From owner-freebsd-current@freebsd.org Sun Jan 24 01:32:20 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2302F4E4DD7 for ; Sun, 24 Jan 2021 01:32:20 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNb8N0QXqz3kHq; Sun, 24 Jan 2021 01:32:20 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from weatherwax.trouble.is (weatherwax.trouble.is [46.235.227.50]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "weatherwax.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id E2205E01D; Sun, 24 Jan 2021 01:32:19 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from rincewind.trouble.is (rincewind.trouble.is [IPv6:2a01:4f9:2a:1715::1:1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "rincewind.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) by weatherwax.trouble.is (Postfix) with ESMTPS id 4DNb8M108bz1wh5; Sun, 24 Jan 2021 01:32:19 +0000 (UTC) Received: by rincewind.trouble.is (Postfix, authenticated sender philip) id 4DNb8K59q3z6FLQ; Sun, 24 Jan 2021 01:32:17 +0000 (UTC) From: "Philip Paeps" To: "Henri Hennebert" Cc: freebsd-current@freebsd.org Subject: Re: RTC on ROCKPRO64 Date: Sun, 24 Jan 2021 09:32:13 +0800 X-Clacks-Overhead: GNU Terry Pratchett X-Mailer: MailMate (1.14r5757) Message-ID: In-Reply-To: <59aa70f6-73fa-4c8f-c6eb-72a05ab9586f@restart.be> References: <59aa70f6-73fa-4c8f-c6eb-72a05ab9586f@restart.be> MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 01:32:20 -0000 On 2021-01-22 23:16:29 (+0800), Henri Hennebert wrote: > I have tested https://reviews.freebsd.org/D22692 on my ROCKPRO64 with > a battery and it works. (After correcting the typo at line 516 of > rk805.c) > > Is it possible to merge it for 13.0-RELEASE ? It looks like that revision needs some changes before it can be accepted. I'll see if I can make those changes. Thanks. Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From owner-freebsd-current@freebsd.org Sun Jan 24 01:35:07 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 284984E5880 for ; Sun, 24 Jan 2021 01:35:07 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from h2.pinyon.org (h2.pinyon.org [65.101.20.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNbCZ2R5yz3kdM for ; Sun, 24 Jan 2021 01:35:06 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from [10.0.10.15] (unknown [10.0.10.15]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by h2.pinyon.org (Postfix) with ESMTPSA id EC03ECD1D for ; Sat, 23 Jan 2021 18:34:58 -0700 (MST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pinyon.org; s=dkim; t=1611452098; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=uHd77Y0uHA8ZwJzj9nU8j/EZ5mOfqI4jb5gyd+VY21Y=; b=ESZkAy4f1HHTX929RWh0jHTzyVAwBC61zs2B/G7fxR6/X3egidTAu88IqzlkNP1u33ijnK K40aLCFtCLuI+nP9CvJUUzEZi5OVMbN762Wojqp7acDRiTSI3PrZgBDwLtUH3Ohypw+jFf BWQluGtTcLvy7bLXtaadioPTMvebY/E= Subject: Re: Which branch in git is 13.0-current? To: freebsd-current@freebsd.org References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> From: "Russell L. Carter" Message-ID: <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> Date: Sat, 23 Jan 2021 18:34:58 -0700 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Firefox/78.0 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <004101d6f1ac$62a619d0$27f24d70$@gmail.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Spam-Status: No, score=-2.10 X-Rspamd-Server: h2 X-Rspamd-Queue-Id: 4DNbCZ2R5yz3kdM X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=pinyon.org header.s=dkim header.b=ESZkAy4f; dmarc=none; spf=pass (mx1.freebsd.org: domain of rcarter@pinyon.org designates 65.101.20.170 as permitted sender) smtp.mailfrom=rcarter@pinyon.org X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[pinyon.org:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.101.20.170:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.101.20.170:from:127.0.2.255]; ARC_NA(0.00)[]; DKIM_TRACE(0.00)[pinyon.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[pinyon.org]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:209, ipnet:65.101.0.0/18, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 01:35:07 -0000 On 1/23/21 10:22 AM, driesm.michiels@gmail.com wrote: > >>>> -----Original Message----- >>>> From: owner-freebsd-current@freebsd.org >>> current@freebsd.org> On Behalf Of Malcolm Matalka >>>> Sent: Saturday, 23 January 2021 17:43 >>>> To: FreeBSD Current >>>> Subject: Which branch in git is 13.0-current? >>>> >>>> I upgraded my src checkout to git, and looks like I'm on 14.0-CURRENT? >>>> >>>> >>>> FreeBSD bsdell 14.0-CURRENT FreeBSD 14.0-CURRENT #33 >>>> main-c256217-g6c789c55c4ba: Sat Jan 23 16:08:16 CET 2021 >>>> root@bsdell:/usr/obj/usr/src/amd64.amd64/sys/GENERIC amd64 >>>> >>>> I am in the main branch, which I got by following the docs on >>> transitioning to >>>> git. >>>> >>>> The main issue is I can't use pkg now. >>> >>> Build pkg from ports or wait a bit till the clusters have caught up >>> building the packages with the base version change. >> >> Does that mean CURRENT is now 14.0? I must have missed the >> announcement. > > That is correct, 13-stable has been branched from 13-current which has now > been bumped to 14-current. > Because it's a major version change going from 13 to 14, pkg is a bit > agitated regarding the ABI. So has anyone tracking stable/12 and ports successfully completed the git checkout stable/13; make buildworld; make installworld; mergemaster drill? I see I can checkout stable/13. Do make.conf | src.conf | GENERIC have silent breaking changes? I usually, recklessly, assume no. Ima throw the build->install as soon as the drill looks good. Russell >>> >>> Dries >>> >>> >>>> >>>> Thanks! >>>> _______________________________________________ >>>> freebsd-current@freebsd.org mailing list >>>> https://lists.freebsd.org/mailman/listinfo/freebsd-current >>>> To unsubscribe, send any mail to "freebsd-current- >> unsubscribe@freebsd.org" > > > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > From owner-freebsd-current@freebsd.org Sun Jan 24 01:51:26 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A61354E5F72 for ; Sun, 24 Jan 2021 01:51:26 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNbZP4dq2z3lYW for ; Sun, 24 Jan 2021 01:51:25 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.16.1/8.15.2) with ESMTP id 10O1pIaO079370; Sun, 24 Jan 2021 01:51:18 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.16.1/8.16.1/Submit) id 10O1pIoK079369; Sat, 23 Jan 2021 17:51:18 -0800 (PST) (envelope-from david) Date: Sat, 23 Jan 2021 17:51:18 -0800 From: David Wolfskill To: "Russell L. Carter" Cc: freebsd-current@freebsd.org Subject: Re: