015 08:56:55 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:date:from:to:cc:subject:message-id:references:mime-version :content-type:content-disposition:in-reply-to:user-agent; bh=QSlOs2Gtn/pdVB79U5fPMfk7g7qRkxLGsak2jSeZ8vI=; b=q6BsQSLwipRJw0/1aDbVrn+QV29QL+UL1l7PV05tAjCxRhxV5+scrVF96Uur1cY35p HTpIkbNo3zDm7HxQOxLCoNZdGyd9u1gbFVar0Nv2ZTpNV5q3kSVvz80eN5AUzftBwdvS C77ERwSi1cF75hE2xgTTBogsjB9q+CBmM7ZjhtwTfiXbtCIRhcfTy9BkirZ8r7rzfluK /82oUoFBvN7fJWBZgurvK2hnXwgsDlzopdvCeDOih2AsYvfpG6qdSQau01l0Lem1bKFM XABtKcuahHoqK0iy4oW7Evk4KzO6YXvkj11xaJUFose/uynrSmb+AD0wKa1aiE3R7W/W FO/Q== X-Received: by 10.52.243.7 with SMTP id wu7mr18867441vdc.88.1428595015177; Thu, 09 Apr 2015 08:56:55 -0700 (PDT) Received: from ivaldir.etoilebsd.net ([2001:41d0:8:db4c::1]) by mx.google.com with ESMTPSA id hb1sm358426vdb.1.2015.04.09.08.56.52 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 08:56:53 -0700 (PDT) Sender: Baptiste Daroussin Date: Thu, 9 Apr 2015 17:56:50 +0200 From: Baptiste Daroussin To: Christian Weisgerber Subject: Re: LibreSSL infects ports, causes problems Message-ID: <20150409155649.GT95321@ivaldir.etoilebsd.net> References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="wYXww9TlNKyqAMAe" Content-Disposition: inline In-Reply-To: <20150409155345.GA87497@lorvorc.mips.inka.de> User-Agent: Mutt/1.5.23 (2014-03-12) Cc: freebsd-ports@freebsd.org, Bryan Drewery X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 15:56:56 -0000 --wYXww9TlNKyqAMAe Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Apr 09, 2015 at 05:53:45PM +0200, Christian Weisgerber wrote: > Baptiste Daroussin: >=20 > > Some how you have mixed up things between base openssl and libressl, wh= en > > starting to activate libressl if you are using ports only you have to b= e extra > > careful, (same goes with ncurses or ports openssl) just installing thos= e ports > > is enough to "pollute" nearly anything you build after with a dependenc= y on it > > (well anything that does link to libssl, libcrypto) >=20 > Well, yes, that's what I said. It's a bug. >=20 > > If it very complicated and > > error prone to cherry pick "only take base openssl here, only ports ope= nssl > > there" the only "safe" way to solve this situation and being consistent= is to > > always skip the version from base and enforce the version for ports. (t= he > > otherway around is impossible - very complicated) >=20 > And the addition of LibreSSL as a not-quite-equivalent alternative > to ports OpenSSL makes this even more complicated. You can expect > things coming out of OpenBSD (like new versions of net/openntpd) > to require LibreSSL, because it includes a new library libtls that > doesn't exist in OpenSSL. In the meantime, LibreSSL has removed > some of the more horrific APIs of OpenSSL, which means some ports > will not build against LibreSSL as is. Like python27. Fixes for > these problems can be picked from the OpenBSD ports tree, if we > want to. >=20 > It's kind of hard to fix such problems if there is no clear policy > how things are supposed to work in the first place. >=20 I'm and other are working on a policy about that: always enforce openssl fr= om ports with just a flag to say I want openssl or I want libressl but not bot= h, would apply to others libs that behave the same way but I have limited time= on this any one who wants to work on that is welcome :) Best regards, Bapt --wYXww9TlNKyqAMAe Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1 iEYEARECAAYFAlUmoUEACgkQ8kTtMUmk6Eym4QCgnEdAaGV7friMhu6td4Ax02Hl 5ogAn2R6O+hCqipjPRtSWil1n/g1FyOY =7Cij -----END PGP SIGNATURE----- --wYXww9TlNKyqAMAe-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 16:00:47 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id E0AB5CE5; Thu, 9 Apr 2015 16:00:46 +0000 (UTC) Received: from mail-ig0-x22f.google.com (mail-ig0-x22f.google.com [IPv6:2607:f8b0:4001:c05::22f]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id A37D7D96; Thu, 9 Apr 2015 16:00:46 +0000 (UTC) Received: by igblo3 with SMTP id lo3so70508241igb.1; Thu, 09 Apr 2015 09:00:46 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:in-reply-to:references:date:message-id:subject:from:to :cc:content-type; bh=faSw6xQCGuMyKJL4GfFieHRIC0nPoZI4FXYX6qoJmy8=; b=TaosYXdW2HVOM3yh05804hb16dE4GqLb9EgnKt7q8+scRYKhM/0Tr+qPfym+xMz5nc TGHMhzjBx3sr6TXa3V8fJfnxH1kgT6yZLYqNKbHJhwTDpPIYiL3pLDVk+sUgI+6RhMmY E0120GZp6OfpM+IqbK1IiuYsHL7t+9m0ZVOr54/dJcSwCyiydIUZdzwkK+Jc/9bj7nFz vyhYQ+6H5k5P3VPgM1Aj2RNqPe8x8I3Kdt25irdbX1ugWGHmKTB6Q1A3t1s6eZNoDVE5 VeFZWVuC1I6Nj5zlzbwUbofHTWeYcyFuT3+NELKCXfTn0PNsoA5yb0Qdx3IJ0h1Qy5lz YJ7g== MIME-Version: 1.0 X-Received: by 10.50.79.132 with SMTP id j4mr20900947igx.33.1428595246057; Thu, 09 Apr 2015 09:00:46 -0700 (PDT) Received: by 10.50.25.231 with HTTP; Thu, 9 Apr 2015 09:00:45 -0700 (PDT) In-Reply-To: <20150409155649.GT95321@ivaldir.etoilebsd.net> References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <20150409155649.GT95321@ivaldir.etoilebsd.net> Date: Thu, 9 Apr 2015 16:00:45 +0000 Message-ID: Subject: Re: LibreSSL infects ports, causes problems From: Loganaden Velvindron To: Baptiste Daroussin Content-Type: text/plain; charset=UTF-8 Cc: Christian Weisgerber , FreeBSD ports , Bryan Drewery X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 16:00:47 -0000 On Thu, Apr 9, 2015 at 3:56 PM, Baptiste Daroussin wrote: > On Thu, Apr 09, 2015 at 05:53:45PM +0200, Christian Weisgerber wrote: >> Baptiste Daroussin: >> >> > Some how you have mixed up things between base openssl and libressl, when >> > starting to activate libressl if you are using ports only you have to be extra >> > careful, (same goes with ncurses or ports openssl) just installing those ports >> > is enough to "pollute" nearly anything you build after with a dependency on it >> > (well anything that does link to libssl, libcrypto) >> >> Well, yes, that's what I said. It's a bug. >> >> > If it very complicated and >> > error prone to cherry pick "only take base openssl here, only ports openssl >> > there" the only "safe" way to solve this situation and being consistent is to >> > always skip the version from base and enforce the version for ports. (the >> > otherway around is impossible - very complicated) >> >> And the addition of LibreSSL as a not-quite-equivalent alternative >> to ports OpenSSL makes this even more complicated. You can expect >> things coming out of OpenBSD (like new versions of net/openntpd) >> to require LibreSSL, because it includes a new library libtls that >> doesn't exist in OpenSSL. In the meantime, LibreSSL has removed >> some of the more horrific APIs of OpenSSL, which means some ports >> will not build against LibreSSL as is. Like python27. Fixes for >> these problems can be picked from the OpenBSD ports tree, if we >> want to. >> >> It's kind of hard to fix such problems if there is no clear policy >> how things are supposed to work in the first place. >> > > I'm and other are working on a policy about that: always enforce openssl from > ports with just a flag to say I want openssl or I want libressl but not both, > would apply to others libs that behave the same way but I have limited time on > this any one who wants to work on that is welcome :) I think that we need to build up a team of people who are interested in making that happen in FreeBSD. I would be very interested to have a LibreSSL-powered FreeBSD server for production use at work. > > Best regards, > Bapt -- This message is strictly personal and the opinions expressed do not represent those of my employers, either past or present. From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 16:14:13 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id D9F5353B; Thu, 9 Apr 2015 16:14:13 +0000 (UTC) Received: from mail-vn0-x230.google.com (mail-vn0-x230.google.com [IPv6:2607:f8b0:400c:c0f::230]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 848B5FA7; Thu, 9 Apr 2015 16:14:13 +0000 (UTC) Received: by vnbf1 with SMTP id f1so23386807vnb.5; Thu, 09 Apr 2015 09:14:12 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:date:from:to:cc:subject:message-id:references:mime-version :content-type:content-disposition:in-reply-to:user-agent; bh=dKBfWjjSyN4SvR5emc5QRw0gp/8c53VC66e9+DXoTXk=; b=iEu/eS17ATp9P6Dd1XO80vtM3S+iMUd6dC0jY37gAu5ujJq+ujnBzJX/m3eRnQoYJ5 zpJS69egWNpQNNnqQBPAnsRwDCEmQxlicqYVW3FQsrEnIjTKjJJdABkut8FYi6g2Xkm6 8ItjKFwwztmbc7/Xwj3QoSa6d2WwLjXN2rZjp5Lp6ReC97ZqBuUGv4w3N5avVadd+4dq HGkneyKwess/vuIVBFqTu1oVU0k6or3KIe6TQMAcvy7oj/Ydagc9jDHofVEKKX8t9O0q ajzNXrhYvGWARV9h6PuAii5ZJvHVjy699C7MqXjLz3lrd+lXm1Wwn6m9wWTR/l5sylLF MR5A== X-Received: by 10.52.157.72 with SMTP id wk8mr24206285vdb.12.1428596052683; Thu, 09 Apr 2015 09:14:12 -0700 (PDT) Received: from ivaldir.etoilebsd.net ([2001:41d0:8:db4c::1]) by mx.google.com with ESMTPSA id p12sm2652566vds.23.2015.04.09.09.14.10 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 09:14:11 -0700 (PDT) Sender: Baptiste Daroussin Date: Thu, 9 Apr 2015 18:14:07 +0200 From: Baptiste Daroussin To: Loganaden Velvindron Subject: Re: LibreSSL infects ports, causes problems Message-ID: <20150409161407.GU95321@ivaldir.etoilebsd.net> References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <20150409155649.GT95321@ivaldir.etoilebsd.net> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="gn1ylXQ+YRNuZICZ" Content-Disposition: inline In-Reply-To: User-Agent: Mutt/1.5.23 (2014-03-12) Cc: Christian Weisgerber , FreeBSD ports , Bryan Drewery X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 16:14:13 -0000 --gn1ylXQ+YRNuZICZ Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Apr 09, 2015 at 04:00:45PM +0000, Loganaden Velvindron wrote: > On Thu, Apr 9, 2015 at 3:56 PM, Baptiste Daroussin wro= te: > > On Thu, Apr 09, 2015 at 05:53:45PM +0200, Christian Weisgerber wrote: > >> Baptiste Daroussin: > >> > >> > Some how you have mixed up things between base openssl and libressl,= when > >> > starting to activate libressl if you are using ports only you have t= o be extra > >> > careful, (same goes with ncurses or ports openssl) just installing t= hose ports > >> > is enough to "pollute" nearly anything you build after with a depend= ency on it > >> > (well anything that does link to libssl, libcrypto) > >> > >> Well, yes, that's what I said. It's a bug. > >> > >> > If it very complicated and > >> > error prone to cherry pick "only take base openssl here, only ports = openssl > >> > there" the only "safe" way to solve this situation and being consist= ent is to > >> > always skip the version from base and enforce the version for ports.= (the > >> > otherway around is impossible - very complicated) > >> > >> And the addition of LibreSSL as a not-quite-equivalent alternative > >> to ports OpenSSL makes this even more complicated. You can expect > >> things coming out of OpenBSD (like new versions of net/openntpd) > >> to require LibreSSL, because it includes a new library libtls that > >> doesn't exist in OpenSSL. In the meantime, LibreSSL has removed > >> some of the more horrific APIs of OpenSSL, which means some ports > >> will not build against LibreSSL as is. Like python27. Fixes for > >> these problems can be picked from the OpenBSD ports tree, if we > >> want to. > >> > >> It's kind of hard to fix such problems if there is no clear policy > >> how things are supposed to work in the first place. > >> > > > > I'm and other are working on a policy about that: always enforce openss= l from > > ports with just a flag to say I want openssl or I want libressl but not= both, > > would apply to others libs that behave the same way but I have limited = time on > > this any one who wants to work on that is welcome :) >=20 > I think that we need to build up a team of people who are interested > in making that happen in FreeBSD. >=20 > I would be very interested to have a LibreSSL-powered FreeBSD server > for production use at work. >=20 The thing is when you start pulling the string on this then you have to han= dle all the other cases, because ports binaries will end up with some rpath to = make sure it finds in priority things from localbase, but then if it is also lin= ked to libarchive, ncurses, etc it will grab the localbase version as well (depending on the shlib version of those) so doing the job for one of the l= ib means doing it for all others. For now candidates are: libarchive ncurses readline (which will have then to be linked to ports ncurses and not base version through the magic of fake libtermcap) openssl libedit(?) for now I do have: http://people.freebsd.org/~bapt/nobase.mk http://people.freebsd.org/~bapt/ssl.mk which will make switch from USE_OPENSSL to USES=3Dssl nobase.mk is for ncurses basically USES=3Dncurses will die and ncurses will= just become a regular LIB_DEPENDS When it becomes fun is that now all ports will have to really respect LDFLA= GS... I already found a couple of bad boys in that area. btw that should also solve some issues with