Which branch in git is 13.0-current? Message-ID: Mail-Followup-To: David Wolfskill , "Russell L. Carter" , freebsd-current@freebsd.org References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="GZS1iXHAig7n6P75" Content-Disposition: inline In-Reply-To: <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> X-Rspamd-Queue-Id: 4DNbZP4dq2z3lYW X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of david@catwhisker.org designates 107.204.234.170 as permitted sender) smtp.mailfrom=david@catwhisker.org X-Spamd-Result: default: False [-2.54 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; FREEFALL_USER(0.00)[david]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:107.204.234.170]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; DMARC_NA(0.00)[catwhisker.org]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.204.234.170:from]; NEURAL_SPAM_SHORT(0.86)[0.856]; SPAMHAUS_ZRD(0.00)[107.204.234.170:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 01:51:26 -0000 --GZS1iXHAig7n6P75 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sat, Jan 23, 2021 at 06:34:58PM -0700, Russell L. Carter wrote: > ... > > That is correct, 13-stable has been branched from 13-current which has = now > > been bumped to 14-current. > > Because it's a major version change going from 13 to 14, pkg is a bit > > agitated regarding the ABI. >=20 > So has anyone tracking stable/12 and ports successfully completed the > git checkout stable/13; make buildworld; make installworld; mergemaster > drill? I see I can checkout stable/13. With the substitution of "etcupdate" for "mergemaster," yes. Mind, I am using ports built under stable/12: I have installed the misc/compat12x port. (My build machine is presently running poudriere under: FreeBSD freebeast.catwhisker.org 13.0-ALPHA2 FreeBSD 13.0-ALPHA2 #1162 stab= le/13-c256208-gf76393a6305b: Sat Jan 23 07:09:19 PST 2021 root@freebeas= t.catwhisker.org:/common/S3/obj/usr/src/amd64.amd64/sys/GENERIC amd64 1300= 136 1300136 building packages for stable/13. I don't plan to use them right away; this is mostly a bit of a stress-test for stable/13: bapt@ called it "poudriere" for at least one good reason.) Current status: [13amd64-ports-home] [2021-01-23_22h27m11s] [parallel_build:] Queued: 1038 = Built: 568 Failed: 0 Skipped: 0 Ignored: 0 Tobuild: 470 Time: 0= 3:21:46 > Do make.conf | src.conf | GENERIC have silent breaking changes? > I usually, recklessly, assume no. My build machine (builds and) runs a GENERIC kernel. It also builds a couple of other kernels for stable/12 and stable/13; no issues with either. > Ima throw the build->install as soon as the drill looks good. >=20 > Russell > .... I admit to having cheated a fair bit: I have also been tracking head. So last night, I "cloned" my "head" slice for use for stable/13; there was little to change, once that was done. (Yes, I use MBR/BIOS booting.) Boring details: * History: https://www.catwhisker.org/~david/FreeBSD/history/ * How I do stuff: https://www.catwhisker.org/~david/FreeBSD/upgrade.html * How I keep sources in sync: https://www.catwhisker.org/~david/FreeBSD/repo-sync.html Peace, david --=20 David H. Wolfskill david@catwhisker.org So Lindsey Graham thinks that Trump's incitement of the Capitol mob on 6 Jan should be without consequences? Graham suppoprts what the mob did??!? See https://www.catwhisker.org/~david/publickey.gpg for my public key. --GZS1iXHAig7n6P75 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGTBAEBCgB9FiEE4owz2QxMJyaxAefyQLJg+bY2PckFAmAM0pVfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldEUy OEMzM0Q5MEM0QzI3MjZCMTAxRTdGMjQwQjI2MEY5QjYzNjNEQzkACgkQQLJg+bY2 PckVmgf/TU2KxyXonNPL1H4V2igS9yD+tkfX5p4AB7nBFZeADpTo746VB6Z3xP+V oKwYIEPYtg+8q3muQ7g1MIaxIJy6PK3fxq+O+dBFJoGk/utR4/o149nw6p1OARa3 1Yae+3PdyIXHXVSi1mgDoMNcfRyUCHqnhKkATPjNqJCj3bEKi7LMJi3QSEuteExi OMTzkNbqeZYDZ6G1Ufa6S12I7aZd4ma/biAJGI/ikyCRHJHKFmjPrQ4CJRu38feh I8AtzFMOhJGbruqvNxMC0JYqvF4/NLCdeqmP7vAB5YhJjpcJvkP3Kaz0G2bdxAY1 yG94iMT7tqlaeKbmCsZ2+RIS7tUeSQ== =holI -----END PGP SIGNATURE----- --GZS1iXHAig7n6P75-- From owner-freebsd-current@freebsd.org Sun Jan 24 01:53:11 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 07B3A4E6728 for ; Sun, 24 Jan 2021 01:53:11 +0000 (UTC) (envelope-from donaldwillinger@gmail.com) Received: from mail-lf1-x134.google.com (mail-lf1-x134.google.com [IPv6:2a00:1450:4864:20::134]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNbcP6YJcz3lP9 for ; Sun, 24 Jan 2021 01:53:09 +0000 (UTC) (envelope-from donaldwillinger@gmail.com) Received: by mail-lf1-x134.google.com with SMTP id i187so2645312lfd.4 for ; Sat, 23 Jan 2021 17:53:09 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=fQoxHWM5PhmOQOegtiINP2+0bjaGR5tK2l1UcPZP+no=; b=t/Yp1BF3YgPVBDJpcO/jaj5b3IGHOlbtkIaewDoBCaRpGp4WSgsPoG+5ILalOTu+v4 Q8MepEp+8XMUrUNYWLp1rUQhBs4jdUidjafxt2xup2n7M/bm9i0vufkC3eyZifB5PlBr 7K82MamUFP3g7JRebGERqZQdfvT3bMRBPktsOhzTB5boWKDoE/zo0lkUiEdrpnv/tX4w uvvz1vmal15KGvy/CYbObQBBF0NGr3lTTuOA85ipZBH1TxslmDQs3u58r6U+hRP/80U4 PfUuBNgB61ZakVwRor9DYv/3rK8d48ilIi+JuJAn0f1Dei5d/h0zwFMtJW9vjbup4yw7 WmLA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=fQoxHWM5PhmOQOegtiINP2+0bjaGR5tK2l1UcPZP+no=; b=PiFfftz2oCdfePk9QXNjzHHuENKVqsSIc247KHBchCwmxgWNULj3SxREKgWQgpnbLf QIoJSZ8SiJt/wwhUOIaLmMKgB1uUau2uQj2AEx1i01l0Vbc6cqkOn8hmpkq0TinKtwes u4JKUyESErE+ubUuxmHfCMqHotN5Fu8UL5g1MHzkDB6mZqBoDl77jCRzdirjg6mBmEBs 6C20KYCgJanmJrlflMSf2GlMeXUOl2tRNGcb20e7WQbScfndgnsEqOtgOUrqW8FXdl6D FPcJCf5l/ZiJVDVeVg2WI/xmvhJMrejSUiCt615uZFXhtfblHL3jN763avzUGcY19lfN B7og== X-Gm-Message-State: AOAM530BosD/1ntxofcwnBcvThLt4YU061t6LDI07PQsfQps5ZFcmbqP bbIArQGBIFBkBc0V3k2QSwQtm2mTYNGCiSwafXhXv/Q3IlY= X-Google-Smtp-Source: ABdhPJxzabJ+ilKOc+0Pvgr8B+7qRtpehkR0PqgT6QTCxHEzJvpLBmToywAys3mHQcpkejjM/kgb3skSKmabeaqUkgo= X-Received: by 2002:ac2:5f05:: with SMTP id 5mr526609lfq.127.1611453188268; Sat, 23 Jan 2021 17:53:08 -0800 (PST) MIME-Version: 1.0 References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> In-Reply-To: From: Donald Willinger Date: Sat, 23 Jan 2021 19:52:57 -0600 Message-ID: Subject: Re: Which branch in git is 13.0-current? To: David Wolfskill , "Russell L. Carter" , freebsd-current@freebsd.org X-Rspamd-Queue-Id: 4DNbcP6YJcz3lP9 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=t/Yp1BF3; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of donaldwillinger@gmail.com designates 2a00:1450:4864:20::134 as permitted sender) smtp.mailfrom=donaldwillinger@gmail.com X-Spamd-Result: default: False [-2.82 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.82)[-0.823]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::134:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::134:from:127.0.2.255]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::134:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 01:53:11 -0000 Look for 14-current. There is no more 13. as I understand it. On Sat, Jan 23, 2021 at 7:51 PM David Wolfskill wrote: > On Sat, Jan 23, 2021 at 06:34:58PM -0700, Russell L. Carter wrote: > > ... > > > That is correct, 13-stable has been branched from 13-current which has > now > > > been bumped to 14-current. > > > Because it's a major version change going from 13 to 14, pkg is a bit > > > agitated regarding the ABI. > > > > So has anyone tracking stable/12 and ports successfully completed the > > git checkout stable/13; make buildworld; make installworld; mergemaster > > drill? I see I can checkout stable/13. > > With the substitution of "etcupdate" for "mergemaster," yes. > > Mind, I am using ports built under stable/12: I have installed the > misc/compat12x port. > > (My build machine is presently running poudriere under: > > FreeBSD freebeast.catwhisker.org 13.0-ALPHA2 FreeBSD 13.0-ALPHA2 #1162 > stable/13-c256208-gf76393a6305b: Sat Jan 23 07:09:19 PST 2021 > root@freebeast.catwhisker.org:/common/S3/obj/usr/src/amd64.amd64/sys/GENERIC > amd64 1300136 1300136 > > building packages for stable/13. I don't plan to use them right > away; this is mostly a bit of a stress-test for stable/13: bapt@ > called it "poudriere" for at least one good reason.) > > Current status: > > [13amd64-ports-home] [2021-01-23_22h27m11s] [parallel_build:] Queued: 1038 > Built: 568 Failed: 0 Skipped: 0 Ignored: 0 Tobuild: 470 Time: > 03:21:46 > > > > Do make.conf | src.conf | GENERIC have silent breaking changes? > > I usually, recklessly, assume no. > > My build machine (builds and) runs a GENERIC kernel. It also builds > a couple of other kernels for stable/12 and stable/13; no issues > with either. > > > Ima throw the build->install as soon as the drill looks good. > > > > Russell > > .... > > I admit to having cheated a fair bit: I have also been tracking head. > > So last night, I "cloned" my "head" slice for use for stable/13; there > was little to change, once that was done. (Yes, I use MBR/BIOS > booting.) > > Boring details: > > * History: https://www.catwhisker.org/~david/FreeBSD/history/ > > * How I do stuff: https://www.catwhisker.org/~david/FreeBSD/upgrade.html > > * How I keep sources in sync: > https://www.catwhisker.org/~david/FreeBSD/repo-sync.html > > Peace, > david > -- > David H. Wolfskill david@catwhisker.org > So Lindsey Graham thinks that Trump's incitement of the Capitol mob on 6 > Jan > should be without consequences? Graham suppoprts what the mob did??!? > > See https://www.catwhisker.org/~david/publickey.gpg for my public key. > From owner-freebsd-current@freebsd.org Sun Jan 24 01:59:22 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8DF434E6A42 for ; Sun, 24 Jan 2021 01:59:22 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNblY2BCGz3mJ6 for ; Sun, 24 Jan 2021 01:59:21 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.16.1/8.15.2) with ESMTP id 10O1xJ9A079437; Sun, 24 Jan 2021 01:59:19 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.16.1/8.16.1/Submit) id 10O1xJ7d079436; Sat, 23 Jan 2021 17:59:19 -0800 (PST) (envelope-from david) Date: Sat, 23 Jan 2021 17:59:19 -0800 From: David Wolfskill To: Donald Willinger Cc: freebsd-current@freebsd.org Subject: Re: Which branch in git is 13.0-current? Message-ID: Mail-Followup-To: David Wolfskill , Donald Willinger , freebsd-current@freebsd.org References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="HPk9hfAP6jzM1SZX" Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DNblY2BCGz3mJ6 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of david@catwhisker.org designates 107.204.234.170 as permitted sender) smtp.mailfrom=david@catwhisker.org X-Spamd-Result: default: False [-2.49 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.204.234.170:from]; FREEFALL_USER(0.00)[david]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:107.204.234.170:c]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; RCVD_TLS_LAST(0.00)[]; DMARC_NA(0.00)[catwhisker.org]; NEURAL_SPAM_SHORT(0.91)[0.910]; SPAMHAUS_ZRD(0.00)[107.204.234.170:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 01:59:22 -0000 --HPk9hfAP6jzM1SZX Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sat, Jan 23, 2021 at 07:52:57PM -0600, Donald Willinger wrote: > Look for 14-current. There is no more 13. as I understand it. > .... head is 14. stable/13 and stable/12 also exist: FreeBSD freebeast.catwhisker.org 12.2-STABLE FreeBSD 12.2-STABLE #1144 stab= le/12-c243280-g4493b69d4aa: Sat Jan 23 03:33:26 PST 2021 root@freebeast= =2Ecatwhisker.org:/common/S1/obj/usr/src/amd64.amd64/sys/GENERIC amd64 120= 2505 1202505 FreeBSD freebeast.catwhisker.org 13.0-ALPHA2 FreeBSD 13.0-ALPHA2 #1162 stab= le/13-c256208-gf76393a6305b: Sat Jan 23 07:09:19 PST 2021 root@freebeas= t.catwhisker.org:/common/S3/obj/usr/src/amd64.amd64/sys/GENERIC amd64 1300= 136 1300136 FreeBSD freebeast.catwhisker.org 14.0-CURRENT FreeBSD 14.0-CURRENT #1162 ma= in-c256217-g6c789c55c4ba: Sat Jan 23 05:10:49 PST 2021 root@freebeast.c= atwhisker.org:/common/S4/obj/usr/src/amd64.amd64/sys/GENERIC amd64 1400000= 1400000 Peace, david --=20 David H. Wolfskill david@catwhisker.org So Lindsey Graham thinks that Trump's incitement of the Capitol mob on 6 Jan should be without consequences? Graham suppoprts what the mob did??!? See https://www.catwhisker.org/~david/publickey.gpg for my public key. --HPk9hfAP6jzM1SZX Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGTBAEBCgB9FiEE4owz2QxMJyaxAefyQLJg+bY2PckFAmAM1HdfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldEUy OEMzM0Q5MEM0QzI3MjZCMTAxRTdGMjQwQjI2MEY5QjYzNjNEQzkACgkQQLJg+bY2 PcnaFwgAgZ7312WmSRAJzp48zWhJkoS2nS7G38gcGm2ub9pF5b3SWJfugfsB2VqV Ofd1rCZRkmHMJJciI9Hh89RZVBaFKmjFOGpHVz9MxIuXx1i8Jfo1ddljBpppEYku 5jPNx4saRAKS5KW2t8lK1pkunJd1pCNNE0tlymc6F+Vofl9hqLKqNUM/wrlRYkXV VN37GQdiFnv/1LAzo+jvSl8sQrLZShCnI41y2HnQer0eY9lFCmMtXMNstH5wFMb9 eZxsvioWAldaXl7g0z1Dm8DC0kxdb52Dw6eUhJKbcd8Z1/d8XhGmLHvPCy/F+4mr o4cG5XXBnxqBNH4KZwHLvERPYHVg2Q== =DL+k -----END PGP SIGNATURE----- --HPk9hfAP6jzM1SZX-- From owner-freebsd-current@freebsd.org Sun Jan 24 02:09:15 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7E7064E6B5B for ; Sun, 24 Jan 2021 02:09:15 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNbyz35Nnz3mf1; Sun, 24 Jan 2021 02:09:15 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from weatherwax.trouble.is (weatherwax.trouble.is [IPv6:2a00:1098:82:3a::1]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "weatherwax.