python and its ncurses module. Best regards, Bapt --gn1ylXQ+YRNuZICZ Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1 iEYEARECAAYFAlUmpU8ACgkQ8kTtMUmk6EzNkACaAvXMsX3ML6JpYbkJuk5e6Mn3 ossAoIQDLVa4+2jOiimj20VsJe1pz1hY =N2uo -----END PGP SIGNATURE----- --gn1ylXQ+YRNuZICZ-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 16:26:00 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 5B200A43 for ; Thu, 9 Apr 2015 16:26:00 +0000 (UTC) Received: from freefall.freebsd.org (freefall.freebsd.org [IPv6:2001:1900:2254:206c::16:87]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 33DF113A for ; Thu, 9 Apr 2015 16:26:00 +0000 (UTC) Received: from freefall.freebsd.org (localhost [127.0.0.1]) by freefall.freebsd.org (8.14.9/8.14.9) with ESMTP id t39GPxQZ012857 for ; Thu, 9 Apr 2015 16:25:59 GMT (envelope-from bdrewery@freefall.freebsd.org) Received: (from bdrewery@localhost) by freefall.freebsd.org (8.14.9/8.14.9/Submit) id t39GPxc6012852 for freebsd-ports@freebsd.org; Thu, 9 Apr 2015 16:25:59 GMT (envelope-from bdrewery) Received: (qmail 31770 invoked from network); 9 Apr 2015 11:25:58 -0500 Received: from unknown (HELO ?10.10.1.139?) (freebsd@shatow.net@10.10.1.139) by sweb.xzibition.com with ESMTPA; 9 Apr 2015 11:25:58 -0500 Message-ID: <5526A81C.1030309@FreeBSD.org> Date: Thu, 09 Apr 2015 11:26:04 -0500 From: Bryan Drewery Organization: FreeBSD User-Agent: Mozilla/5.0 (Windows NT 6.3; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: Baptiste Daroussin , Loganaden Velvindron Subject: Re: LibreSSL infects ports, causes problems References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <20150409155649.GT95321@ivaldir.etoilebsd.net> <20150409161407.GU95321@ivaldir.etoilebsd.net> In-Reply-To: <20150409161407.GU95321@ivaldir.etoilebsd.net> OpenPGP: id=F9173CB2C3AAEA7A5C8A1F0935D771BB6E4697CF; url=http://www.shatow.net/bryan/bryan2.asc Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="OCaxqRVcLk01sx8GqUQvpuJAidMRa6gEv" Cc: Christian Weisgerber , FreeBSD ports X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 16:26:00 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --OCaxqRVcLk01sx8GqUQvpuJAidMRa6gEv Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: quoted-printable On 4/9/2015 11:14 AM, Baptiste Daroussin wrote: > On Thu, Apr 09, 2015 at 04:00:45PM +0000, Loganaden Velvindron wrote: >> On Thu, Apr 9, 2015 at 3:56 PM, Baptiste Daroussin = wrote: >>> On Thu, Apr 09, 2015 at 05:53:45PM +0200, Christian Weisgerber wrote:= >>>> Baptiste Daroussin: >>>> >>>>> Some how you have mixed up things between base openssl and libressl= , when >>>>> starting to activate libressl if you are using ports only you have = to be extra >>>>> careful, (same goes with ncurses or ports openssl) just installing = those ports >>>>> is enough to "pollute" nearly anything you build after with a depen= dency on it >>>>> (well anything that does link to libssl, libcrypto) >>>> >>>> Well, yes, that's what I said. It's a bug. >>>> >>>>> If it very complicated and >>>>> error prone to cherry pick "only take base openssl here, only ports= openssl >>>>> there" the only "safe" way to solve this situation and being consis= tent is to >>>>> always skip the version from base and enforce the version for ports= =2E (the >>>>> otherway around is impossible - very complicated) >>>> >>>> And the addition of LibreSSL as a not-quite-equivalent alternative >>>> to ports OpenSSL makes this even more complicated. You can expect >>>> things coming out of OpenBSD (like new versions of net/openntpd) >>>> to require LibreSSL, because it includes a new library libtls that >>>> doesn't exist in OpenSSL. In the meantime, LibreSSL has removed >>>> some of the more horrific APIs of OpenSSL, which means some ports >>>> will not build against LibreSSL as is. Like python27. Fixes for >>>> these problems can be picked from the OpenBSD ports tree, if we >>>> want to. >>>> >>>> It's kind of hard to fix such problems if there is no clear policy >>>> how things are supposed to work in the first place. >>>> >>> >>> I'm and other are working on a policy about that: always enforce open= ssl from >>> ports with just a flag to say I want openssl or I want libressl but n= ot both, >>> would apply to others libs that behave the same way but I have limite= d time on >>> this any one who wants to work on that is welcome :) >> >> I think that we need to build up a team of people who are interested >> in making that happen in FreeBSD. >> >> I would be very interested to have a LibreSSL-powered FreeBSD server >> for production use at work. >> > The thing is when you start pulling the string on this then you have to= handle > all the other cases, because ports binaries will end up with some rpath= to make > sure it finds in priority things from localbase, but then if it is also= linked > to libarchive, ncurses, etc it will grab the localbase version as well > (depending on the shlib version of those) so doing the job for one of t= he lib > means doing it for all others. >=20 > For now candidates are: > libarchive > ncurses > readline (which will have then to be linked to ports ncurses and not ba= se > version through the magic of fake libtermcap) > openssl > libedit(?) >=20 > for now I do have: > http://people.freebsd.org/~bapt/nobase.mk > http://people.freebsd.org/~bapt/ssl.mk >=20 > which will make switch from USE_OPENSSL to USES=3Dssl > nobase.mk is for ncurses basically USES=3Dncurses will die and ncurses = will just > become a regular LIB_DEPENDS >=20 > When it becomes fun is that now all ports will have to really respect L= DFLAGS... >=20 > I already found a couple of bad boys in that area. >=20 > btw that should also solve some issues with python and its ncurses modu= le. >=20 Peter has pointed out that OpenSSL has symbol versioning that we are not using. Enabling this in base may help the conflict issue here. Even if we force all ports to use ports OpenSSL we run into the problem you describe of loading in the base OpenSSL when linking some libraries. The versioning may avoid that. Of course that would only solve for 11.0/10.2/9.4 and not current releases. --=20 Regards, Bryan Drewery --OCaxqRVcLk01sx8GqUQvpuJAidMRa6gEv Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQEcBAEBAgAGBQJVJqgcAAoJEDXXcbtuRpfPScQH/0814Fs/byaKvi95fSRaagZf fHgJbcP6xBugKLw6ZilKPKxTqg0KYT76Q4/xpd73d26/gMp3zdAVcS2XS3IpmGu/ MCxnin45uVX0tZ9C5D+lJtmtAnwEvkUFK/81BXkXJqYOcICvO6BV7zYf5dBJTi7X hIKQGx4IrsA+zXqyomZCLVY1i2lbyfgf87PtE8srnWbLV5Ymh4dLGPRVtUhsJHJ/ PKvz3ke2iAkH3njf8kbRqBCBuQM9A+AG9MYM332JDYSfvK0zdVtzfWr/VOe/FFK1 anWWK7FsCV4gnXIEui1V86IuqkYUYwrgZ9GB+fbaWjjs56exaXKczASybzuUEfc= =y5RO -----END PGP SIGNATURE----- --OCaxqRVcLk01sx8GqUQvpuJAidMRa6gEv-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 16:26:58 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 1EA1CAE2 for ; Thu, 9 Apr 2015 16:26:58 +0000 (UTC) Received: from smtp.infracaninophile.co.uk (smtp6.infracaninophile.co.uk [IPv6:2001:8b0:151:1:3cd3:cd67:fafa:3d78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "smtp.infracaninophile.co.uk", Issuer "ca.infracaninophile.co.uk" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id A0F70150 for ; Thu, 9 Apr 2015 16:26:57 +0000 (UTC) Received: from ox-dell39.ox.adestra.com (no-reverse-dns.metronet-uk.com [85.199.232.226] (may be forged)) (authenticated bits=0) by smtp.infracaninophile.co.uk (8.15.1/8.15.1) with ESMTPSA id t39GQMn1033613 (version=TLSv1.2 cipher=DHE-RSA-AES128-SHA bits=128 verify=NO) for ; Thu, 9 Apr 2015 17:26:46 +0100 (BST) (envelope-from matthew@freebsd.org) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=none header.from=freebsd.org DKIM-Filter: OpenDKIM Filter v2.9.2 smtp.infracaninophile.co.uk t39GQMn1033613 Authentication-Results: smtp.infracaninophile.co.uk/t39GQMn1033613; dkim=none reason="no signature"; dkim-adsp=none; dkim-atps=neutral X-Authentication-Warning: lucid-nonsense.infracaninophile.co.uk: Host no-reverse-dns.metronet-uk.com [85.199.232.226] (may be forged) claimed to be ox-dell39.ox.adestra.com Message-ID: <5526A82E.3070609@freebsd.org> Date: Thu, 09 Apr 2015 17:26:22 +0100 From: Matthew Seaman User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: LibreSSL infects ports, causes problems References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <20150409155649.GT95321@ivaldir.etoilebsd.net> <20150409161407.GU95321@ivaldir.etoilebsd.net> In-Reply-To: <20150409161407.GU95321@ivaldir.etoilebsd.net> Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="Jjw29qQjRBedMVL69Dbwr1g8EpVRF4g4m" X-Virus-Scanned: clamav-milter 0.98.6 at lucid-nonsense.infracaninophile.co.uk X-Virus-Status: Clean X-Spam-Status: No, score=-2.8 required=5.0 tests=ALL_TRUSTED,AWL,BAYES_00 autolearn=ham autolearn_force=no version=3.4.0 X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on lucid-nonsense.infracaninophile.co.uk X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 16:26:58 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --Jjw29qQjRBedMVL69Dbwr1g8EpVRF4g4m Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable On 04/09/15 17:14, Baptiste Daroussin wrote: > For now candidates are: > libarchive > ncurses > readline (which will have then to be linked to ports ncurses and not ba= se > version through the magic of fake libtermcap) > openssl > libedit(?) >=20 One I noticed recently was in ftp/curl -- if you're using the ports version of OpenSSL you also have to use one of the ports versions of GSSAPI -- GSSAPI_HEIMDAL or GSSAPI_MIT, or else GSSAPI_NONE. Otherwise you can end up with two different SSL shlibs linked into the same binary. Cheers, Matthew --Jjw29qQjRBedMVL69Dbwr1g8EpVRF4g4m Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQJ8BAEBCgBmBQJVJqguXxSAAAAAAC4AKGlzc3Vlci1mcHJAbm90YXRpb25zLm9w ZW5wZ3AuZmlmdGhob3JzZW1hbi5uZXQxOUYxNTRFQ0JGMTEyRTUwNTQ0RTNGMzAw MDUxM0YxMEUwQTlFNEU3AAoJEABRPxDgqeTnMaIP/1LTT3/MIu4fPnMu4oNTJ/S2 bzJLZqH3xEMXdkBQyeZn8ZPhHJ79xF9lmWbnFnrvqL0uDP3+cPlzpTRGgUas/0Pb YEMZWxa3JFANqXR8VRvV0V/W5yh4425BWFy478z+XEy1IZHAwrw/ExJ6YeEgfKu+ cWwCbgWqnVUN2K3cxz8KCWoKlmfdPuYIhO1ctiq80gf/9VrpVyXveexZcnP1joSN gYQJR/ZF9Oj5NUOP7wXs7o1FP4WyDimDrbfgLSIQPyi/GiivI2M/XX5WzYYnowDk NrNwFVbUrtclBk9ePaYSDvDnFuWi1dozzl/QW3mnrUCZCn5chwJqqP8wkdE2UFAH bYnS8JxnLBR6Lak47xpOvXsMSRLjS16a8m2Bb49E97Mq8Q+vi6C6iV+RPBmHpqNr CA7tr8PWaE0fEejT2sbd2u1Rl2Q+MiTjhoSf9Dmts91tdv0RhhZKszkYzCVZ/Gx8 FnLiBiROt40fNhgxIX7cvWFd8wGuqAvYGmV/lO8T2jZ+URgdAcDwRuRj20wOD08q GkM3wSTdDLjbnXOoYHzwpDms4Z7OSCz/GPTW/dNJaCYB01QoA+CrgNcPvu/QHIvq h+h2Ig550M9s4xn6solX2IQkMY4ylHgZl/D04b6wumoX//1v8+MQwCXd78lCehXM aR2Hce6pw8aYfAO82nxh =H4Ge -----END PGP SIGNATURE----- --Jjw29qQjRBedMVL69Dbwr1g8EpVRF4g4m-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 17:33:14 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 04864261 for ; Thu, 9 Apr 2015 17:33:14 +0000 (UTC) Received: from mail.egr.msu.edu (boomhauer.egr.msu.edu [35.9.37.167]) by mx1.freebsd.org (Postfix) with ESMTP id CC299BD5 for ; Thu, 9 Apr 2015 17:33:12 +0000 (UTC) Received: from boomhauer (localhost [127.0.0.1]) by mail.egr.msu.edu (Postfix) with ESMTP id EF4FF3BF78 for ; Thu, 9 Apr 2015 13:33:05 -0400 (EDT) X-Virus-Scanned: amavisd-new at egr.msu.edu Received: from mail.egr.msu.edu ([127.0.0.1]) by boomhauer (boomhauer.egr.msu.edu [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 7st1WvUt9f4Z for ; Thu, 9 Apr 2015 13:33:05 -0400 (EDT) Received: from EGR authenticated sender mcdouga9 Message-ID: <5526B7D1.20607@egr.msu.edu> Date: Thu, 09 Apr 2015 13:33:05 -0400 From: Adam McDougall User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: LibreSSL infects ports, causes problems References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> In-Reply-To: <20150409155345.GA87497@lorvorc.mips.inka.de> Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 17:33:14 -0000 On 04/09/2015 11:53, Christian Weisgerber wrote: > Baptiste Daroussin: > >> Some how you have mixed up things between base openssl and libressl, when >> starting to activate libressl if you are using ports only you have to be extra >> careful, (same goes with ncurses or ports openssl) just installing those ports >> is enough to "pollute" nearly anything you build after with a dependency on it >> (well anything that does link to libssl, libcrypto) > > Well, yes, that's what I said. It's a bug. > >> If it very complicated and >> error prone to cherry pick "only take base openssl here, only ports openssl >> there" the only "safe" way to solve this situation and being consistent is to >> always skip the version from base and enforce the version for ports. (the >> otherway around is impossible - very complicated) > > And the addition of LibreSSL as a not-quite-equivalent alternative > to ports OpenSSL makes this even more complicated. You can expect > things coming out of OpenBSD (like new versions of net/openntpd) > to require LibreSSL, because it includes a new library libtls that > doesn't exist in OpenSSL. In