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 46798E890; Sun, 24 Jan 2021 02:09:15 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from rincewind.trouble.is (rincewind.trouble.is [IPv6:2a01:4f9:2a:1715::1:1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (4096 bits)) (Client CN "rincewind.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) by weatherwax.trouble.is (Postfix) with ESMTPS id 4DNbyy4F5Vz1whr; Sun, 24 Jan 2021 02:09:14 +0000 (UTC) Received: by rincewind.trouble.is (Postfix, authenticated sender philip) id 4DNbyw1Wtcz6F8q; Sun, 24 Jan 2021 02:09:11 +0000 (UTC) From: "Philip Paeps" To: "Graham Perrin" Cc: "Ed Maste" , "Li-Wen Hsu" , "Ulrich =?utf-8?q?Sp=C3=B6rlein?=" , "Warner Losh" , freebsd-current@freebsd.org Subject: Re: Beta Git repo for ports Date: Sun, 24 Jan 2021 10:09:08 +0800 X-Clacks-Overhead: GNU Terry Pratchett X-Mailer: MailMate (1.14r5757) Message-ID: <3010C3E4-9CB3-4C16-8F01-CDB76A45FC26@freebsd.org> In-Reply-To: <142a3cd9-7f20-7285-b713-3d53ff36a633@gmail.com> References: <142a3cd9-7f20-7285-b713-3d53ff36a633@gmail.com> MIME-Version: 1.0 Content-Type: text/plain; format=flowed Content-Transfer-Encoding: quoted-printable X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 02:09:15 -0000 On 2021-01-22 14:24:47 (+0800), Graham Perrin wrote: > Via = > = > : > > > > Please: where to file enhancement requests (or bugs) for development = > of this cgit service for ports? > > Is there a GitHub repo where issues might be raised? Or, are group = > e-mails (all four of you) preferred? The git@freebsd.org mailing list has been very responsive to = suggestions. That's probably a good place for them. Philip -- = Philip Paeps Senior Reality Engineer Alternative Enterprises From owner-freebsd-current@freebsd.org Sun Jan 24 02:20:55 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3322A4E7170 for ; Sun, 24 Jan 2021 02:20:55 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qk1-x72a.google.com (mail-qk1-x72a.google.com [IPv6:2607:f8b0:4864:20::72a]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNcDR0Y6Bz3nFd for ; Sun, 24 Jan 2021 02:20:55 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qk1-x72a.google.com with SMTP id n15so4631769qkh.8 for ; Sat, 23 Jan 2021 18:20:55 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=QHWPOPO1BUGBByQcbmO9W2QhObhx0LIvnyLaO1MT9zE=; b=qNx6z9JuGaB73JjmVBHQaquyh/n3wUhVgjQRbt+7tCcvKnkTVOTGlihiBxEeRJRxcT LwEWsoSvHN9ZBb7LQhxQXAH0EzaAn6US1eO9rHZpp/IjPQymG+cSNQiwEezvs2CK9QNj 0Vam3kKNJdu6htVz/d7fPYbu0oLnMG3vbNgqHsn63nhJaKdzJXRmFXJrv68u5Sonov1p qcD4gljHzjRUvR0a0uRcBZzOKTgVBUIUeHAhXgDq/DZzwB+805VN/yQmJFxzWQl8JSrL mPOxRAGX6H6fllgWrHnLq5kGYkPUmuOfxQoHGVdvxOC6xVaAssdRqxhHSxIllnRdMkJX CtlA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=QHWPOPO1BUGBByQcbmO9W2QhObhx0LIvnyLaO1MT9zE=; b=jrxa5Kzjw6vhberyS6OXOlp94S7ZRSVa4rKenQwhm2oHbTWWsVveOO2msZqUXI39Wm JFRsWXtYWjhJus3u24hpqns3CKKesLmRn8RMPjifXoNNtqDhZyfqgFJhqk1XsIL2eToi W0ukDGQOyqOi2A70+Ka6hiM52uQX6H1Mb8k637c1prryoAd+9c0Z0tFnlRFG+lWU2pid G3dBnG9FCoY3XTki3nP1fHIco3AdCP8lYK5E+Gf0KE2OxkkSwP4rL80c5+ey9kJLzhkN HmlDhltWH+EWRlnB9M4GqcGw8diccWxglXNs0aq/laA2TH5wWXpvP3N0EwNXtE3FLr0e /58A== X-Gm-Message-State: AOAM533xBD7As8LxoNC26xGymY/wYZ2fwKXt2P5Us8zAXQURMcHxpMjw ZYU7XPasjgp7W3Pp6lj4UORseYDVY9znIJFK1KK5oQ== X-Google-Smtp-Source: ABdhPJz728Y/ToYDofEPpvNfw6Q1rXnfkRRoM+xTwEJiqIgUw1aH9xcG/O8wbw2vUPRC16B8gpRNc3PORb5C6RD2LfM= X-Received: by 2002:a05:620a:883:: with SMTP id b3mr3134243qka.359.1611454853957; Sat, 23 Jan 2021 18:20:53 -0800 (PST) MIME-Version: 1.0 References: <142a3cd9-7f20-7285-b713-3d53ff36a633@gmail.com> <3010C3E4-9CB3-4C16-8F01-CDB76A45FC26@freebsd.org> In-Reply-To: <3010C3E4-9CB3-4C16-8F01-CDB76A45FC26@freebsd.org> From: Warner Losh Date: Sat, 23 Jan 2021 19:20:42 -0700 Message-ID: Subject: Re: Beta Git repo for ports To: Philip Paeps Cc: Graham Perrin , Ed Maste , Li-Wen Hsu , =?UTF-8?Q?Ulrich_Sp=C3=B6rlein?= , Warner Losh , freebsd-current@freebsd.org X-Rspamd-Queue-Id: 4DNcDR0Y6Bz3nFd X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 02:20:55 -0000 On Sat, Jan 23, 2021, 7:09 PM Philip Paeps wrote: > On 2021-01-22 14:24:47 (+0800), Graham Perrin wrote: > > Via > > < > https://www.freebsd.org/news/status/report-2020-10-2020-12.html#Git-Migration-Working-Group> > > > : > > > > > > > > Please: where to file enhancement requests (or bugs) for development > > of this cgit service for ports? > > > > Is there a GitHub repo where issues might be raised? Or, are group > > e-mails (all four of you) preferred? > > The git@freebsd.org mailing list has been very responsive to > suggestions. That's probably a good place for them. > Yes... that's the best place. Warner Philip > > -- > Philip Paeps > Senior Reality Engineer > Alternative Enterprises > From owner-freebsd-current@freebsd.org Sun Jan 24 02:36:32 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 218404E77FC for ; Sun, 24 Jan 2021 02:36:32 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (phouka1.phouka.net [107.170.196.116]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "phouka.net", Issuer "Go Daddy Secure Certificate Authority - G2" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNcZQ246Zz3nlG for ; Sun, 24 Jan 2021 02:36:30 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (localhost [127.0.0.1]) by phouka1.phouka.net (8.16.1/8.16.1) with ESMTPS id 10O2ZCrx000982 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sat, 23 Jan 2021 18:35:12 -0800 (PST) (envelope-from warlock@phouka1.phouka.net) Received: (from warlock@localhost) by phouka1.phouka.net (8.16.1/8.16.1/Submit) id 10O2ZCdI000981; Sat, 23 Jan 2021 18:35:12 -0800 (PST) (envelope-from warlock) Date: Sat, 23 Jan 2021 18:35:12 -0800 From: John Kennedy To: "Russell L. Carter" Cc: freebsd-current@freebsd.org Subject: Re: Which branch in git is 13.0-current? Message-ID: References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> X-Rspamd-Queue-Id: 4DNcZQ246Zz3nlG X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of warlock@phouka1.phouka.net has no SPF policy when checking 107.170.196.116) smtp.mailfrom=warlock@phouka1.phouka.net X-Spamd-Result: default: False [-0.80 / 15.00]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[phouka.net]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.170.196.116:from]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[107.170.196.116:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[warlock@phouka.net,warlock@phouka1.phouka.net]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MIME_TRACE(0.00)[0:+]; FROM_NEQ_ENVFROM(0.00)[warlock@phouka.net,warlock@phouka1.phouka.net]; ASN(0.00)[asn:14061, ipnet:107.170.192.0/18, country:US] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 02:36:32 -0000 On Sat, Jan 23, 2021 at 06:34:58PM -0700, Russell L. Carter wrote: > So has anyone tracking stable/12 and ports successfully completed the > git checkout stable/13; make buildworld; make installworld; mergemaster > drill? I see I can checkout stable/13. > > Do make.conf | src.conf | GENERIC have silent breaking changes? > I usually, recklessly, assume no. > > Ima throw the build->install as soon as the drill looks good. I've done it about 3x now, from different stages of 12.2. Don't have any kernel modules from ports loaded, usually end up doing the world+kernel thing twice due to some libraries going away, then rebuild all ports. I've continued to use mergemaster, but there is a thread talking about it going towards obsolete. From owner-freebsd-current@freebsd.org Sun Jan 24 03:59:02 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 06E2D4EA472 for ; Sun, 24 Jan 2021 03:59:02 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNfPc4PGgz3wGd for ; Sun, 24 Jan 2021 03:59:00 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10O3wrhp073668 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO) for ; Sat, 23 Jan 2021 19:58:53 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10O3wqKm073667 for freebsd-current@freebsd.org; Sat, 23 Jan 2021 19:58:52 -0800 (PST) (envelope-from sgk) Date: Sat, 23 Jan 2021 19:58:52 -0800 From: Steve Kargl To: freebsd-current@freebsd.org Subject: Getting /usr/src to match specific git hash? Message-ID: <20210124035852.GA73653@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline X-Rspamd-Queue-Id: 4DNfPc4PGgz3wGd X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-2.00 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; MAILMAN_DEST(0.00)[freebsd-current]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM, none] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 03:59:02 -0000 Suppose one has an empty /usr/src. Suppose further that one had to re-install a 32-bit i386-*-freebsd with the 24 Dec 2020 image available from freebsd.org. uname -a for the booted kernel shows % uname -a FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i386 How does one use git to pull the exact sources that match this specifc kernel? -- Steve From owner-freebsd-current@freebsd.org Sun Jan 24 04:08:52 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 855094EAF4D for ; Sun, 24 Jan 2021 04:08:52 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNfcz1Xvyz4RWN for ; Sun, 24 Jan 2021 04:08:51 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id B1B174D35E for ; Sun, 24 Jan 2021 13:08:44 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611461324; bh=XLj7V1hNJwmsqZIRHhTgGtfjJ0OO86MP9MGQHN2UH90=; h=Date:To:Subject:From:In-Reply-To:References; b=CaFzVRl8DaHgHIItF6VFsJP1xJh7E8BDkaqJ5MQiI5I8HeTatrZX7hd//wAAHqv2Y 89ge6g6cFIh/g3QZCVv0zHv6/XH4HjZQBeU0YP7g2XGMirRW9DQwuv2L+whOn3/mbt GLAU5d0sb0JdmXj4B3ljR34k26fXTy57viF/jyM8UF/45l5U5Nx+PYX2PE2JAkqCKh nDL5ojJ8/i3JMVXbD/djoux0Z5HSaa7senQi2D4Ack4F4ixHWYCrnMsYXBGen67Rxi Xjb6TceB16P8CSayYgltJe1MMES7ceslDZFs5t/N7G3kLcSkKR7LCFSyJ1wkBk7Kk4 QexphVOhMjR4g== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 70E214BFCD; Sun, 24 Jan 2021 13:08:42 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Sun, 24 Jan 2021 13:08:05 +0900 (JST) Message-Id: <20210124.130805.532159532765637026.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: Getting /usr/src to match specific git hash? From: Yasuhiro Kimura In-Reply-To: <20210124035852.GA73653@troutmask.apl.washington.edu> References: <20210124035852.GA73653@troutmask.apl.washington.edu> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DNfcz1Xvyz4RWN X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=CaFzVRl8; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [0.30 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[utahime.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 04:08:52 -0000 From: Steve Kargl Subject: Getting /usr/src to match specific git hash? Date: Sat, 23 Jan 2021 19:58:52 -0800 > Suppose one has an empty /usr/src. > > Suppose further that one had to re-install a 32-bit > i386-*-freebsd with the 24 Dec 2020 image available > from freebsd.org. > > uname -a for the booted kernel shows > > % uname -a > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i386 > > How does one use git to pull the exact sources that match > this specifc kernel? cd /usr git clone https://git.freebsd.org/src.git cd src git checkout 3cc0c0d66a0 --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Sun Jan 24 04:12:43 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 756064EB1DC for ; Sun, 24 Jan 2021 04:12:43 +0000 (UTC) (envelope-from truckman@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNfjR2wlrz4SF8; Sun, 24 Jan 2021 04:12:43 +0000 (UTC) (envelope-from truckman@FreeBSD.org) Received: from mousie.catspoiler.org (unknown [76.212.85.177]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client did not present a certificate) (Authenticated sender: truckman) by smtp.freebsd.org (Postfix) with ESMTPSA id BD7B6F908; Sun, 24 Jan 2021 04:12:42 +0000 (UTC) (envelope-from truckman@FreeBSD.org) Date: Sat, 23 Jan 2021 20:12:40 -0800 (PST) From: Don Lewis Subject: Re: Getting /usr/src to match specific git hash? To: Yasuhiro Kimura cc: freebsd-current@freebsd.org In-Reply-To: <20210124.130805.532159532765637026.yasu@utahime.org> Message-ID: References: <20210124035852.GA73653@troutmask.apl.washington.edu> <20210124.130805.532159532765637026.yasu@utahime.org> MIME-Version: 1.0 Content-Type: TEXT/PLAIN; CHARSET=us-ascii Content-Disposition: INLINE X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 04:12:43 -0000 On 24 Jan, Yasuhiro Kimura wrote: > From: Steve Kargl > Subject: Getting /usr/src to match specific git hash? > Date: Sat, 23 Jan 2021 19:58:52 -0800 > >> Suppose one has an empty /usr/src. >> >> Suppose further that one had to re-install a 32-bit >> i386-*-freebsd with the 24 Dec 2020 image available >> from freebsd.org. >> >> uname -a for the booted kernel shows >> >> % uname -a >> FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ >> 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ >> root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i386 >> >> How does one use git to pull the exact sources that match >> this specifc kernel? > > cd /usr > git clone https://git.freebsd.org/src.git > cd src > git checkout 3cc0c0d66a0 And don't take the git warning about having a detached HEAD as a criticism. From owner-freebsd-current@freebsd.org Sun Jan 24 04:14:06 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9561A4EB5C6 for ; Sun, 24 Jan 2021 04:14:06 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNfl0730fz4STQ for ; Sun, 24 Jan 2021 04:14:04 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10O4E32e073782 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sat, 23 Jan 2021 20:14:03 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10O4E39K073781; Sat, 23 Jan 2021 20:14:03 -0800 (PST) (envelope-from sgk) Date: Sat, 23 Jan 2021 20:14:03 -0800 From: Steve Kargl To: Yasuhiro Kimura Cc: freebsd-current@freebsd.org Subject: Re: Getting /usr/src to match specific git hash? Message-ID: <20210124041403.GB73653@troutmask.apl.washington.edu> References: <20210124035852.GA73653@troutmask.apl.washington.edu> <20210124.130805.532159532765637026.yasu@utahime.