the meantime, LibreSSL has removed > some of the more horrific APIs of OpenSSL, which means some ports > will not build against LibreSSL as is. Like python27. Fixes for > these problems can be picked from the OpenBSD ports tree, if we > want to. > Many problem reports with patches are filed already just waiting for committers and are summarized here: https://wiki.freebsd.org/LibreSSL It would be great to get at least the python27 patch committed. From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 17:56:26 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 050CB788 for ; Thu, 9 Apr 2015 17:56:26 +0000 (UTC) Received: from freefall.freebsd.org (freefall.freebsd.org [IPv6:2001:1900:2254:206c::16:87]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id D9034DE9 for ; Thu, 9 Apr 2015 17:56:25 +0000 (UTC) Received: from freefall.freebsd.org (localhost [127.0.0.1]) by freefall.freebsd.org (8.14.9/8.14.9) with ESMTP id t39HuPu8042977 for ; Thu, 9 Apr 2015 17:56:25 GMT (envelope-from bdrewery@freefall.freebsd.org) Received: (from bdrewery@localhost) by freefall.freebsd.org (8.14.9/8.14.9/Submit) id t39HuP3L042975 for ports@FreeBSD.org; Thu, 9 Apr 2015 17:56:25 GMT (envelope-from bdrewery) Received: (qmail 59080 invoked from network); 9 Apr 2015 12:56:23 -0500 Received: from unknown (HELO ?10.10.1.139?) (freebsd@shatow.net@10.10.1.139) by sweb.xzibition.com with ESMTPA; 9 Apr 2015 12:56:23 -0500 Message-ID: <5526BD4D.2040304@FreeBSD.org> Date: Thu, 09 Apr 2015 12:56:29 -0500 From: Bryan Drewery Organization: FreeBSD User-Agent: Mozilla/5.0 (Windows NT 6.3; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: Pracheth Javali , "ports@FreeBSD.org" Subject: Re: FreeBSD Port: valgrind-3.10.0.20150126_1,1 References: In-Reply-To: OpenPGP: id=F9173CB2C3AAEA7A5C8A1F0935D771BB6E4697CF; url=http://www.shatow.net/bryan/bryan2.asc Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="prxl6S7pHF1JNaVeH4cqFL1BhlbHIdJ0o" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 17:56:26 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --prxl6S7pHF1JNaVeH4cqFL1BhlbHIdJ0o Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: quoted-printable On 4/9/2015 6:17 AM, Pracheth Javali wrote: > Hey, >=20 > Is there a valgrind port for mips64/freebsd platform? >=20 There is only devel/valgrind. There is the ONLY_FOR_ARCHS line in the Makefile. I am not sure if it really is only for x86 or not. Can you remove that line and try building and see? --=20 Regards, Bryan Drewery --prxl6S7pHF1JNaVeH4cqFL1BhlbHIdJ0o Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQEcBAEBAgAGBQJVJr1OAAoJEDXXcbtuRpfPuHMIANHcesoiYsJlJDT60qPKWGS9 YXdmQlA2UOZnH083GALI5ckF2aAcDiE6ZuKB1T8MqyJkvNsFryNmNMDX9WiBc/j8 SY8KD/xFxwm6xkX+9SKQRpkjgucRpkTDwftdetmMSaZQ+Cf30VkmAvfif0AICiC2 ej1ijemeY/GA4zje0DhIdetH7PXul2ZoAqeIY0Wg17TvQLlB6YO6spVREX3TMBN5 hBjdAWm/yYADQXzeWoOVTzNm7aEjMryXSr2v3OTruA64pB77LvhNnpKuTkL7Y83Q yqalWgkV2wbFug5VSrqHiOidYIPw0e+qkRoVLdba6h0AO+7ADWqj8m37RVjal1o= =V+GT -----END PGP SIGNATURE----- --prxl6S7pHF1JNaVeH4cqFL1BhlbHIdJ0o-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 18:17:27 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 57608F42 for ; Thu, 9 Apr 2015 18:17:27 +0000 (UTC) Received: from mail-ig0-x22e.google.com (mail-ig0-x22e.google.com [IPv6:2607:f8b0:4001:c05::22e]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 1BB1091 for ; Thu, 9 Apr 2015 18:17:27 +0000 (UTC) Received: by igbqf9 with SMTP id qf9so71864601igb.1 for ; Thu, 09 Apr 2015 11:17:26 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=mime-version:in-reply-to:references:from:date:message-id:subject:to :cc:content-type; bh=iPtakvEbRNg6FUZXDotrv79Njh7X62Fi3B/gG7DSUWc=; b=OhQazDPYbTbBZFagiM0kygYfkhOo0YrfuHg7Bf5LZW1rg1xJW4GQc9AkVOH9jg32rv b+XuH6EyNune9BXzUMRXgVCT8kIg201BSRo1vmkfrVmYxUQnPgDUoAYIcMax2ClxWxR6 HzXKBxEJ2aHKQJlTl7Tqdc7yrvUytFuElHNNurB4vNQR+0Q0dHAHUyvZAGu6z4qoI5uh rC23Kr8nhxY1e5TuGYAUzj6s0SPC8qEQJmaIc3EDIzp/+OFfefrYI4NsIdxgUJ87kkgT BjaMIURXhy+d/8rU9jT7TF9I/gQgJs3eeQemC+agH2rep1b+UZyyrFQtsT+TI3qonwv3 pp6A== X-Received: by 10.50.18.49 with SMTP id t17mr22188754igd.3.1428603446147; Thu, 09 Apr 2015 11:17:26 -0700 (PDT) MIME-Version: 1.0 Received: by 10.107.136.35 with HTTP; Thu, 9 Apr 2015 11:16:55 -0700 (PDT) In-Reply-To: References: From: Gleb Popov <6yearold@gmail.com> Date: Thu, 9 Apr 2015 21:16:55 +0300 Message-ID: Subject: Re: FreeBSD Port: valgrind-3.10.0.20150126_1,1 To: Pracheth Javali Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: "ports@FreeBSD.org" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 18:17:27 -0000 On Thu, Apr 9, 2015 at 2:17 PM, Pracheth Javali wrote: > Hey, > > Is there a valgrind port for mips64/freebsd platform? > > > Regards, > Pracheth > > > > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > Our intelligence reports there is an development repo: https://bitbucket.org/stass/valgrind-freebsd/ From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 18:31:51 2015 Return-Path: Delivered-To: ports@FreeBSD.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id F12972B7; Thu, 9 Apr 2015 18:31:51 +0000 (UTC) Received: from biertje.skysmurf.nl (unknown [IPv6:2001:984:78b5:1:21b:78ff:fea8:3f22]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 880B726B; Thu, 9 Apr 2015 18:31:51 +0000 (UTC) Received: from biertje.skysmurf.nl (localhost [127.0.0.1]) by biertje.skysmurf.nl (8.14.9/8.14.9) with ESMTP id t39IVlZh036498; Thu, 9 Apr 2015 20:31:47 +0200 (CEST) (envelope-from fonz@biertje.skysmurf.nl) Received: (from fonz@localhost) by biertje.skysmurf.nl (8.14.9/8.14.9/Submit) id t39IVlWn036497; Thu, 9 Apr 2015 20:31:47 +0200 (CEST) (envelope-from fonz) Date: Thu, 9 Apr 2015 20:31:47 +0200 From: "A.J. \"Fonz\" van Werven" To: Bryan Drewery Subject: Re: FreeBSD Port: valgrind-3.10.0.20150126_1,1 Message-ID: <20150409183147.GA36468@biertje.skysmurf.nl> References: <5526BD4D.2040304@FreeBSD.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="RnlQjJ0d97Da+TV1" Content-Disposition: inline In-Reply-To: <5526BD4D.2040304@FreeBSD.org> User-Agent: Mutt/1.5.23 (2014-03-12) Cc: "ports@FreeBSD.org" , Pracheth Javali X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 18:31:52 -0000 --RnlQjJ0d97Da+TV1 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Bryan Drewery wrote: >> Is there a valgrind port for mips64/freebsd platform? >=20 > There is only devel/valgrind. There is the ONLY_FOR_ARCHS line in the > Makefile. There's also devel/valgrind-devel ;-) But it has the same ONLY_FOR_ARCHS line. Unfortunately both are unmaintained, but perhaps whoever maintained these ports when that line appeared might know more. If I'm not mistaken the most recent version of Valgrind has Linux mips64 support, but FreeBSD mips64 support is probably experimental at best. AvW --=20 I'm not completely useless, I can be used as a bad example. --RnlQjJ0d97Da+TV1 Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v2 iQIcBAEBCAAGBQJVJsWSAAoJEAfP7gJTaCe8gzQQAMShtyU60zMXcScdc+v7FwQ3 zN0y82DL5ZH2pXTzsihvYsWc7+hPQRJzjZf9JeHTnjf/dGzIGD9mqjqCaT6m8kQz bjSgDDNVa6RXUY+RMRaMX50dbhqUKwi4VMlBoexX9P7yhe1yBAc4B19wNGsRRklu 53mMyCKS8c5EK3JgVcOwimQJj0czirRUPb2QfbxzWRG4+bpBE/Gmsptva2HsZU/t udEw+ebwG6150f6hMCTDgCuG9l70IXdQjiNNAsqqZnmJHUo309sCSKkZ8sbPzzKU fEybGsuh29HFnuhVHMU90NmE87xBVbHnb7linNiS2sADqXlZsFjMGFby0GQcU7U4 vi3xDD9IABR5lVcpJaNkOYT33xTaw/Rx2zWSYhthZfRyX2ygu3m1gxksasy2y3fF S9bhS+FcNnIqfvZ39EmPzHMyidDjyln26RyoUuCdu/cpeFeUy9X+GhKvinWbV0lS YCaO5hxoHRZi0CEh8wAof3oauB4mYnww5fyy63QwEOFrFqIDK/0Es6RYjsdhOy2N 5Tzash9vuCeKbMZayl9CwQbpH4TfJKwQY8iC+jfXvQygicI/R0CqLA2OA70EILw3 6Lp1bwiHUHSnjigniiRJwjpi06GOki+hecLO0XgRLX0LFCKYIqWU8xwzilUbNTRd Gg7nSVPOMqu5t5wYT5Py =ghsn -----END PGP SIGNATURE----- --RnlQjJ0d97Da+TV1-- From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 19:54:28 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id B74EFD13 for ; Thu, 9 Apr 2015 19:54:28 +0000 (UTC) Received: from mail.grem.de (outcast.grem.de [213.239.217.27]) by mx1.freebsd.org (Postfix) with SMTP id 21F56FB4 for ; Thu, 9 Apr 2015 19:54:27 +0000 (UTC) Received: (qmail 10701 invoked by uid 89); 9 Apr 2015 19:54:18 -0000 Received: from unknown (HELO ?10.83.193.212?) (mg@grem.de@109.43.2.74) by mail.grem.de with ESMTPA; 9 Apr 2015 19:54:18 -0000 Content-Type: text/plain; charset=us-ascii Mime-Version: 1.0 (1.0) Subject: Re: LibreSSL infects ports, causes problems From: Michael Gmelin X-Mailer: iPhone Mail (12F70) In-Reply-To: <5526B7D1.20607@egr.msu.edu> Date: Thu, 9 Apr 2015 21:54:17 +0200 Content-Transfer-Encoding: quoted-printable Message-Id: References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <5526B7D1.20607@egr.msu.edu> To: Adam McDougall Cc: "freebsd-ports@freebsd.org" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 19:54:28 -0000 > On 09 Apr 2015, at 19:33, Adam McDougall wrote: >=20 >> On 04/09/2015 11:53, Christian Weisgerber wrote: >> Baptiste Daroussin: >>=20 >>> Some how you have mixed up things between base openssl and libressl, whe= n >>> starting to activate libressl if you are using ports only you have to be= extra >>> careful, (same goes with ncurses or ports openssl) just installing those= ports >>> is enough to "pollute" nearly anything you build after with a dependency= on it >>> (well anything that does link to libssl, libcrypto) >>=20 >> Well, yes, that's what I said. It's a bug. >>=20 >>> If it very complicated and >>> error prone to cherry pick "only take base openssl here, only ports open= ssl >>> there" the only "safe" way to solve this situation and being consistent i= s to >>> always skip the version from base and enforce the version for ports. (th= e >>> otherway around is impossible - very complicated) >>=20 >> And the addition of LibreSSL as a not-quite-equivalent alternative >> to ports OpenSSL makes this even more complicated. You can expect >> things coming out of OpenBSD (like new versions of net/openntpd) >> to require LibreSSL, because it includes a new library libtls that >> doesn't exist in OpenSSL. In the meantime, LibreSSL has removed >> some of the more horrific APIs of OpenSSL, which means some ports >> will not build against LibreSSL as is. Like python27. Fixes for >> these problems can be picked from the OpenBSD ports tree, if we >> want to. >=20 > Many problem reports with patches are filed already just waiting for > committers and are summarized here: https://wiki.freebsd.org/LibreSSL > It would be great to get at least the python27 patch committed. The patches proposed are not sufficient in all cases though. > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 21:17:11 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id E92F9283; Thu, 9 Apr 2015 21:17:11 +0000 (UTC) Received: from wonkity.com (wonkity.com [67.158.26.137]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "wonkity.com", Issuer "wonkity.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 906E6CA2; Thu, 9 Apr 2015 21:17:11 +0000 (UTC) Received: from wonkity.com (localhost [127.0.0.1]) by wonkity.com (8.14.9/8.14.9) with ESMTP id t39LH9J5030104 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Thu, 9 Apr 2015 15:17:09 -0600 (MDT) (envelope-from wblock@wonkity.com) Received: from localhost (wblock@localhost) by wonkity.com (8.14.9/8.14.9/Submit) with ESMTP id t39LH9Sp030101; Thu, 9 Apr 2015 15:17:09 -0600 (MDT) (envelope-from wblock@wonkity.com) Date: Thu, 9 Apr 2015 15:17:09 -0600 (MDT) From: Warren Block To: Matthew Seaman Subject: Re: LibreSSL infects ports, causes problems In-Reply-To: <5526A82E.3070609@freebsd.org> Message-ID: References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <20150409155649.GT95321@ivaldir.etoilebsd.net> <20150409161407.GU95321@ivaldir.etoilebsd.net> <5526A82E.3070609@freebsd.org> User-Agent: Alpine 2.20 (BSF 67 2015-01-07) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed X-Greylist: Sender IP whitelisted, not delayed by milter-greylist-4.4.3 (wonkity.com [127.0.0.1]); Thu, 09 Apr 2015 15:17:09 -0600 (MDT) Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 21:17:12 -0000 On Thu, 9 Apr 2015, Matthew Seaman wrote: > On 04/09/15 17:14, Baptiste Daroussin wrote: >> For now candidates are: >> libarchive >> ncurses >> readline (which will have then to be linked to ports ncurses and not base >> version through the magic of fake libtermcap) >> openssl >> libedit(?) >> > > One I noticed recently was in ftp/curl -- if you're using the ports > version of OpenSSL you also have to use one of the ports versions of > GSSAPI -- GSSAPI_HEIMDAL or GSSAPI_MIT, or else GSSAPI_NONE. > Otherwise you can end up with two different SSL shlibs linked into the > same binary. That broke VirtualBox with some very weird and inconsistent symptoms: https://lists.freebsd.org/pipermail/freebsd-emulation/2015-March/012402.html From owner-freebsd-ports@FreeBSD.ORG Thu Apr 9 22:49:46 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id F02F459A; Thu, 9 Apr 2015 22:49:45 +0000 (UTC) Received: from mail-vn0-x22a.google.com (mail-vn0-x22a.google.com [IPv6:2607:f8b0:400c:c0f::22a]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 9A5A395A; Thu, 9 Apr 2015 22:49:45 +0000 (UTC) Received: by vnbg1 with SMTP id g1so453829vnb.2; Thu, 09 Apr 2015 15:49:44 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=sender:date:from:to:cc:subject:message-id:references:mime-version :content-type:content-disposition:in-reply-to:user-agent; bh=DWPSCTzxCq9Ocez3O7sg5V1HxMHnbqEQk1n6dvAZ8hw=; b=A9fm1pLjBgcrxIxT+I72DfkqfV1sjqhi2WrhAZS6UEgkzD/8lFiNUR2XMWE1slq/UB WYVmiRNISOzqY2OT/J8OXkUL6QQzPRzZ0DnUwQyDHEJ888X4245xykDmkEr1wSfh4TaD WSKFicFuKvg4pJl2SgfsYLFVQ+ZXBTmCBY1p6G9Ogyu+GdH/iZ3YgS+c1tRmHEG51AZm 3Cv7dbarMJlNqdnDI8ovhYNZeBsHOPhsixuAttMzRTVsRHfn3Fg1voAZvAN5RL6vhij7 5oTN+gUBEPYATpYpNd3d6B0Pq30YRvv9CEWd1vtw4jAm36iwU6aDWkXDnWR6zd4l/bbZ 3GoQ== X-Received: by 10.52.243.41 with SMTP id wv9mr25768941vdc.20.1428619784744; Thu, 09 Apr 2015 15:49:44 -0700 (PDT) Received: from ivaldir.etoilebsd.net ([2001:41d0:8:db4c::1]) by mx.google.com with ESMTPSA id ad5sm29048vdc.13.2015.04.09.15.49.42 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 15:49:43 -0700 (PDT) Sender: Baptiste Daroussin Date: Fri, 10 Apr 2015 00:49:39 +0200 From: Baptiste Daroussin To: Warren Block Subject: Re: LibreSSL infects ports, causes problems Message-ID: <20150409224939.GV95321@ivaldir.etoilebsd.net> References: <5525E609.70402@FreeBSD.org> <20150409115942.GA81282@lorvorc.mips.inka.de> <20150409130521.GQ95321@ivaldir.etoilebsd.net> <20150409155345.GA87497@lorvorc.mips.inka.de> <20150409155649.GT95321@ivaldir.etoilebsd.net> <20150409161407.GU95321@ivaldir.etoilebsd.net> <5526A82E.3070609@freebsd.