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20210124.130805.532159532765637026.yasu@utahime.org> X-Rspamd-Queue-Id: 4DNfl0730fz4STQ X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-2.00 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; MAILMAN_DEST(0.00)[freebsd-current]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM, none] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 04:14:06 -0000 On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > From: Steve Kargl > Subject: Getting /usr/src to match specific git hash? > Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > Suppose one has an empty /usr/src. > > > > Suppose further that one had to re-install a 32-bit > > i386-*-freebsd with the 24 Dec 2020 image available > > from freebsd.org. > > > > uname -a for the booted kernel shows > > > > % uname -a > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i386 > > > > How does one use git to pull the exact sources that match > > this specifc kernel? > > cd /usr > git clone https://git.freebsd.org/src.git > cd src > git checkout 3cc0c0d66a0 > Thank you. -- Steve From owner-freebsd-current@freebsd.org Sun Jan 24 05:37:27 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 291A74EE3BE for ; Sun, 24 Jan 2021 05:37:27 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic315-8.consmr.mail.gq1.yahoo.com (sonic315-8.consmr.mail.gq1.yahoo.com [98.137.65.32]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNhb96FH4z4Xrg for ; Sun, 24 Jan 2021 05:37:25 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611466644; bh=WMPuVEU+5Uay9Tbr/iAqoSmNPCNUM6W/3uJnB8LNP8w=; h=From:Subject:Date:To:From:Subject:Reply-To; b=AkgkvwI1h0GHoIQoPBzKuutgtR9BcfqUXdpsjuzWMNil5MDl11PaLUo6EiPRrc5kfucjNwFR6AWzrHnkPJJB9i0OuYj5aRIWZ/UZ4TFDZpOaafi/AU6fOCfVlqbITrgAURnqWMrrATUgqDRFNfIERTdBugAzj04q4SHM2XqCb9RG+s5LBTNW6ij4fHw+B9hdJO9+xdHzQiJPknPUX7VwRe90tiF9iQvou4WnihLgiSAAXfAoWOg9jKE8BsLx/18Tqs7vNe9Oy8QctM/JsM9axxEpEN3Moi5doQp37IQJQCBLpy8u+YPcLIP4QOwz6OcoouysmRfT/MFX5tyA9Wqo7g== X-YMail-OSG: Icc371MVM1lj6Yb9ywqui6pnOUK5B8Kk8WhS2iTo.B4VeVw7q8dt4RcS_2oYbOQ FzxXwsenRzyBl_2RY5zHKt8y2Z.HV_oC3tne4eUXxhjlqIBcKtg6pG8CrrAgPOWY7XmyMJlBuhUO 0zFT6FbTiA2dNdt3H66JcZLOXBssaKk9TEH4_gIEjNjULSLTKgMmiSDcZ2XEyT986fBg1bNb4eMi QItXEfUqZbTeCmJ8ML10MlsPVv5FA9Neb_fTAQ.w0H4Z4twhZ65a1u1Z1RsnGswJZP75s8yByNqL 0aoSYWaAOQ12aaJqlGeVvxm5u1TwZzRjsNA1lvbLgFMveqV8vDCr_duatQ9xJPeBEGDNBrJXljQy dG5G7uBx146C6CKCRf.HmY9hGdkQBshLpyeuzGZocPNDP17rNxFOJMVm3.uu6qRjGXpEumVo3Kxb tTF4RqrkIQunptYAfVUl2azw76DZsjxCpoNMVcPD9svKTBT60ZU3d6LUzHimzm.zUm_JQLVn.0QJ DBxvFoeiAb5SvPEt3811q_92YqT4kxPp6bIeBvcTNjSuyH4TkHZIWV4RMAbC5Az2obIXTf5v0VIC l3i5wKR2KibJ0T.oIGYOCw__3iDTn0aiYxx4vVDVcWAl54.UWKkkkOre99oPd3bnYHk.2SKnje8Y 5nhDAalC1zcWKe79rfHYvFjP1iVQ28fWtH54ULSUvaVQsTN3TBbRcMTUPKXFq3LGBLpjuN8lMULj I_YUEu1uHvzuYuVY9MJblBSa_7GDsO.JuZWzxmO6QFKrPuogvsmL12z3Nw98QOwPoJuaHAd9ySgz bkGDIgxj6wt8m3GWkJLC9P8av7pTmimywZzkZItui71LGHGYxJFTsovP8v3f8Y235MKcMnGYzSXp 0ZY2W4yiJTMCrFV0emYicWGtxl7SXmZMJv3lzFHuyK_twRB2_3mcW6P4JkIeFDq3AZdTCs5MOCt1 w67o391FEV0De5xB2FYniO0xGBjAsvXoX2Ctp6ECzuaIPWairbkqXEwS7UCyqFEwqq1FT_i0qhYX DYT75jqz7RlxvQdc4h5X3jdukzH4pidbXmyqOwQ8KY8xkzbeKW7m7Ycy3Nzo9g.MRfZVrR54PYc5 h52Ql.eCOQwzawosRjXDk8MtcvPs33cjazNeBpqEn0CNW.ZSiWpjXwxaejnfnuajia8efLnvRHz7 4vCrwdeFy9Kecoab_w7jfMisQ0WvRJrwW9b2QltYpLMbC0Ex1o2fLAmIL3XYaMaWXMkqopfp9uCj zJjGBGxB5AI5uO_uii7YDnbqmajfVxzQ..1JillbKQRIPgyXvvep7qRu6Ak1LNFey5d.x30w0qS. 2Rvu21MXmsrwNkQ5DLz0w5qzLGaL2uuRZS5JozeDNEbSBaqAj1OR88fixr8Oy4xjS42AJTSAdHwK mtOG6lWpj1NeCKtOwUDIWNf532R4cn34hmyfRaraP.jlN2FPTP53JOLl3CKpy29gCdhdMe4Y7ymg ryyjhsIUX_RACY2_wrFIC5qz.D6glGan5c5bSjOQqzAaB33Bhpc24fkGtNPVOKQ7IcZOB3XwABsY RxQ93Veyc2Q5sY1p4mp5HrSXjWg95ZOVOxBpWE3OCTnr7WjMzueFVCuCQLj8DbUsL5IezjTa6dkK dm8kVk01rJGVWFmj._ZFYOAhb.4G_vAoJoyKqfH3LBWwgwMZ_ghgMwa.20y9XAiEPfD.VtledQrI _S8DzwI.wELt61tJGzoC.RF5liOqjMER93l3UHhia4Wz2wq3IhYx2FxYQ9QtjPkqceYZzfbT0UJ3 10OBgUFbaBWv6uOjm3yUX1stimviWKGxzHdxIaj4KTK9oevd6GmgoaDLwppH4oCOVze7KEWHgy4l rFJEaLG1sWBA0xI3YhLzTm0byRHvgeQeunDOJZGc79EV9kdjFQ0LQubkZRZjN0k.yTcmYc9ZM84W PbuPgYxoUfzNn8agmldDbwi8FGC9RXYTONcp6ur2Tzg_daaLqa6edcueLjpgvFiOdaq3xlSH1xyg kCvB6L9TUKmN2DLi9uzG.sLOFHcZcn5Flj9KbUdvDsB.Jk5KMU5e1PgC0t63NSfdCblClZ0MUb8k 46owz1JhqQyEkAnPEd1gruRvdKGKOPrV97P29nGM3QriU6hCPcr6KeMjfjXw5ywzN2m5Jvf6Ntn6 IEfnsIYrSUrga_kQXMJpkNBuiev4OVxsC1BaJZEqOEXC9uaiuoQFflaQxoV3DROMPjgN4c0dcuQU DFtilvucfRZyseArP0KQQEe28g7JxgyQKJVSZzrqBajf2dmSfblhIaDKqny7mRAXGHzfeCgc22DE mvC6JqUUOL0VKtiWBfs4eg2KWS9f_i._libUzaExJbmT..Hqjqyt3uXTzEDLbtogGpiDPIK7oaXu naOhfReYdZb3lgQVs77L7ST8ddTodLYbUlDXvUZ9fYJzyKCi5CKwNEwCQTCltn4uxjfBmQT2zLzV b6qj.wwNOadHXhcvykQreW99SIaBVCLHSwlMjhssZjQrWAn6x0w3Y68_Ldwv6PfIlZdz9y4jsp_p d7iIn5Jfok5y0xun6V..pwClcqgd6z68JP71XG7GtrB24QpTQ Received: from sonic.gate.mail.ne1.yahoo.com by sonic315.consmr.mail.gq1.yahoo.com with HTTP; Sun, 24 Jan 2021 05:37:24 +0000 Received: by smtp402.mail.