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="MLcyhLwX/7AHNQNx" Content-Disposition: inline In-Reply-To: User-Agent: Mutt/1.5.23 (2014-03-12) Cc: Matthew Seaman , freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 09 Apr 2015 22:49:46 -0000 --MLcyhLwX/7AHNQNx Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Thu, Apr 09, 2015 at 03:17:09PM -0600, Warren Block wrote: > On Thu, 9 Apr 2015, Matthew Seaman wrote: >=20 > > On 04/09/15 17:14, Baptiste Daroussin wrote: > >> For now candidates are: > >> libarchive > >> ncurses > >> readline (which will have then to be linked to ports ncurses and not b= ase > >> version through the magic of fake libtermcap) > >> openssl > >> libedit(?) > >> > > > > One I noticed recently was in ftp/curl -- if you're using the ports > > version of OpenSSL you also have to use one of the ports versions of > > GSSAPI -- GSSAPI_HEIMDAL or GSSAPI_MIT, or else GSSAPI_NONE. > > Otherwise you can end up with two different SSL shlibs linked into the > > same binary. >=20 > That broke VirtualBox with some very weird and inconsistent symptoms: > https://lists.freebsd.org/pipermail/freebsd-emulation/2015-March/012402.h= tml Yup some people will probably be unhappy to see new dependencies for those things, but that would for sure solve a lot more problem than it causes and makes life easier for all maintainers. Best regards, Bapt --MLcyhLwX/7AHNQNx Content-Type: application/pgp-signature -----BEGIN PGP SIGNATURE----- Version: GnuPG v1 iEYEARECAAYFAlUnAgMACgkQ8kTtMUmk6EzFNQCfaYnb/ztoW9t+jmNvz0fJAHRJ zPUAn2vgJNbMja2oVaY2kSVRKRALu51E =l9aw -----END PGP SIGNATURE----- --MLcyhLwX/7AHNQNx-- From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 00:35:18 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 31C0C930 for ; Fri, 10 Apr 2015 00:35:18 +0000 (UTC) Received: from mail14.tpgi.com.au (mail14.tpgi.com.au [203.12.160.182]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.tpg.com.au", Issuer "RapidSSL CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id B038161B for ; Fri, 10 Apr 2015 00:35:16 +0000 (UTC) X-TPG-Junk-Status: Message not scanned X-TPG-Antivirus: Passed X-TPG-Abuse: host=[202.161.115.54]; ip=202.161.115.54; date=Fri, 10 Apr 2015 10:35:05 +1000 Received: from fish.ish.com.au (202-161-115-54.static.tpgi.com.au [202.161.115.54] (may be forged)) by mail14.tpgi.com.au (envelope-from ari@ish.com.au) (8.14.3/8.14.3) with ESMTP id t3A0Z3gL013076 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-SHA bits=256 verify=NO) for ; Fri, 10 Apr 2015 10:35:05 +1000 Received: from ip-211.ish.com.au ([203.29.62.211]:37745 helo=ish.com.au) by fish.ish.com.au with esmtp (Exim 4.82_1-5b7a7c0-XX) (envelope-from ) id 1YgMuT-00009O-1g for freebsd-ports@freebsd.org; Fri, 10 Apr 2015 10:35:01 +1000 Received: from [203.29.62.136] (HELO ip-136.ish.com.au) by ish.com.au (CommuniGate Pro SMTP 6.1.2) with ESMTPS id 18042258 for freebsd-ports@freebsd.org; Fri, 10 Apr 2015 10:35:01 +1000 Subject: Re: openssl and bash libcrypto To: FreeBSD Mailing List references: <552657AC.1020802@ish.com.au> From: Aristedes Maniatis x-enigmail-draft-status: N1110 message-id: <55271AB5.8020907@ish.com.au> Date: Fri, 10 Apr 2015 10:35:01 +1000 user-agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:38.0) Gecko/20100101 Thunderbird/38.0 mime-version: 1.0 in-reply-to: <552657AC.1020802@ish.com.au> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 00:35:18 -0000 -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA1 On 9/04/2015 8:42pm, Aristedes Maniatis wrote: > Starting in the last week or so, several different applications are exhibiting the same symptoms of broken libcrypto libraries. Thanks everyone for your ideas. Before I start hacking away at the system to remove openssl from the base, can anyone help clarify what I'm seeing in the backtrace? > #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/libcrypto.so.8 > #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7 Am I right in assuming /lib/libcrypto.so.7 is installed by openssl in the base OS? And /usr/local/lib/libcrypto.so.8 from openssl in ports? How do they get to call each other like this? My base system is from freebsd-update binary installs, not compiled by me. The poudriere jail is also updated to the latest 10.1 patch. /lib/libcrypto.so.7 is from 2 April which is roughly when all this started happening. But if that file was broken in the latest FreeBSD updates, everyone running FreeBSD would be complaining right now. So there has to be something unusual about my systems (I've reproduced this on two different installations) or the way I build openssl from ports. I can reproduce the problem in /usr/bin/vi from the base system. Again, the bt looks like this: #0 0x0000000802ffcfe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/libcrypto.so.8 [New LWP 101914] (gdb) bt #0 0x0000000802ffcfe5 in OPENSSL_ia32_cpuid () from /usr/local/lib/libcrypto.so.8 #1 0x0000000803a010b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7 #2 0x000000080390784e in _init () from /lib/libcrypto.so.7 #3 0x00007fffffffcf00 in ?? () #4 0x00000008006656bf in r_debug_state () from /libexec/ld-elf.so.1 #5 0x0000000800669d87 in _rtld_get_stack_prot () from /libexec/ld-elf.so.1 #6 0x0000000800666ad3 in dlopen () from /libexec/ld-elf.so.1 #7 0x0000000800dfa436 in _nsdbtaddsrc () from /lib/libc.so.7 #8 0x0000000800df43c9 in _nsyyparse () from /lib/libc.so.7 #9 0x0000000800dfaab1 in nsdispatch () from /lib/libc.so.7 #10 0x0000000800de7ebe in getpwuid () from /lib/libc.so.7 #11 0x0000000800de7cbf in getpwnam () from /lib/libc.so.7 Maybe what I really need to do now is recompile everything against base openssl and remove the openssl port from my system completely. Or do people have better ideas? Thanks Ari - -- - --------------------------> Aristedes Maniatis ish http://www.ish.com.au Level 1, 30 Wilson Street Newtown 2042 Australia phone +61 2 9550 5001 fax +61 2 9550 4001 GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A -----BEGIN PGP SIGNATURE----- iEYEARECAAYFAlUnGrUACgkQ72p9Lj5JECo1NgCeP6NSHvJas88SEA4jc9zsbvdf G9YAmwQqqsuATUCYkiR36WXLIL565fhH =6VrH -----END PGP SIGNATURE----- From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 00:52:13 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id A4688F23 for ; Fri, 10 Apr 2015 00:52:13 +0000 (UTC) Received: from mail-vn0-f53.google.com (mail-vn0-f53.google.com [209.85.216.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 5F7A3847 for ; Fri, 10 Apr 2015 00:52:12 +0000 (UTC) Received: by vnbg1 with SMTP id g1so1200780vnb.2 for ; Thu, 09 Apr 2015 17:52:11 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20130820; h=x-gm-message-state:mime-version:in-reply-to:references:date :message-id:subject:from:to:cc:content-type; bh=oDX27tdW1hn1Ts4NYrITC96gE/gwxvS2u5X+LheQ8Zg=; b=F7+TtUhr73E+fl4uF9/nNbWO0Lj1OiLpF6ooDD3gZpdSje6cOKXYAlry6T4BFpNBPJ keV3Zhf1Buc1GmBqisTDw2NlBOpHsJXYoK/D5jLInyqpo7x1vOTih87F7TVCIgKkbIbE SxGi2AE+GQYQQbQjg1O5tlHvnp7NDpQ1qEjTONAFJ1GZspw45LZMlGMeGKLVXAE7XcRK Z5i/n4P93PLRqELb3f8nVSx6kArQSPw3DOXp+ji51FMGsryf4UPh7KOsCJE2QaFpHy1o yiPhE+2GHWXsBV1Xfs57yBbhBgFH9yFH4r3UEBrh8sgX75/wWhzQqBPd/Mr3F/Mox4BG clBw== X-Gm-Message-State: ALoCoQlZRz6Y9u6IaIX6koQ04mmKRVVPbBMPb8MAAvZODCy1udETypPkMZ20QuTEt7yh2PsnaK3v MIME-Version: 1.0 X-Received: by 10.60.37.166 with SMTP id z6mr42049279oej.63.1428626685088; Thu, 09 Apr 2015 17:44:45 -0700 (PDT) Received: by 10.76.147.134 with HTTP; Thu, 9 Apr 2015 17:44:45 -0700 (PDT) Received: by 10.76.147.134 with HTTP; Thu, 9 Apr 2015 17:44:45 -0700 (PDT) In-Reply-To: <55271AB5.8020907@ish.com.au> References: <552657AC.1020802@ish.com.au> <55271AB5.8020907@ish.com.au> Date: Thu, 9 Apr 2015 19:44:45 -0500 Message-ID: Subject: Re: openssl and bash libcrypto From: Matthew Donovan To: Aristedes Maniatis Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: freebsd-ports X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 00:52:13 -0000 This conversation is happening in another post. The issue is that Libressl is being seen first. On Apr 9, 2015 7:35 PM, "Aristedes Maniatis" wrote: > -----BEGIN PGP SIGNED MESSAGE----- > Hash: SHA1 > > On 9/04/2015 8:42pm, Aristedes Maniatis wrote: > > Starting in the last week or so, several different applications are > exhibiting the same symptoms of broken libcrypto libraries. > > Thanks everyone for your ideas. Before I start hacking away at the system > to remove openssl from the base, can anyone help clarify what I'm seeing in > the backtrace? > > > #0 0x00000008029cafe5 in OPENSSL_ia32_cpuid () from > /usr/local/lib/libcrypto.so.8 > > #1 0x00000008033cf0b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7 > > Am I right in assuming /lib/libcrypto.so.7 is installed by openssl in the > base OS? And /usr/local/lib/libcrypto.so.8 from openssl in ports? > > How do they get to call each other like this? My base system is from > freebsd-update binary installs, not compiled by me. The poudriere jail is > also updated to the latest 10.1 patch. > > /lib/libcrypto.so.7 is from 2 April which is roughly when all this started > happening. But if that file was broken in the latest FreeBSD updates, > everyone running FreeBSD would be complaining right now. So there has to be > something unusual about my systems (I've reproduced this on two different > installations) or the way I build openssl from ports. > > > I can reproduce the problem in /usr/bin/vi from the base system. Again, > the bt looks like this: > > #0 0x0000000802ffcfe5 in OPENSSL_ia32_cpuid () from > /usr/local/lib/libcrypto.so.8 > [New LWP 101914] > (gdb) bt > #0 0x0000000802ffcfe5 in OPENSSL_ia32_cpuid () from > /usr/local/lib/libcrypto.so.8 > #1 0x0000000803a010b9 in OPENSSL_ia32cap_loc () from /lib/libcrypto.so.7 > #2 0x000000080390784e in _init () from /lib/libcrypto.so.7 > #3 0x00007fffffffcf00 in ?? () > #4 0x00000008006656bf in r_debug_state () from /libexec/ld-elf.so.1 > #5 0x0000000800669d87 in _rtld_get_stack_prot () from /libexec/ld-elf.so.1 > #6 0x0000000800666ad3 in dlopen () from /libexec/ld-elf.so.1 > #7 0x0000000800dfa436 in _nsdbtaddsrc () from /lib/libc.so.7 > #8 0x0000000800df43c9 in _nsyyparse () from /lib/libc.so.7 > #9 0x0000000800dfaab1 in nsdispatch () from /lib/libc.so.7 > #10 0x0000000800de7ebe in getpwuid () from /lib/libc.so.7 > #11 0x0000000800de7cbf in getpwnam () from /lib/libc.so.7 > > > Maybe what I really need to do now is recompile everything against base > openssl and remove the openssl port from my system completely. Or do people > have better ideas? > > Thanks > > > Ari > > > - -- > - --------------------------> > Aristedes Maniatis > ish > http://www.ish.com.au > Level 1, 30 Wilson Street Newtown 2042 Australia > phone +61 2 9550 5001 fax +61 2 9550 4001 > GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A > -----BEGIN PGP SIGNATURE----- > > iEYEARECAAYFAlUnGrUACgkQ72p9Lj5JECo1NgCeP6NSHvJas88SEA4jc9zsbvdf > G9YAmwQqqsuATUCYkiR36WXLIL565fhH > =6VrH > -----END PGP SIGNATURE----- > _______________________________________________ > freebsd-ports@freebsd.org mailing list > http://lists.freebsd.org/mailman/listinfo/freebsd-ports > To unsubscribe, send any mail to "freebsd-ports-unsubscribe@freebsd.org" > From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 00:59:20 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 201ED18C for ; Fri, 10 Apr 2015 00:59:20 +0000 (UTC) Received: from hermes.heuristicsystems.com.au (hermes.heuristicsystems.com.au [203.41.22.115]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client CN "hermes.heuristicsystems.com.au", Issuer "Heuristic Systems Type 4 Host CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 89568891 for ; Fri, 10 Apr 2015 00:59:18 +0000 (UTC) Received: from [10.0.5.3] (ewsw01.hs [10.0.5.3]) (authenticated bits=0) by hermes.heuristicsystems.com.au (8.14.5/8.13.6) with ESMTP id t3A0wDqA072154 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES128-SHA bits=128 verify=NOT) for ; Fri, 10 Apr 2015 10:58:21 +1000 (EST) (envelope-from dewayne.geraghty@heuristicsystems.com.au) Message-ID: <55272022.2050307@heuristicsystems.com.au> Date: Fri, 10 Apr 2015 10:58:10 +1000 From: Dewayne Geraghty User-Agent: Mozilla/5.0 (Windows NT 6.1; rv:31.0) Gecko/20100101 Thunderbird/31.5.