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID df6dad13eca8db57ec662aa5742876c2; Sun, 24 Jan 2021 05:37:22 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: FYI: Why META_MODE rebuilds so much for building again after installworld (no source changes) Date: Sat, 23 Jan 2021 21:37:19 -0800 References: To: Bryan Drewery , Current FreeBSD In-Reply-To: Message-Id: <3345EBA5-A09C-4E3F-B94D-39F57F56BDBB@yahoo.com> X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Rspamd-Queue-Id: 4DNhb96FH4z4Xrg X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.95 / 15.00]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-0.45)[-0.454]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.65.32:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.65.32:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.65.32:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.65.32:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 05:37:27 -0000 On 2021-Jan-22, at 01:45, Mark Millard wrote: > Given an already built, installed and booted system version, I've > noted a big difference for META_MODE in 2 rebuild contexts (no > source updates involved): >=20 > *) Prior buildworld buildkernel, installkernel, installworld, boot > presumed before (A) and before (B) below. >=20 > A) make . . . buildworld buildkernel > make . . . buildworld buildkernel > (the 2nd buildworld buildkernel in (A) builds far less than the = first) > (that means that the first built more than I would have guessed) >=20 > vs. >=20 > B) make . . . buildworld buildkernel > make . . . installworld > make . . . buildworld buildkernel > (the 2nd buildworld buildkernel in (B) builds far more than it did = in (A)) > (so, more like the 1st buildworld buildkernel in (A) and (B), given > the specified prior context) >=20 > So I used make -dM for the commented buildworld buildkernel lines, = logging > the build output and later diff'ing them. >=20 > Result that I noticed? Lots of lines uniquely from (B)'s case, ending = with > one of: >=20 > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/awk' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/cap_mkdb' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/cat' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/cp' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/crunchgen' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/crunchide' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/dd' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/egrep' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/env' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/file2c' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/gencat' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/grep' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/gzip' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/jot' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/lex' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/ln' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/m4' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/mv' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/patch' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/rm' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/sed' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/sh' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/touch' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/truncate' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/uudecode' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/uuencode' is newer than the target... > file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/xargs' is newer than the target... >=20 > The lines with these lead to more files being updated and so causing = more > indirect rebuild activity (that cascades). >=20 > Many/most/all(?) of these seem to me to be unlikely to actually need = to > contribute to what needs to be rebuilt (just based on being newer). So > the option to ignore (some of?) them could be useful in making = META_MODE > builds quicker. The following from one of the .meta files makes the point that rm use in the example is unlikely to be important to needing to rebuild, despite it actually causing a file rebuild. Nor is the specific echo command listed relevant. Only the "ar" command is: # Meta data file = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/lib/libc++/li= bc++.a.meta CMD @echo building static c++ library CMD @rm -f libc++.a CMD ar -crsD libc++.a algorithm.o any.o atomic.o barrier.o bind.o = charconv.o chrono.o condition_variable.o condition_variable_destructor.o = debug.o exception.o filesystem/directory_iterator.o filesyste m/int128_builtins.o filesystem/operations.o functional.o future.o hash.o = ios.o iostream.o locale.o memory.o mutex.o mutex_destructor.o new.o = optional.o random.o random_shuffle.o regex.o shared_mutex.o stdexcept.o string.o strstream.o system_error.o thread.o typeinfo.o = utility.o valarray.o variant.o vector.o cxxrt_auxhelper.o = cxxrt_dynamic_cast.o cxxrt_exception.o cxxrt_guard.o = cxxrt_libelftc_dem_g nu3.o cxxrt_memory.o cxxrt_stdexcept.o cxxrt_terminate.o = cxxrt_typeinfo.o CWD = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/lib/libc++ TARGET libc++.a -- command output -- building static c++ library -- filemon acquired metadata -- # filemon version 5 # Target pid 22471 # Start 1611359217.214996 V 5 E 22961 /bin/sh R 22961 /etc/libmap.conf R 22961 /var/run/ld-elf.so.hints R 22961 /lib/libedit.so.7 R 22961 /lib/libc.so.7 R 22961 /lib/libncursesw.so.9 R 22961 /usr/share/locale/C.UTF-8/LC_CTYPE F 22961 22962 E 22962 = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/us= r/sbin/rm R 22962 /etc/libmap.conf R 22962 /var/run/ld-elf.so.hints R 22962 /lib/libc.so.7 R 22962 /usr/share/locale/C.UTF-8/LC_CTYPE D 22962 libc++.a X 22962 0 0 . . . The timestamp on . . ./tmp/legacy/usr/sbin/rm is not actually relevant to if libc++.a needs to be rebuilt. Of course, the structure also point out the judgment is specific to understanding the sequence of CMD's listed above. Only a hack of ignoring, not recording, or commenting out the filemon lines ending in /tmp/legacy/usr/sbin/rm would seem to avoid the @rm handling issue. Such might well have its own risks. Some other /tmp/legacy/usr/sbin/* filemon line endings likely would have a similar status of being a reference to a file that could(/should?) have its timestamp relationship not checked. =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Sun Jan 24 10:11:40 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A433A4F600F for ; Sun, 24 Jan 2021 10:11:40 +0000 (UTC) (envelope-from ish@amail.plala.or.jp) Received: from msc11.plala.or.jp (msc11.plala.or.jp [60.36.166.21]) by mx1.freebsd.org (Postfix) with ESMTP id 4DNpgZ4fZFz4n2J for ; Sun, 24 Jan 2021 10:11:37 +0000 (UTC) (envelope-from ish@amail.plala.or.jp) Received: from localhost ([2400:4050:9320:7a00::8]) by msc11.plala.or.jp with ESMTP id <20210124101134.SJV7418.msc11.plala.or.jp@localhost> for ; Sun, 24 Jan 2021 19:11:34 +0900 Date: Sun, 24 Jan 2021 19:11:28 +0900 (JST) Message-Id: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> To: freebsd-current@freebsd.org Subject: pkg for 14-current From: Masachika ISHIZUKA X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-VirusScan: Outbound; mvir-ac11; Sun, 24 Jan 2021 19:11:34 +0900 X-Rspamd-Queue-Id: 4DNpgZ4fZFz4n2J X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of ish@amail.plala.or.jp designates 60.36.166.21 as