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: openssl and bash libcrypto References: <552657AC.1020802@ish.com.au> <55271AB5.8020907@ish.com.au> In-Reply-To: <55271AB5.8020907@ish.com.au> Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 00:59:20 -0000 Ari, Yes, /lib/libcrypto.so.7 is part of the base openssl. I can't help with questions involving poudriere or freebsd-update as I don't use them, though we do use jails to build different architectures and CPU types. It isn't true that openssl in base or openssl in ports is calling the other. Most likely there was a port build that required openssl port, and also required something like libarchive or libfetch (for example), both require openssl base (I've found net-mgmt/net-snmp does this). Your bt reveals that the symbol table is confused, as expected. If you use pouderie and freebsd-update, you should probably work with the developers to identify the cause, so a fresh start might assist that end. Document the sequence and what you do so it can be reviewed. :) From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 01:48:14 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 02511ADF for ; Fri, 10 Apr 2015 01:48:14 +0000 (UTC) Received: from mail16.tpgi.com.au (mail16.tpgi.com.au [203.12.160.231]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.tpg.com.au", Issuer "RapidSSL CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 7E3FED40 for ; Fri, 10 Apr 2015 01:48:12 +0000 (UTC) X-TPG-Junk-Status: Message not scanned X-TPG-Antivirus: Passed X-TPG-Abuse: host=[202.161.115.54]; ip=202.161.115.54; date=Fri, 10 Apr 2015 11:48:03 +1000 Received: from fish.ish.com.au (202-161-115-54.static.tpgi.com.au [202.161.115.54] (may be forged)) by mail16.tpgi.com.au (envelope-from ari@ish.com.au) (8.14.3/8.14.3) with ESMTP id t3A1m0xE006029 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-SHA bits=256 verify=NO) for ; Fri, 10 Apr 2015 11:48:03 +1000 Received: from ip-211.ish.com.au ([203.29.62.211]:16906 helo=ish.com.au) by fish.ish.com.au with esmtp (Exim 4.82_1-5b7a7c0-XX) (envelope-from ) id 1YgO2v-00041c-2B for freebsd-ports@freebsd.org; Fri, 10 Apr 2015 11:47:50 +1000 Received: from [203.29.62.136] (HELO ip-136.ish.com.au) by ish.com.au (CommuniGate Pro SMTP 6.1.2) with ESMTPS id 18042291 for freebsd-ports@freebsd.org; Fri, 10 Apr 2015 11:47:49 +1000 Subject: Re: openssl and bash libcrypto references: <552657AC.1020802@ish.com.au> <55271AB5.8020907@ish.com.au> From: Aristedes Maniatis x-enigmail-draft-status: N1110 To: freebsd-ports message-id: <55272BC5.8090805@ish.com.au> Date: Fri, 10 Apr 2015 11:47:49 +1000 user-agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:38.0) Gecko/20100101 Thunderbird/38.0 mime-version: 1.0 in-reply-to: Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 01:48:14 -0000 Dewayne Geraghty wrote: > Most likely there was a port build that required openssl port, and also required > something like libarchive or libfetch (for example), both require openssl base > (I've found net-mgmt/net-snmp does this). Your bt reveals that the symbol table > is confused, as expected. Ah, that's a good help. So I can easily core dump /usr/bin/vi by trying to edit any file. Forgive my ignorance of C debugging, but I'll stumble through this: 1. I attach gdb to the application and load the core dump. 2. It tries to read symbols from a bunch of system libraries. 3. In amongst all those libraries are some located in /usr/local: /usr/local/lib/nss_ldap.so.1 /usr/local/lib/libldap-2.4.so.2 /usr/local/lib/liblber-2.4.so.2 /usr/local/lib/libssl.so.8 /usr/local/lib/libcrypto.so.8 So the whole chain of problems originates from nss_ldap. But I'm confused about what I'm looking at here.. Did vi try to load some access control library when it tried to write a file out to disk, and then that loaded nsswitch which in turn I've tied into the nss_ldap port, and then from there it was a slippery slope to disaster of conflicting libraries? I'll try building nss_ldap against base openssl and see if that helps, but can someone help explain the naming here. Why do we have /usr/local/lib/libcrypto.so.8 but lib/libcrypto.so.7. Was this done when the openssl port moved from 1.0.1 to 1.0.2? Isn't there usually a warning in UPDATING when we need to rebuild all ports for that reason? If all ports move to only use openssl from ports, then how does my example above get fixed? Doesn't it make it all worse? So many questions! Thanks for all the help in understanding this. Ari -- --------------------------> Aristedes Maniatis ish http://www.ish.com.au Level 1, 30 Wilson Street Newtown 2042 Australia phone +61 2 9550 5001 fax +61 2 9550 4001 GPG fingerprint CBFB 84B4 738D 4E87 5E5C 5EFA EF6A 7D2E 3E49 102A From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 03:12:55 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 8FB56C0C; Fri, 10 Apr 2015 03:12:55 +0000 (UTC) Received: from mail-vn0-x22e.google.com (mail-vn0-x22e.google.com [IPv6:2607:f8b0:400c:c0f::22e]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4510F991; Fri, 10 Apr 2015 03:12:55 +0000 (UTC) Received: by vnbf1 with SMTP id f1so2020418vnb.5; Thu, 09 Apr 2015 20:12:54 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20120113; h=message-id:date:from:user-agent:mime-version:to:cc:subject :content-type:content-transfer-encoding; bh=T42SqLN9JLh625eayFNxGo6S8FTuzUaHIczyH0iPK3I=; b=DccFrDrdbUpM63bU7UZlYjTUxjEqsJRUATHDxVbvuujkuSSXV0re0qZcsnK8ySaXVG kOJwLAKjE/4C4F9hhAFznjiEajtD3E9QzNgFGpDcCzKlJtVanv+2ClR0Ehtr73DjeSd4 TwApsT7nQX8Ur0g1J7dqBE181xmk6lcErA8UIjhIKkSpHWIeidLVpjmRQhuPHXUpVqQK O1pyrykyLZcBMBAmwMUrzqe3sgE6213oOPMhAq3N2hEdcZNyJvR9SujreGZ+XoX6pyg+ /S356+vOnFQJbYyXTRkTHao1p9S632BqOIXPfEzrCqrg3NkrQSL6ewZrwJaZcPnlEEkT SoxQ== X-Received: by 10.52.24.113 with SMTP id t17mr6640415vdf.89.1428635574308; Thu, 09 Apr 2015 20:12:54 -0700 (PDT) Received: from [10.137.1.6] (108-61-57-43ch.openskytelcom.net. [108.61.57.43]) by mx.google.com with ESMTPSA id hb1sm139263vdb.1.2015.04.09.20.12.53 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128); Thu, 09 Apr 2015 20:12:53 -0700 (PDT) Message-ID: <55273FB2.4080105@gmail.com> Date: Thu, 09 Apr 2015 23:12:50 -0400 From: Mike User-Agent: Mozilla/5.0 (Windows NT 6.3; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: jlh@FreeBSD.org Subject: FreeBSD Port: subsonic-standalone-5.2 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Cc: ports@FreeBSD.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 03:12:55 -0000 Hi. I love that you have a updated version of subsonic. Subsonic is opensource as you know but also is a paid application. But since its OSS there is a fork of it that is the full version with all features. The repo for the fully free version is: https://github.com/EugeneKay/subsonic It would be great to have this as the subsonic port or possibly another subsonic-standalon-free port. Thanks! -Mike From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 07:07:41 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 988D4FB2 for ; Fri, 10 Apr 2015 07:07:41 +0000 (UTC) Received: from hermes.heuristicsystems.com.au (hermes.heuristicsystems.com.au [203.41.22.115]) (using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits)) (Client CN "hermes.heuristicsystems.com.au", Issuer "Heuristic Systems Type 4 Host CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id CB01C24B for ; Fri, 10 Apr 2015 07:07:39 +0000 (UTC) Received: from [10.0.5.3] (ewsw01.hs [10.0.5.3]) (authenticated bits=0) by hermes.heuristicsystems.com.au (8.14.5/8.13.6) with ESMTP id t3A76ZhK082430 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES128-SHA bits=128 verify=NOT) for ; Fri, 10 Apr 2015 17:06:40 +1000 (EST) (envelope-from dewayne.geraghty@heuristicsystems.com.au) Message-ID: <5527769D.3060505@heuristicsystems.com.au> Date: Fri, 10 Apr 2015 17:07:09 +1000 From: Dewayne Geraghty User-Agent: Mozilla/5.0 (Windows NT 6.1; rv:31.0) Gecko/20100101 Thunderbird/31.5.0 MIME-Version: 1.0 To: freebsd-ports@freebsd.org Subject: Re: openssl and bash libcrypto References: <552657AC.1020802@ish.com.au> <55271AB5.8020907@ish.com.au> <55272BC5.8090805@ish.com.au> In-Reply-To: <55272BC5.8090805@ish.com.au> Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 07:07:41 -0000 On 10/04/2015 11:47 AM, Aristedes Maniatis wrote: > Dewayne Geraghty wrote: >> Most likely there was a port build that required openssl port, and also required >> something like libarchive or libfetch (for example), both require openssl base >> (I've found net-mgmt/net-snmp does this). Your bt reveals that the symbol table >> is confused, as expected. > Ah, that's a good help. So I can easily core dump /usr/bin/vi by trying to edit any file. Forgive my ignorance of C debugging, but I'll stumble through this: > > 1. I attach gdb to the application and load the core dump. > 2. It tries to read symbols from a bunch of system libraries. > 3. In amongst all those libraries are some located in /usr/local: > > /usr/local/lib/nss_ldap.so.1 > /usr/local/lib/libldap-2.4.so.2 > /usr/local/lib/liblber-2.4.so.2 > /usr/local/lib/libssl.so.8 > /usr/local/lib/libcrypto.so.8 > > So the whole chain of problems originates from nss_ldap. But I'm confused about what I'm looking at here.. > > Did vi try to load some access control library when it tried to write a file out to disk, and then that loaded nsswitch which in turn I've tied into the nss_ldap port, and then from there it was a slippery slope to disaster of conflicting libraries? > > I'll try building nss_ldap against base openssl and see if that helps, but can someone help explain the naming here. Why do we have /usr/local/lib/libcrypto.so.8 but lib/libcrypto.so.7. Was this done when the openssl port moved from 1.0.1 to 1.0.2? Isn't there usually a warning in UPDATING when we need to rebuild all ports for that reason? > > If all ports move to only use openssl from ports, then how does my example above get fixed? Doesn't it make it all worse? > > > So many questions! Thanks for all the help in understanding this. > > Ari > > Ari, Anything under /usr/local/ should be regarded as coming from /usr/ports - that is, it is *not* part of the base system. /lib and /usr/lib are part of the base system. If your system is crashing due to /usr/bin/vi which is part of the base system, then something is very wrong with the system. I'm guessing but is it possible that you've installed 32 libs onto a 64 base system, or the other way around? I can't see how vi needs anything under /usr/local, as its from the "base" system - so I guess others may need to step up to assist. Regards, Dewayne From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 08:10:00 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 2467BC22 for ; Fri, 10 Apr 2015 08:10:00 +0000 (UTC) Received: from mail.xtaz.uk (tao.xtaz.uk [IPv6:2001:8b0:202::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id B1ACDB8B for ; Fri, 10 Apr 2015 08:09:58 +0000 (UTC) Received: by mail.xtaz.uk (Postfix, from userid 1001) id 4A05F209AF21; Fri, 10 Apr 2015 09:09:51 +0100 (BST) Date: Fri, 10 Apr 2015 09:09:51 +0100 From: Matt Smith To: Dewayne Geraghty Subject: Re: openssl and bash libcrypto Message-ID: <20150410080951.GD1280@xtaz.uk> Mail-Followup-To: Matt Smith , Dewayne Geraghty , freebsd-ports@freebsd.org References: <552657AC.1020802@ish.com.au> <55271AB5.8020907@ish.com.au> <55272BC5.8090805@ish.com.au> <5527769D.3060505@heuristicsystems.com.au> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline In-Reply-To: <5527769D.3060505@heuristicsystems.com.au> User-Agent: Mutt/1.5.23 (2014-03-12) Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 08:10:00 -0000 On Apr 10 17:07, Dewayne Geraghty wrote: >part of the base system. If your system is crashing due to /usr/bin/vi >which is part of the base system, then something is very wrong with the >system. I'm guessing but is it possible that you've installed 32 libs >onto a 64 base system, or the other way around? > >I can't see how vi needs anything under /usr/local, as its from the >"base" system - so I guess others may need to step up to assist. See the comments in the PR at https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=198788 It appears that on certain hardware compiling openssl 1.0.2 with the ASM optimisations turned on, which is the default, can cause all sorts of strange issues. I had the same issues with vi, bash, and all sorts of things both in the base system and the ports system. I have no idea why or how. But disabling ASM and recompiling it works around the issue. It seems to completely corrupt the environment. Matt From owner-freebsd-ports@FreeBSD.ORG Fri Apr 10 22:26:42 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id EDCBAE5A for ; Fri, 10 Apr 2015 22:26:42 +0000 (UTC) Received: from mail.sig11.fr (tritus.sig11.fr [IPv6:2a01:4f8:160:72a3::6:1]) by mx1.freebsd.org (Postfix) with ESMTP id 90077FC7 for ; Fri, 10 Apr 2015 22:26:42 +0000 (UTC) Received: from tritus.sig11.fr (tritus.sig11.fr [IPv6:2a01:4f8:160:72a3::6:1]) by mail.sig11.fr (Postfix) with ESMTP id 83538487B; Sat, 11 Apr 2015 00:20:41 +0200 (CEST) X-Virus-Scanned: amavisd-new at sig11.fr Received: from mail.sig11.fr ([IPv6:2a01:4f8:160:72a3::6:1]) by tritus.sig11.fr (mail.sig11.fr [IPv6:2a01:4f8:160:72a3::6:1]) (amavisd-new, port 10024) with LMTP id NKT3bRMWnu2m; Sat, 11 Apr 2015 00:20:39 +0200 (CEST) Received: from [IPv6:2001:910:10b7:f00:1ddc:c1ec:e696:e8ce] (unknown [IPv6:2001:910:10b7:f00:1ddc:c1ec:e696:e8ce]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mail.sig11.fr (Postfix) with ESMTPSA id C986247F7; Sat, 11 Apr 2015 00:20:38 +0200 (CEST) Message-ID: <55284CA4.4040107@guinoiseau.eu> Date: Sat, 11 Apr 2015 00:20:20 +0200 From: Pierre Guinoiseau User-Agent: Mozilla/5.0 (Windows NT 6.1; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: Dewayne Geraghty , freebsd-ports@freebsd.org Subject: Re: openssl and bash libcrypto References: <552657AC.1020802@ish.com.au> <55271AB5.8020907@ish.com.au> <55272BC5.8090805@ish.com.au> <5527769D.3060505@heuristicsystems.com.au> In-Reply-To: <5527769D.3060505@heuristicsystems.com.au> Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="mqNhaIjKxWXpte44bu1eWBF7H24DggIO8" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2015 22:26:43 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --mqNhaIjKxWXpte44bu1eWBF7H24DggIO8 Content-Type: text/plain; charset=windows-1252 Content-Transfer-Encoding: quoted-printable On 4/10/2015 9:07 AM, Dewayne Geraghty wrote: >=20 >=20 > On 10/04/2015 11:47 AM, Aristedes Maniatis wrote: >> Dewayne Geraghty wrote: >>> Most likely there was a port build that required openssl port, and al= so required >>> something like libarchive or libfetch (for example), both require ope= nssl base >>> (I've found net-mgmt/net-snmp does this). Your bt reveals that the s= ymbol table >>> is confused, as expected.=20 >> Ah, that's a good help. So I can easily core dump /usr/bin/vi by tryin= g to edit any file. Forgive my ignorance of C debugging, but I'll stumble= through this: >> >> 1. I attach gdb to the application and load the core dump. >> 2. It tries to read symbols from a bunch of system libraries. >> 3. In amongst all those libraries are some located in /usr/local: >> >> /usr/local/lib/nss_ldap.so.1 >> /usr/local/lib/libldap-2.4.so.2 >> /usr/local/lib/liblber-2.4.so.2 >> /usr/local/lib/libssl.so.8 >> /usr/local/lib/libcrypto.so.8 >> >> So the whole chain of problems originates from nss_ldap. But I'm confu= sed about what I'm looking at here.. >> >> Did vi try to load some access control library when it tried to write = a file out to disk, and then that loaded nsswitch which in turn I've tied= into the nss_ldap port, and then from there it was a slippery slope to d= isaster of conflicting libraries? >> >> I'll try building nss_ldap against base openssl and see if that helps,= but can someone help explain the naming here. Why do we have /usr/local/= lib/libcrypto.so.8 but lib/libcrypto.so.7. Was this done when the openssl= port moved from 1.0.1 to 1.0.2? Isn't there usually a warning in UPDATIN= G when we need to rebuild all ports for that reason? >> >> If all ports move to only use openssl from ports, then how does my exa= mple above get fixed? Doesn't it make it all worse? >> >> >> So many questions! Thanks for all the help in understanding this. >> >> Ari >> >> > Ari, > Anything under /usr/local/ should be regarded as coming from /usr/ports= > - that is, it is *not* part of the base system. /lib and /usr/lib are > part of the base system. If your system is crashing due to /usr/bin/vi= > which is part of the base system, then something is very wrong with the= > system. I'm guessing but is it possible that you've installed 32 libs > onto a 64 base system, or the other way around? >=20 > I can't see how vi needs anything under /usr/local, as its from the > "base" system - so I guess others may need to step up to assist. > Regards, Dewayne >=20 As he said, he's using nss_ldap, which is dynamically loaded by almost everything from the ports _and_ the base system if ldap is enabled in /etc/nsswitch.conf, that's why /usr/bin/vi crashes too. I have the same problem in jails with nss_ldap installed and configured, even a simple ls -l would segfault. As a result, I have downgraded openssl to 1.0.1 and wait until a fix comes out. --=20 Pierre Guinoiseau http://segmentationfau.lt/ | +PierreGuinoiseau | @peikk00 --mqNhaIjKxWXpte44bu1eWBF7H24DggIO8 Content-Type: application/pgp-signature; name="signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: GnuPG v2.0.22 (MingW32) iQIcBAEBAgAGBQJVKEyyAAoJEFBNg+ogrffPdwIP/RkB4aBu9TjarUZa9VwqwzYD AJn12jL6di2VXAJKlnLao+51w90v4WVAtLU0dm/2jfT4/sl5j7TbkvWRrRiVKbnb SHhXPom1QUpsYPnH3ze6siBECrFBKyuYt16PlUuAl/ybm/tMfWjOxNV08iqg91TB 5esuqqb/lEW+dJKE3Cjf4b1OAW02c2skUUih3SCL1oGX1Rygi2BNTgzbQHqBEI5q 3oPs68X0dSdagCgF4E5yS2+uQd59G5YgrB3CTtul84trbL9qGiU04p2yHh0emcMQ SH/cn/OkGjDSEKJt+LEJqAnmihY0V8G7DfIFJaagYrWchJNzfH4GoXRzWEIuyB8I DUiK+yEwzF8qRDLNyVkc++BDW8ZSwpH1hU5beeHhofDONCApiviXqhaYir5e9WJq qbp552E5MX6f98WVeQnLTEaKepnSIxVbnMY9dUNYCXJaHAFrpO2NWj+/zlCL+B2a SwO81CCzDr+NoE7LO6p0Euy8uWCrieuMlHdiQXWQ2o7CfdAHvWIyJ+b/FV2VnCfb SiQOyk2z6HCeJESa5RvyMqzj02n/G6Z5/kiQJB/wzrXNSaTymOnBhQS3jB5hztPL ED2iiDV9UNjPXIdMUEjCWp4aEFW3umBcL0NM6jPUMmq57rK+kMQ/iWqztm4LTmq8 fw2YMw/sRcuLg+cMa638 =Osb7 -----END PGP SIGNATURE----- --mqNhaIjKxWXpte44bu1eWBF7H24DggIO8-- From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 03:18:34 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 53D2EEB4 for ; Sat, 11 Apr 2015 03:18:34 +0000 (UTC) Received: from mail-wi0-f177.google.com (mail-wi0-f177.google.com [209.85.212.177]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.gmail.com", Issuer "Google Internet Authority G2" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id BD51BF90 for ; Sat, 11 Apr 2015 03:18:33 +0000 (UTC) Received: by wiax7 with SMTP id x7so27461460wia.0 for ; Fri, 10 Apr 2015 20:18:26 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20130820; h=x-gm-message-state:mime-version:date:message-id:subject:from:to:cc :content-type; bh=h9s6giee5IJX0pteAT0TntX2ehK8P+EqQwAly5uJ8b0=; b=hDtf1Eh6XDyc/7O2jj1t2mvJMh3S/EFJrxs1DRJDgQ9AjWI+ZYI5/I1KVzyHsqp4dK 2AZJlFTJYUsMuzBmO8n6LJI9UI2cdYi4kMy+LmbYVFIqesUZ9UwEqliZuHifARxwmeEr C1BO0ImfgbKuL5C0wy3UTLIdw0xivwLstGpHNVpgh+AOyIGbQvrsLq+J+F2PsxsvneWT 0jCh69m9522iXZHd80BWdgpHvzIRwO1TFZR7P9Sgq+/Pj0KM/ixYNvCbBosQ5hpPrjTj ARDXBX6Vr3fltAdgumlhOMfnxuftFoMveFBVKKGRsGAxw/Ag23UMbrp/4OqDgU6Kqi6n VUxQ== X-Gm-Message-State: ALoCoQl/jpqV+Y4ZY9HBx86Hq7DFWCNmC5NA3TRMGH97S8t6T8J/HSsEygJodkUc3HSLyeIyOOlq MIME-Version: 1.0 X-Received: by 10.180.87.101 with SMTP id w5mr2897045wiz.18.1428722306607; Fri, 10 Apr 2015 20:18:26 -0700 (PDT) Received: by 10.194.176.131 with HTTP; Fri, 10 Apr 2015 20:18:26 -0700 (PDT) Date: Fri, 10 Apr 2015 23:18:26 -0400 Message-ID: Subject: OPENSSL_ia32cap is my worst night mare From: Philip Gollucci To: ruby@freebsd.org, ports@freebsd.org Content-Type: text/plain; charset=UTF-8 X-Content-Filtered-By: Mailman/MimeDel 2.1.18-1 Cc: Matthew Vincenz , Scott Sanders , Stephen Garlick X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 03:18:34 -0000 All, This definitely needs an official bug report, I'm just not sure where. So for those of you that don't know I work at a ruby on rails shop and we also use AWS. We're just finishing our 10.x update. So take it as a given all is well on 9.x. - Spawn cperciva official AMI for FreeBSD 10.1-RELEASE - Build and install ruby with ruby-install (gcc or clang). As far as I can tell any version will do, but we're using 1.9.3-p551, 2.1.4, 2.2.1 - deploy a ruby on rails app with bundler/unicorn. any version of bundler/unicorn seems to cause it. - During unicorn start if you hook lib/libc/stdlib/getenv.c [patched file attached]. You'll see an ENV request for OPENSSL_ia32cap. This CORRUPTS the ENV. SMACK MY FACE AND PUNCH ME THEN HURT ME THEN CRY. - Once corrupted the next thing in *that* process/sub-process to SET an ENV var or rebuild the ENV will trigger it. static const char CorruptEnvFindMsg[] = "environment corrupt; unable to > find "; which obviously causes the process to exit. So as far as I can tell this is 100% reproducible. I must be the only person running rails with unicorn in aws on fbsd. So the good news is if you do > export OPENSSL_ia32cap=' '; You can hack around it. I will provide any other information on demand. I'll even make you an AMI if you want. Do note, that I can do a full buildworld, kernel, install, run chef, install pkgs, run ruby and nothing breaks. $ sudo kill -USR2 `cat pid of unicorn master` is a good way to cause it. The error msg is very misleading, I promise you BUNDLE_BIN_PATH has nothing to do with it which is the ENV its trying to dick with but its CORRUPT. If you apply my getenv.c file you'll see pointers/memory go everywhere. reaped # worker=unknown > executing ["/u/apps/rc/shared/vendor_bundle/ruby/1.9.1/bin/unicorn", "-E", > "dev", "-c", "/usr/local/etc/unicorn/rc.rb", "-D", > {23=>#}] (in /u/apps/rc/releases/20150405023358) > ruby: environment corrupt; missing value for BUNDLE_B~A^B > /opt/rubies/1.9.3-p551/lib/ruby/gems/1.9.1/gems/bundler-1.9.2/lib/bundler/gem_path_manipulation.rb:5:in > `[]=': Bad address - setenv (Errno::EFAULT) > from > /opt/rubies/1.9.3-p551/lib/ruby/gems/1.9.1/gems/bundler-1.9.2/lib/bundler/gem_path_manipulation.rb:5:in > `preserve_gem_path' > from > /opt/rubies/1.9.3-p551/lib/ruby/gems/1.9.1/gems/bundler-1.9.2/lib/bundler.rb:12:in > `' > from > /opt/rubies/1.9.3-p551/lib/ruby/gems/1.9.1/gems/bundler-1.9.2/lib/bundler.rb:11:in > `' > from > /opt/rubies/1.9.3-p551/lib/ruby/1.9.1/rubygems/custom_require.rb:36:in > `require' > from > /opt/rubies/1.9.3-p551/lib/ruby/1.9.1/rubygems/custom_require.rb:36:in > `require' > from > /opt/rubies/1.9.3-p551/lib/ruby/gems/1.9.1/gems/bundler-1.9.2/lib/bundler/setup.rb:4:in > `' > from > /opt/rubies/1.9.3-p551/lib/ruby/1.9.1/rubygems/custom_require.rb:36:in > `require' > from > /opt/rubies/1.9.3-p551/lib/ruby/1.9.1/rubygems/custom_require.rb:36:in > `require' That *only* took 5 8 hour days of pain. -- *PHILIP M. GOLLUCCI* Sr. Director of IT | *Curb* *w.* 703-579-6947 *m.* 703-336-9354 @gocurb Enter code* p6magic* for $10 off your first ride From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 16:12:31 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id D9D87716 for ; Sat, 11 Apr 2015 16:12:31 +0000 (UTC) Received: from mx5.roble.com (mx5.roble.com [206.40.34.5]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mx5.roble.com", Issuer "mx5.roble.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id CB1C279B for ; Sat, 11 Apr 2015 16:12:31 +0000 (UTC) Date: Sat, 11 Apr 2015 09:12:25 -0700 (PDT) From: Roger Marquis To: freebsd-ports@freebsd.org Subject: mailman attempting to reinstall postfix and other oddities User-Agent: Alpine 2.11 (BSF 23 2013-08-11) MIME-Version: 1.0 Content-Type: TEXT/PLAIN; format=flowed; charset=US-ASCII X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 16:12:31 -0000 Have a working and patched mailman but the port build is running into all sorts of issues. First it's warning me about the PYTHON_DEFAULT_VERSION, which is apparently 2.6 though 2.7 is installed and neither are set in make.conf: /!\ WARNING /!\ Your requested default python version 2.7 is different from the installed default python interpreter version 2.6 (whose idea was the "/!\" anyway?). Ignoring that warning it next attempts to reinstall postfix which is already at the current version: ===> postfix-base-2.11.4,1 is already installed You may wish to ``make deinstall'' and install this port again by ``make reinstall'' to upgrade it properly. If you really wish to overwrite the old port of postfix-base without deleting it first, set the variable "FORCE_PKG_REGISTER" in your environment or the "make install" command line. (why doesn't make automatically "deinstall reinstall" or, better yet, leave it alone? The suggestion to set FORCE_PKG_REGISTER should also be deprecated IMO.) Then it goes on to have issues installing (not compiling) py-dnspython... all on 8.4 (please, no recommendations to workaround by upgrading to 9 or 10 while 8.4 is supported). Can't recall seeing these issues before portsng/pkgng so am putting this out for recommendations. Roger Marquis From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 19:09:19 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id BB690CB3; Sat, 11 Apr 2015 19:09:19 +0000 (UTC) Received: from maildrop31.somerville.occnc.com (maildrop31.somerville.occnc.com [IPv6:2001:4830:c400:203::3131]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 8ACC6A3B; Sat, 11 Apr 2015 19:09:18 +0000 (UTC) Received: from harbor31.somerville.occnc.com (harbor31.somerville.occnc.com [IPv6:2001:4830:c400:203::3231]) (authenticated bits=128) by maildrop31.somerville.occnc.com (8.14.9/8.14.9) with ESMTP id t3BJ9EoK089662; Sat, 11 Apr 2015 15:09:14 -0400 (EDT) (envelope-from curtis@ipv6.occnc.com) Message-Id: <201504111909.t3BJ9EoK089662@maildrop31.somerville.occnc.com> To: mat@FreeBSD.org Reply-To: curtis@ipv6.occnc.com Subject: suggested patch to /usr/ports/dns/bind99/files/named.in From: Curtis Villamizar MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <89660.1428779354.1@harbor31.somerville.occnc.com> Date: Sat, 11 Apr 2015 15:09:14 -0400 X-Spam-Status: No, score=-101.5 required=5.0 tests=ALL_TRUSTED,MISSING_MID, RP_MATCHES_RCVD,USER_IN_WHITELIST autolearn=unavailable autolearn_force=no version=3.4.0 X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on maildrop31.somerville.occnc.com Cc: freebsd-ports@freebsd.org, curtis@ipv6.occnc.com X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 19:09:19 -0000 Mat, You are listed as the maintainer of dns/bind99 so this is addressed to you. Sorry to trouble you. A similar patch can be applied to dns/bind910. There would be a line number shift. I tried it - it works. The purpose of this patch is to fix two very minor annoyances. 1. If named.conf is moved in /etc/rc.conf with a line such as named_conf=/etc/namedb/named.conf, then rndc-confgen creates a key in the /etc/namedb but /usr/local/etc/rc.d/named restart or reload won't use that key file. The reload will fail, but the restart falls back to using kill. 2. The second problem is that if a rndc.conf file is used and put in /etc/namedb, rndc won't find it. It is necessary to use an rndc.conf file if running named in a jail, where there is no 127.0.0.1 address or if running IPv6 only and in other circumstances, such as if it is desirable to reload remotely (although an ssh command also solves this). The change is simply to load up a rndc_flags variable and use it in the two places where rndc is used. btw- there seems to be a non-ascii character in the comment on line 188 after the string "but ${named_program}". I had to replace that with a space to get this email message to go out. As a result the second hunk may have to be applied manually but its a one line change (one word addition). Curtis --- files/named.in.save 2015-03-25 16:25:30.000000000 -0400 +++ files/named.in 2015-04-11 15:02:48.556657000 -0400 @@ -62,6 +62,17 @@ _named_program_root="${named_program%/sbin/named}" _openssl_engines="%%LOCALBASE%%/lib/engines" +# Needed if named.conf and rndc.key are moved or if rndc.conf is used +rndc_conf=${rndc_conf:-"$_named_confdir/rndc.conf"} +rndc_key=${rndc_key:-"$_named_confdir/rndc.key"} +if [ -s $rndc_conf ] ; then + rndc_flags=${rndc_flags:-"-c $rndc_conf"} +elif [ -s $rndc_key ] ; then + rndc_flags=${rndc_flags:-"-k $rndc_key"} +else + rndc_flags=${rndc_flags:-""} +fi + # If running in a chroot cage, ensure that the appropriate files # exist inside the cage, as well as helper symlinks into the cage # from outside. @@ -187,7 +198,7 @@ { # This is a one line function, but ${named_program} is not defined early # enough to be there when the reload_cmd variable is defined up there. - ${_named_program_root}/sbin/rndc reload + ${_named_program_root}/sbin/rndc $rndc_flags reload } find_pidfile() @@ -213,7 +224,7 @@ return 1 fi echo 'Stopping named.' - if ${_named_program_root}/sbin/rndc stop 2>/dev/null; then + if ${_named_program_root}/sbin/rndc $rndc_flags stop 2>/dev/null; then wait_for_pids ${rc_pid} else echo -n 'rndc failed, trying kill: ' From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 19:12:51 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id E435ED69 for ; Sat, 11 Apr 2015 19:12:51 +0000 (UTC) Received: from prod2.absolight.net (mx3.absolight.net [IPv6:2a01:678:2:100::25]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client CN "plouf.absolight.net", Issuer "CAcert Class 3 Root" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id A7CCDAF3 for ; Sat, 11 Apr 2015 19:12:51 +0000 (UTC) Received: from prod2.absolight.net (localhost [127.0.0.1]) by prod2.absolight.net (Postfix) with ESMTP id B43F9BDC65; Sat, 11 Apr 2015 21:12:48 +0200 (CEST) Received: from atuin.in.mat.cc (atuin.in.mat.cc [79.143.241.205]) by prod2.absolight.net (Postfix) with ESMTPA id 91049BDC24; Sat, 11 Apr 2015 21:12:48 +0200 (CEST) Received: from localhost (localhost [127.0.0.1]) by atuin.in.mat.cc (Postfix) with ESMTP id 492C92FAE3CB; Sat, 11 Apr 2015 21:12:48 +0200 (CEST) Date: Sat, 11 Apr 2015 21:12:48 +0200 From: Mathieu Arnold To: curtis@ipv6.occnc.com Subject: Re: suggested patch to /usr/ports/dns/bind99/files/named.in Message-ID: In-Reply-To: <201504111909.t3BJ9EoK089662@maildrop31.somerville.occnc.com> References: <201504111909.t3BJ9EoK089662@maildrop31.somerville.occnc.com> X-Mailer: Mulberry/4.0.8 (Mac OS X) MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Content-Disposition: inline Cc: freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 19:12:52 -0000 +--On 11 avril 2015 15:09:14 -0400 Curtis Villamizar wrote: | Mat, | | You are listed as the maintainer of dns/bind99 so this is addressed to | you. Sorry to trouble you. Hi, I'm busy right now, could you open a PR so that I don't loose and forget this ? Regards, -- Mathieu Arnold From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 19:13:13 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [8.8.178.115]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 48B99DFC for ; Sat, 11 Apr 2015 19:13:13 +0000 (UTC) Received: from mailout.easydns.com (mailout.easydns.com [64.68.201.141]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id E4486B39 for ; Sat, 11 Apr 2015 19:13:12 +0000 (UTC) Received: from localhost (localhost [127.0.0.1]) by mailout.easydns.com (Postfix) with ESMTP id 1EE8A12F428 for ; Sat, 11 Apr 2015 15:07:21 -0400 (EDT) X-Virus-Scanned: Debian amavisd-new at mailout.easydns.com Received: from mailout.easydns.com ([127.0.0.1]) by localhost (mailout.easydns.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 0YhCwmRlHeUs for ; Sat, 11 Apr 2015 15:07:19 -0400 (EDT) Received: from mx1.hayers.org (cpc4-tilb8-2-0-cust163.basl.cable.virginm.net [80.193.15.164]) (using TLSv1 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by mailout.easydns.com (Postfix) with ESMTPSA id 6792B12F00D for ; Sat, 11 Apr 2015 15:07:19 -0400 (EDT) Received: from mx1.hayers.org (mx1.hayers.org [127.0.0.1]) by mx1.hayers.org (Postfix) with ESMTP id F2863B53E77 for ; Sat, 11 Apr 2015 20:07:17 +0100 (BST) X-Virus-Scanned: HCF-Sophos-SpamAssassin at hayers.org Received: from mx1.hayers.org ([127.0.0.1]) by mx1.hayers.org (mx1.hayers.org [127.0.0.1]) (HCF-Sophos-SpamAssassin, port 10024) with ESMTP id 5RP_aq6PAqNb for ; Sat, 11 Apr 2015 20:07:01 +0100 (BST) Received: from [192.168.0.2] (zeus.hayers.org [192.168.0.2]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "gary@hayers.org", Issuer "StartCom Class 1 Primary Intermediate Client CA" (verified OK)) (Authenticated sender: gary) by mx1.hayers.org (Postfix) with ESMTPSA id 13B82B53E59 for ; Sat, 11 Apr 2015 20:07:01 +0100 (BST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=hayers.org; s=hayers; t=1428779221; bh=6SYEhaaw+eom3yG2EzUszR5kfBfUNx662URvDGI24PU=; h=Date:From:To:Subject:References:In-Reply-To; b=yL2Eqi9ADzBhMWO2qsbnQi9xEcHNiGJaP+rOrmAGPc/SXozL+yjMRop3V6OJ5jTDX vJVcpSjRc3ToGmlWxAz2EJJ6zKxFT/sklhoDlaAjJuEva7rmXxnxWP9lg5SJ43PQw7 C32cWaozQ6/sWYXXMRdbbq3yg3wgOSQfi8x4ryqk= Message-ID: <552970C0.1090105@hayers.org> Date: Sat, 11 Apr 2015 20:06:40 +0100 From: "Gary J. Hayers" User-Agent: Mozilla/5.0 (Windows NT 6.1; WOW64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: FreeBSD Ports Subject: Re: email address being harvested from ports website References: <5527D0BD.8060401@gmail.com> <55291B68.4060509@gmail.com> In-Reply-To: <55291B68.4060509@gmail.com> Content-Type: multipart/signed; protocol="application/pkcs7-signature"; micalg=sha1; boundary="------------ms050109010008020106010406" X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 19:13:13 -0000 This is a cryptographically signed message in MIME format. --------------ms050109010008020106010406 Content-Type: text/plain; charset=windows-1252; format=flowed Content-Transfer-Encoding: quoted-printable On 11/04/2015 14:02, Ernie Luzar wrote: > Erich Dollansky wrote: > As the O.P. the maintainer email addresses are not used for every day > use. There are special email addresses created just for the individual > port. In your opinion, personally I can't see the problem (mountain out of a=20 molehill). I believe it is beneficial to have the maintainers email=20 address in the makefile, first point of call. --=20 Regards, Gary J. Hayers gary@hayers.org PGP Signature http://www.hayers.org/pgp "In the beginning the Universe was created. This has made a lot of people very angry and been widely regarded as a bad move." --------------ms050109010008020106010406 Content-Type: application/pkcs7-signature; name="smime.p7s" Content-Transfer-Encoding: base64 Content-Disposition: attachment; filename="smime.p7s" Content-Description: S/MIME Cryptographic Signature MIAGCSqGSIb3DQEHAqCAMIACAQExCzAJBgUrDgMCGgUAMIAGCSqGSIb3DQEHAQAAoIITFTCC BjQwggQcoAMCAQICAR4wDQYJKoZIhvcNAQEFBQAwfTELMAkGA1UEBhMCSUwxFjAUBgNVBAoT DVN0YXJ0Q29tIEx0ZC4xKzApBgNVBAsTIlNlY3VyZSBEaWdpdGFsIENlcnRpZmljYXRlIFNp Z25pbmcxKTAnBgNVBAMTIFN0YXJ0Q29tIENlcnRpZmljYXRpb24gQXV0aG9yaXR5MB4XDTA3 MTAyNDIxMDE1NVoXDTE3MTAyNDIxMDE1NVowgYwxCzAJBgNVBAYTAklMMRYwFAYDVQQKEw1T dGFydENvbSBMdGQuMSswKQYDVQQLEyJTZWN1cmUgRGlnaXRhbCBDZXJ0aWZpY2F0ZSBTaWdu aW5nMTgwNgYDVQQDEy9TdGFydENvbSBDbGFzcyAxIFByaW1hcnkgSW50ZXJtZWRpYXRlIENs aWVudCBDQTCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBAMcJg8zOLdgasSmkLhOr lr6KMoOMpohBllVHrdRvEg/q6r8jR+EK75xCGhR8ToREoqe7zM9/UnC6TS2y9UKTpT1v7RSM zR0t6ndl0TWBuUr/UXBhPk+Kmy7bI4yW4urC+y7P3/1/X7U8ocb8VpH/Clt+4iq7nirMcNh6 qJR+xjOhV+VHzQMALuGYn5KZmc1NbJQYclsGkDxDz2UbFqE2+6vIZoL+jb9x4Pa5gNf1TwSD kOkikZB1xtB4ZqtXThaABSONdfmv/Z1pua3FYxnCFmdr/+N2JLKutIxMYqQOJebr/f/h5t95 m4JgrM3Y/w7YX9d7YAL9jvN4SydHsU6n65cCAwEAAaOCAa0wggGpMA8GA1UdEwEB/wQFMAMB Af8wDgYDVR0PAQH/BAQDAgEGMB0GA1UdDgQWBBRTcu2SnODaywFcfH6WNU7y1LhRgjAfBgNV HSMEGDAWgBROC+8apEBbpRdphzDKNGhD0EGu8jBmBggrBgEFBQcBAQRaMFgwJwYIKwYBBQUH MAGGG2h0dHA6Ly9vY3NwLnN0YXJ0c3NsLmNvbS9jYTAtBggrBgEFBQcwAoYhaHR0cDovL3d3 dy5zdGFydHNzbC5jb20vc2ZzY2EuY3J0MFsGA1UdHwRUMFIwJ6AloCOGIWh0dHA6Ly93d3cu c3RhcnRzc2wuY29tL3Nmc2NhLmNybDAnoCWgI4YhaHR0cDovL2NybC5zdGFydHNzbC5jb20v c2ZzY2EuY3JsMIGABgNVHSAEeTB3MHUGCysGAQQBgbU3AQIBMGYwLgYIKwYBBQUHAgEWImh0 dHA6Ly93d3cuc3RhcnRzc2wuY29tL3BvbGljeS5wZGYwNAYIKwYBBQUHAgEWKGh0dHA6Ly93 d3cuc3RhcnRzc2wuY29tL2ludGVybWVkaWF0ZS5wZGYwDQYJKoZIhvcNAQEFBQADggIBAAqD CH14qywGXLhjjF6uHLkjd02hcdh9hrw+VUsv+q1eeQWB21jWj3kJ96AUlPCoEGZ/ynJNScWy 6QMVQjbbMXltUfO4n4bGGdKo3awPWp61tjAFgraLJgDk+DsSvUD6EowjMTNx25GQgyYJ5RPI zKKR9tQW8gGK+2+RHxkUCTbYFnL6kl8Ch507rUdPPipJ9CgJFws3kDS3gOS5WFMxcjO5DwKf KSETEPrHh7p5shuuNktvsv6hxHTLhiMKX893gxdT3XLS9OKmCv87vkINQcNEcIIoFWbP9HOR z9v3vQwR4e3ksLc2JZOAFK+ssS5XMEoznzpihEP0PLc4dCBYjbvSD7kxgDwZ+Aj8Q9PkbvE9 sIPP7ON0fz095HdThKjiVJe6vofq+n6b1NBc8XdrQvBmunwxD5nvtTW4vtN6VY7mUCmxsCie uoBJ9OlqmsVWQvifIYf40dJPZkk9YgGTzWLpXDSfLSplbY2LL9C9U0ptvjcDjefLTvqSFc7t w1sEhF0n/qpA2r0GpvkLRDmcSwVyPvmjFBGqUp/pNy8ZuPGQmHwFi2/14+xeSUDG2bwnsYJQ G2EdJCB6luQ57GEnTA/yKZSTKI8dDQa8Sd3zfXb19mOgSF0bBdXbuKhEpuP9wirslFe6fQ1t 5j5R0xi72MZ8ikMu1RQZKCyDbMwazlHiMIIGNjCCBR6gAwIBAgIDDFjNMA0GCSqGSIb3DQEB BQUAMIGMMQswCQYDVQQGEwJJTDEWMBQGA1UEChMNU3RhcnRDb20gTHRkLjErMCkGA1UECxMi U2VjdXJlIERpZ2l0YWwgQ2VydGlmaWNhdGUgU2lnbmluZzE4MDYGA1UEAxMvU3RhcnRDb20g Q2xhc3MgMSBQcmltYXJ5IEludGVybWVkaWF0ZSBDbGllbnQgQ0EwHhcNMTQxMjIyMTExODM2 WhcNMTUxMjIzMjEwNDI5WjBVMRkwFwYDVQQNExB1OE1UWjQ0ejFyaE1NSTdMMRgwFgYDVQQD DA9nYXJ5QGhheWVycy5vcmcxHjAcBgkqhkiG9w0BCQEWD2dhcnlAaGF5ZXJzLm9yZzCCASIw DQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBALBpMEzDoYN0iI4qLAFlmxoS96ezUdwy0y55 nK6uPLSdq46GEqoy/yvKdpDlW7I1uS/Dewo7/srBRuud0Jpz6+kXsCAuaMFudBUSPBQJiqNc 3A7T0KEgl/SyXqE1ZMnkVPD3WwkQ6vSHe8mLp7Wu5Fy4tVKgbXT43vN+Czd2XuMMe398FsAc oNEfvGroJdPwRIkoY7dl00wVWH7Ow7B7VQzLzMVKQAZIIudQw2oLMp96XhBqYdk1Ep/hnCYh jIgYk1LrFvBAh7jAuCkFmTf3kkqWmN0MwNvNjyd3enXQeBSI100TPD0buQ2Rlexzus+NV+/w dUwWxEnOqNbbqWm6Hr0CAwEAAaOCAtUwggLRMAkGA1UdEwQCMAAwCwYDVR0PBAQDAgSwMB0G A1UdJQQWMBQGCCsGAQUFBwMCBggrBgEFBQcDBDAdBgNVHQ4EFgQUwxzZ0eRN66tZm4SjJGZL 75DntEAwHwYDVR0jBBgwFoAUU3Ltkpzg2ssBXHx+ljVO8tS4UYIwGgYDVR0RBBMwEYEPZ2Fy eUBoYXllcnMub3JnMIIBTAYDVR0gBIIBQzCCAT8wggE7BgsrBgEEAYG1NwECAzCCASowLgYI KwYBBQUHAgEWImh0dHA6Ly93d3cuc3RhcnRzc2wuY29tL3BvbGljeS5wZGYwgfcGCCsGAQUF BwICMIHqMCcWIFN0YXJ0Q29tIENlcnRpZmljYXRpb24gQXV0aG9yaXR5MAMCAQEagb5UaGlz IGNlcnRpZmljYXRlIHdhcyBpc3N1ZWQgYWNjb3JkaW5nIHRvIHRoZSBDbGFzcyAxIFZhbGlk YXRpb24gcmVxdWlyZW1lbnRzIG9mIHRoZSBTdGFydENvbSBDQSBwb2xpY3ksIHJlbGlhbmNl IG9ubHkgZm9yIHRoZSBpbnRlbmRlZCBwdXJwb3NlIGluIGNvbXBsaWFuY2Ugb2YgdGhlIHJl bHlpbmcgcGFydHkgb2JsaWdhdGlvbnMuMDYGA1UdHwQvMC0wK6ApoCeGJWh0dHA6Ly9jcmwu c3RhcnRzc2wuY29tL2NydHUxLWNybC5jcmwwgY4GCCsGAQUFBwEBBIGBMH8wOQYIKwYBBQUH MAGGLWh0dHA6Ly9vY3NwLnN0YXJ0c3NsLmNvbS9zdWIvY2xhc3MxL2NsaWVudC9jYTBCBggr BgEFBQcwAoY2aHR0cDovL2FpYS5zdGFydHNzbC5jb20vY2VydHMvc3ViLmNsYXNzMS5jbGll bnQuY2EuY3J0MCMGA1UdEgQcMBqGGGh0dHA6Ly93d3cuc3RhcnRzc2wuY29tLzANBgkqhkiG 9w0BAQUFAAOCAQEAZn89wCPbiFIdnwY07XE35Lv8LQN5nmx6Tkd21qV3ohxzwmVMP56Y3J4U pZS/xj5qg2i7Rrstf7eO+hyMpfndhNbXO2Yb/qPAwhd092q17LpD5u4ThdJ4OXrhAu/QNn3z 76dF3UukuSbafHQHv2dZ8ZaP4dSOuIgcxHtzEtQHeJfkz2aRIcvadpIoXKMIbEMz2jAaKgdO j3wFExxhM5ymLpPkxLQ6WpHw3enkMPycQ1rYJE3Z18fcuzE19oHZY/j2kILhvEpbUn7KRiu3 5cgGV0mcKgrm1QAFea+Em80awz5Bl9cV72KG2GNSqgnGQjmUj5W3s2GerGNEYckxQYXUCzCC Bp8wggSHoAMCAQICAT0wDQYJKoZIhvcNAQELBQAwUzELMAkGA1UEBhMCSUwxFjAUBgNVBAoT DVN0YXJ0Q29tIEx0ZC4xLDAqBgNVBAMTI1N0YXJ0Q29tIENlcnRpZmljYXRpb24gQXV0aG9y aXR5IEcyMB4XDTA2MDkxNzE5NDYzN1oXDTM2MDkxNzE5NDYzN1owfTELMAkGA1UEBhMCSUwx FjAUBgNVBAoTDVN0YXJ0Q29tIEx0ZC4xKzApBgNVBAsTIlNlY3VyZSBEaWdpdGFsIENlcnRp ZmljYXRlIFNpZ25pbmcxKTAnBgNVBAMTIFN0YXJ0Q29tIENlcnRpZmljYXRpb24gQXV0aG9y aXR5MIICIjANBgkqhkiG9w0BAQEFAAOCAg8AMIICCgKCAgEAwYjbCbxsRnx4n5V7tTOQ8nJi 1sE2ICIkXs7pd/JDCqIGZKTMjjb4OOYj8G5tsTzdcqOFHKHTPbQzK9Mvr/7qsEFZZ7bEBn0K nnSF1nlMgDd63zkFUln39BtGQ6TShYXSw3HzdWI0uiyKfx6P7u000BHHls1SPboz1t1N3gs7 SkufwiYv+rUWHHI1d8o8XebK4SaLGjZ2XAHbdBQl/u21oIgP3XjKLR8HlzABLXJ5+kbWEyqo uaarg0kd5fLv3eQBjhgKj2NTFoViqQ4ZOsy1ZqbCa3QH5Cvhdj60bdj2ROFzYh87xL6gU1Yl bFEJ96qryr92/W2b853bvz1mvAxWqq+YSJU6S9+nWFDZOHWpW+pDDAL/mevobE1wWyllnN2q XcyvATHsDOvSjejqnHvmbvcnZgwaSNduQuM/3iE+e+ENcPtjqqhsGlS0XCV6yaLJixamuyx+ F14FTVhuEh0B7hIQDcYyfxj//PT6zW6R6DZJvhpIaYvClk0aErJpF8EKkNb6eSJIv7p7afhw x/p6N9jYDdJ2T1f/kLfjkdLd78Jgt2c63f6qnPDUi39yIs7Gn5e2+K+KoBCo2fsYxra1XFI8 ibYZKnMBCg8DsxJg8novgdujbv8mMJf1i92JV7atPbOvK8W3dgLwpdYrmoYUKnL24zOMXQlL E9+7jHQTUksCAwEAAaOCAVIwggFOMBIGA1UdEwEB/wQIMAYBAf8CAQIwDgYDVR0PAQH/BAQD AgEGMB0GA1UdDgQWBBROC+8apEBbpRdphzDKNGhD0EGu8jAfBgNVHSMEGDAWgBRLxbRAa60c s6UcZW5GNomHBQwOtjBvBggrBgEFBQcBAQRjMGEwKgYIKwYBBQUHMAGGHmh0dHA6Ly9vY3Nw LnN0YXJ0c3NsLmNvbS9jYS1nMjAzBggrBgEFBQcwAoYnaHR0cDovL2FpYS5zdGFydHNzbC5j b20vY2VydHMvY2EtZzIuY2VyMDIGA1UdHwQrMCkwJ6AloCOGIWh0dHA6Ly9jcmwuc3RhcnRz c2wuY29tL2NhLWcyLmNybDBDBgNVHSAEPDA6MDgGBFUdIAAwMDAuBggrBgEFBQcCARYiaHR0 cDovL3d3dy5zdGFydHNzbC5jb20vcG9saWN5LnBkZjANBgkqhkiG9w0BAQsFAAOCAgEAM55T y65ULAKJsJVWBoK0R3lwl0gPCtBNN2tVXwhPLoYEWYO3CtzdqBKIwTKHi+FaiznrqnHd8/sU qvObsZ8z3PnAAW4kW+ILskLyv3as1o45g3BGFZNKMwqlogZPnnOFuB5oMpEB3b4WPvM4CUgk HX6hpIQFHNf1P4hOYwCL3NzO+5xXieiiHt1WpxAQ7LRc5UISUqPKUs4S/KRGAVqbnR2p2xaI GQycBvhguqRPD0pyBAB5iyl8KEXkq+saB6VA6zHcAobYdNIEWAs+OQDq5E8pSKyJfBJc8127 YwawhTCiHLZnMVxNLFXNmE/TgglC/pu/yyjzXV6KRm3vA1i+h5hVMBi8HbfLeVs11UsUt8QA OxegzM9OcDU+vCX3X/AZSckNx0Yk7/09tAWzUqklbDlrKSMrmj4S0df0r9puD3qweZSWAOv1 P3hWdaLfIHud1ziKD3w/fSxvUnneJxfNtqP3R0lwGfF/qKLaAV+bYgPvYXxqn1fybrGHL/oX O0qkXc2E23LOrIvhIUbNYSli4rnzaEDBz/pXKKTlJbdyKf6elg2TSTiauOi4LwxY+3EP1kpD LswOX6ejT740J1ZqI41E7GnaUTeIW52o6zu64yYTiQTd5HHeNc2u2UPZYeNvcvMuU2yVmCeB G5R+K4kFShEIMoOJqpgjpZcjGEuwhhkxggPdMIID2QIBATCBlDCBjDELMAkGA1UEBhMCSUwx FjAUBgNVBAoTDVN0YXJ0Q29tIEx0ZC4xKzApBgNVBAsTIlNlY3VyZSBEaWdpdGFsIENlcnRp ZmljYXRlIFNpZ25pbmcxODA2BgNVBAMTL1N0YXJ0Q29tIENsYXNzIDEgUHJpbWFyeSBJbnRl cm1lZGlhdGUgQ2xpZW50IENBAgMMWM0wCQYFKw4DAhoFAKCCAh0wGAYJKoZIhvcNAQkDMQsG CSqGSIb3DQEHATAcBgkqhkiG9w0BCQUxDxcNMTUwNDExMTkwNjQwWjAjBgkqhkiG9w0BCQQx FgQUnTLpgyXIdfCKiqXWIvgQyE+hk2AwbAYJKoZIhvcNAQkPMV8wXTALBglghkgBZQMEASow CwYJYIZIAWUDBAECMAoGCCqGSIb3DQMHMA4GCCqGSIb3DQMCAgIAgDANBggqhkiG9w0DAgIB QDAHBgUrDgMCBzANBggqhkiG9w0DAgIBKDCBpQYJKwYBBAGCNxAEMYGXMIGUMIGMMQswCQYD VQQGEwJJTDEWMBQGA1UEChMNU3RhcnRDb20gTHRkLjErMCkGA1UECxMiU2VjdXJlIERpZ2l0 YWwgQ2VydGlmaWNhdGUgU2lnbmluZzE4MDYGA1UEAxMvU3RhcnRDb20gQ2xhc3MgMSBQcmlt YXJ5IEludGVybWVkaWF0ZSBDbGllbnQgQ0ECAwxYzTCBpwYLKoZIhvcNAQkQAgsxgZeggZQw gYwxCzAJBgNVBAYTAklMMRYwFAYDVQQKEw1TdGFydENvbSBMdGQuMSswKQYDVQQLEyJTZWN1 cmUgRGlnaXRhbCBDZXJ0aWZpY2F0ZSBTaWduaW5nMTgwNgYDVQQDEy9TdGFydENvbSBDbGFz cyAxIFByaW1hcnkgSW50ZXJtZWRpYXRlIENsaWVudCBDQQIDDFjNMA0GCSqGSIb3DQEBAQUA BIIBAIZfb12tuEyA+l9dV8QoI1/iD8toKGc2dJi4guTpypz2DkKsbsjKwr5P9Z3hicOoOi3b TtbHt8+7LDXozwZtpu1kjTat3vMjlhZzqO3ummFVTEOA8QPCWx3yTKWm4v+qa+2LRHG6/cSR QCnwQL9H1CHGUy7eF3rfLxBFBDTG2Pl5f9tI22GYVaO3Dk88+DxvnkGBRY3PKWRIuqppsej5 fmx/nhUL3eGLaTbEOZrlLNjD1SDnG4H3ve23+GpwH68K8Xmvuu3oKdoe4om3KsedCHvXuomZ ircZsPWWrId+jdPGCcyPcmUF84G1MNpow5+V0glByACSPsT00fHKhve8IVsAAAAAAAA= --------------ms050109010008020106010406-- From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 23:01:55 2015 Return-Path: Delivered-To: ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id B12F7AA; Sat, 11 Apr 2015 23:01:55 +0000 (UTC) Received: from shell1.rawbw.com (shell1.rawbw.com [198.144.192.42]) by mx1.freebsd.org (Postfix) with ESMTP id 9A7E12F2; Sat, 11 Apr 2015 23:01:55 +0000 (UTC) Received: from yuri.doctorlan.com (c-50-184-63-128.hsd1.ca.comcast.net [50.184.63.128]) (authenticated bits=0) by shell1.rawbw.com (8.14.9/8.14.9) with ESMTP id t3BN1mBT077713 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES128-SHA bits=128 verify=NO); Sat, 11 Apr 2015 16:01:49 -0700 (PDT) (envelope-from yuri@rawbw.com) X-Authentication-Warning: shell1.rawbw.com: Host c-50-184-63-128.hsd1.ca.comcast.net [50.184.63.128] claimed to be yuri.doctorlan.com Message-ID: <5529A7DB.4030807@rawbw.com> Date: Sat, 11 Apr 2015 16:01:47 -0700 From: Yuri User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:31.0) Gecko/20100101 Thunderbird/31.6.0 MIME-Version: 1.0 To: "ports@freebsd.org" Subject: Re: Pourdriere produces faulty build results due to bsd.openssl.mk bug References: <551C5C4C.5090707@rawbw.com> In-Reply-To: <551C5C4C.5090707@rawbw.com> Content-Type: text/plain; charset=windows-1252; format=flowed Content-Transfer-Encoding: 7bit Cc: Bryan Drewery X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 23:01:55 -0000 The is also this bug in bsd.openssl.mk that lines like this CFLAGS+= -Wl,-rpath,${OPENSSLRPATH} need to have -L${OPENSSLRPATH} before -Wl,-rpath. This is because pure -Wl,-rpath,${SOMEPATH} w/out preceding -L${SOMAPATH} doesn't force-link to that path. -L/usr/local/lib is *usually* but *not always* present. I saw the cases when -Wl,-rpath fails to link to that path w/out -L before it. Yuri From owner-freebsd-ports@FreeBSD.ORG Sat Apr 11 23:59:00 2015 Return-Path: Delivered-To: freebsd-ports@freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2001:1900:2254:206a::19:1]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by hub.freebsd.org (Postfix) with ESMTPS id 2FA99488 for ; Sat, 11 Apr 2015 23:59:00 +0000 (UTC) Received: from asp.reflexion.net (outbound-242.asp.reflexion.net [69.84.129.242]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id DA71C99D for ; Sat, 11 Apr 2015 23:58:59 +0000 (UTC) Received: (qmail 3901 invoked from network); 11 Apr 2015 23:58:51 -0000 Received: from unknown (HELO rtc-sm-01.app.dca.reflexion.local) (10.81.150.1) by 0 (rfx-qmail) with SMTP; 11 Apr 2015 23:58:51 -0000 Received: by rtc-sm-01.app.dca.reflexion.local (Reflexion email security v7.40.1) with SMTP; Sat, 11 Apr 2015 19:58:51 -0400 (EDT) Received: (qmail 22263 invoked from network); 11 Apr 2015 23:58:51 -0000 Received: from unknown (HELO iron2.pdx.net) (69.64.224.71) by 0 (rfx-qmail) with (DHE-RSA-AES256-SHA encrypted) SMTP; 11 Apr 2015 23:58:51 -0000 X-No-Relay: not in my network X-No-Relay: not in my network X-No-Relay: not in my network X-No-Relay: not in my network X-No-Relay: not in my network Received: from [192.168.1.8] (c-67-189-19-145.hsd1.or.comcast.net [67.189.19.145]) by iron2.pdx.net (Postfix) with ESMTPSA id E3A151C43BC; Sat, 11 Apr 2015 16:58:45 -0700 (PDT) Content-Type: text/plain; charset=utf-8 Mime-Version: 1.0 (Mac OS X Mail 8.2 \(2098\)) Subject: gcc-4.9.1/gcc/config/rs6000/freebsd64.h vs. FreeBSD's powerpc (non-64) L"..." and wchar_t (other gcc ports too?) From: Mark Millard In-Reply-To: <5B228278-A967-46D4-8F56-08E47008D009@dsl-only.net> Date: Sat, 11 Apr 2015 16:58:50 -0700 Content-Transfer-Encoding: quoted-printable Message-Id: <3734A273-6178-4AF5-B066-DEEB6CFC7F1C@dsl-only.net> References: <5B228278-A967-46D4-8F56-08E47008D009@dsl-only.net> To: freebsd-ports@freebsd.org, Warner Losh , Baptiste Daroussin X-Mailer: Apple Mail (2.2098) Cc: freebsd-toolchain@freebsd.org, FreeBSD PowerPC ML X-BeenThere: freebsd-ports@freebsd.org X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Porting software to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 11 Apr 2015 23:59:00 -0000 [The following may point to something that should be directed upstream = for gcc 4.9+ (and possibly earlier?) and/or something for the port(s) to = patch.] Short version: Looking at = /usr/obj/portswork/usr/ports/devel/powerpc64-gcc/work/gcc-4.9.1/gcc/config= /rs6000/freebsd64.h shows: > /* rs6000.h gets this wrong for FreeBSD. We use the GCC defaults = instead. */ > #undef WCHAR_TYPE > #define WCHAR_TYPE (TARGET_64BIT ? "int" : "long int") > #undef WCHAR_TYPE_SIZE > #define WCHAR_TYPE_SIZE 32 The above is what controls the type that results for L". . ." notation = no matter what the FreeBSD typedefs for wchar_t trace back to (int for = powerpc and powerpc64). For FreeBSD that long int should also be just int from what I can tell. = Why? . . . For it being long int: when trying WITH_LIB32=3D for buildworld with = powerpc64-xtoolchain-gcc's powerpc64-gcc port (on a powerpc64 box, using = WITHOUT_BOOT=3D ) this leads to the following in libedit: > . . . parse.c:181:25: error: array of inappropriate type initialized = from string constant > const Char hex[] =3D STR("0123456789ABCDEF"); > ^ where STR(". . .") produces L". . ." and Char traces back to wchar_t = (and back to int for the context). I also got lots of warnings about incompatible pointer types when Char = and STR(. . .) were in the mix for libedit. The ones that mention a type = explicitly mention long int *. I have not checked other processor families: I only have access to = PowerMac based FreeBSD's so far. I have not checked other gcc ports: Are gcc ports that are not = explicitly used for system builds supposed to be well behaved for L". . = ." notation vs. the FreeBSD wchar_t definition for C? If yes then they = likely need the same sort of adjustment. Details/evidence below: Ignore the following if the above is enough. The evidence for what was installed for powerpc64-gcc (on the powerpc64 = box) and what it will treat L". . ." as is: > # /usr/local/bin/powerpc64-portbld-freebsd11.0-gcc-4.9.1 -dM -E -m32 - = < /dev/null | grep WCHAR > #define __WCHAR_MAX__ 2147483647L > #define __WCHAR_MIN__ (-__WCHAR_MAX__ - 1) > #define __GCC_ATOMIC_WCHAR_T_LOCK_FREE 2 > #define __WCHAR_TYPE__ long int > #define __SIZEOF_WCHAR_T__ 4 The above does not match what gcc 4.2.1 uses for __WCHAR_TYPE__ or what = -m64 uses for either gcc version. Those use int, like FreeBSD does. The long int use seems to be from following = gcc-4.9.1/gcc/config/rs6000/sysv4.h=E2=80=99s conventions for powerpc = (non-64) instead of following freebsd-=E2=80=99s wchar_t being int for = both powerpc and powerpc64: > $ /usr/local/bin/powerpc64-portbld-freebsd11.0-gcc-4.9.1 -dM -E -m32 - = < /dev/null | sort | grep _CALL_ > #define _CALL_SYSV 1 > $ /usr/local/bin/powerpc64-portbld-freebsd11.0-gcc-4.9.1 -dM -E -m64 - = < /dev/null | sort | grep _CALL_ > #define _CALL_AIX 1 > #define _CALL_AIXDESC 1 > #define _CALL_ELF 1 In other words: gcc 4.9.1=E2=80=99s freebsd64.h incorrectly assumes that = the call standard to follow drives the choice of underlying wchar_t type = for FreeBSD. The libedit/Makefile uses -DWIDECHAR and libedit/chartype.h defines for = that case: > #define Char wchar_t > . . . > #define STR(x) L ## x Note: I had WITHOUT_BOOT=3D for the experimental buildworld. WITH_BOOT=3D = has both some powerpc Makefile.inc problems (needing to use -Wl, = appropriately) and also there seems to be a lack of bindings for various = _restgpr__x compiler support routines so boot1.elf fails to link. So = I skipped that via WITHOUT_BOOT=3D so I could see what WITH_LIB32=3D = would do. =3D=3D=3D Mark Millard markmi at dsl-only.net