permitted sender) smtp.mailfrom=ish@amail.plala.or.jp X-Spamd-Result: default: False [-1.70 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[60.36.166.21:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; MV_CASE(0.50)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[60.36.166.21:from:127.0.2.255]; DMARC_NA(0.00)[plala.or.jp]; R_SPF_ALLOW(-0.20)[+ip4:60.36.166.0/24]; NEURAL_HAM_LONG(-1.00)[-0.999]; NEURAL_HAM_SHORT(-1.00)[-1.000]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[60.36.166.21:from]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:4713, ipnet:60.32.0.0/12, country:JP]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 10:11:40 -0000 Hi. I updated to 14-current from 13-current and reinstalled ports-mgmt/pkg. I cannot get meta files for 14-current. How can I use pkg on 14-current ? > # pkg update > Updating FreeBSD repository catalogue... > pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/meta.txz: Not Found > repository FreeBSD has no meta file, using default settings > pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/packagesite.txz: Not Found > Unable to update repository FreeBSD > Error updating repositories! -- Masachika ISHIZUKA From owner-freebsd-current@freebsd.org Sun Jan 24 10:19:06 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 318B54F63E2 for ; Sun, 24 Jan 2021 10:19:06 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNpr912ZPz4nLq for ; Sun, 24 Jan 2021 10:19:04 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id 8880A4D428 for ; Sun, 24 Jan 2021 19:18:58 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611483538; bh=WGLBbahS3Mvf3y3lz3wb7EEef1a0FsLDbGLiAN6S/4g=; h=Date:To:Subject:From:In-Reply-To:References; b=dMUPbBmQlwycboEoOMXLjFv3oWoJFznvQFujRCBDNw6uuOc6WPiTx+WRYXFHWksE6 f1NjlLgcPgLEudJ7LuViVTT+kajRewyz/0c0svVSEdo+cGs8/Y0L/gC4DTdoH1ZbA9 rba/5Z7EPDU1uHAdzsYIqAm8aghVOl77e5ZEQMVQJG4SZE+lJLbCzONGaq1nD13lK8 aJ1m+5jYoP1oZ/Ae+yCZ485zLZzxcdWyjrax4EXVh0BBPjVNHqcBhqFpSYhhGug2hj NhJfmxwp/u46HmblZ4UZ4AEP0h1iGPtoTqrArMCo4KvK7z1UESlcd0uYw6cvDGW7pA faVVXaMDJF6oA== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 0B6E24C240; Sun, 24 Jan 2021 19:18:56 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Sun, 24 Jan 2021 19:18:29 +0900 (JST) Message-Id: <20210124.191829.1703374243123280023.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: pkg for 14-current From: Yasuhiro Kimura In-Reply-To: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> References: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DNpr912ZPz4nLq X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=dMUPbBmQ; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [-0.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[utahime.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 10:19:06 -0000 From: Masachika ISHIZUKA Subject: pkg for 14-current Date: Sun, 24 Jan 2021 19:11:28 +0900 (JST) > Hi. > > I updated to 14-current from 13-current and reinstalled ports-mgmt/pkg. > I cannot get meta files for 14-current. > How can I use pkg on 14-current ? > >> # pkg update >> Updating FreeBSD repository catalogue... >> pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/meta.txz: Not Found >> repository FreeBSD has no meta file, using default settings >> pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/packagesite.txz: Not Found >> Unable to update repository FreeBSD >> Error updating repositories! All what you can do is to wait until build of offical packages for 14-CURRENT has completed unless you build them by yourself. --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Sun Jan 24 10:45:41 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 15E844F6E5E for ; Sun, 24 Jan 2021 10:45:41 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNqQr2bSdz4q0k for ; Sun, 24 Jan 2021 10:45:40 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id 4FA684D42A for ; Sun, 24 Jan 2021 19:45:36 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611485136; bh=LblQKWH6Zkl416TDJarTRnXkM1vTP49cnkf0h/Fmu+0=; h=Date:To:Subject:From:In-Reply-To:References; b=p/H/AAsZ/i2K1r2RnXUngRrinzOs2Rk7QJGbKEsVm5JI6i85OzlgSZQzWAODkAXbT 0WyPbpGa5IuDGafOssM+Vqh+SlTYoD8LSZ/GSbwO2e8VMcnSP/U5CP0SsA1AwO0wcz dTGPmdQjLrhbwiek/HA3MDrNoz2nj2fspC/W5BUdKF6IRsBuhZL4aQXY4RwWaGvwH1 fO4IBrsFnSGyWyblNAC/q0v9EyTy0VCcVvrIi7bT1e7BH+n250MNVeXAoGRAw2BuJe qDRWIH4ZqXFdTgev1wO1JudOTI/Uv1BLiNu9R53zQ3DmyVLMIsVWYkqO9OAvrjZ8hY u+Pbqixp9jLmA== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384)) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 2C7C74C2BE; Sun, 24 Jan 2021 19:45:35 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Sun, 24 Jan 2021 19:45:08 +0900 (JST) Message-Id: <20210124.194508.2045909391762657611.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: pkg for 14-current From: Yasuhiro Kimura In-Reply-To: <20210124.191829.1703374243123280023.yasu@utahime.org> References: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> <20210124.191829.1703374243123280023.yasu@utahime.org> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DNqQr2bSdz4q0k X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=p/H/AAsZ; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [-0.55 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org:c]; MV_CASE(0.50)[]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-0.85)[-0.847]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[utahime.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 10:45:41 -0000 From: Yasuhiro Kimura Subject: Re: pkg for 14-current Date: Sun, 24 Jan 2021 19:18:29 +0900 (JST) >> I updated to 14-current from 13-current and reinstalled ports-mgmt/pkg. >> I cannot get meta files for 14-current. >> How can I use pkg on 14-current ? >> > All what you can do is to wait until build of offical packages for > 14-CURRENT has completed unless you build them by yourself. By the way, when -CURRENT was bumped from 12 to 13, there were some ports that failed to be built on 13-CURRENT simply because they don't expect there is version 13.x of FreeBSD. And probably such ports fails to be built on 14-CURRENT with same reason. So it may takes for a while until offical packages for 14-CURRENT are provided with same level as 13-CURRENT. --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Sun Jan 24 11:01:30 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8039D4F7A82 for ; Sun, 24 Jan 2021 11:01:30 +0000 (UTC) (envelope-from guyyur@gmail.com) Received: from mail-ej1-x631.google.com (mail-ej1-x631.google.com [IPv6:2a00:1450:4864:20::631]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNqn31JG0z4qtn; Sun, 24 Jan 2021 11:01:26 +0000 (UTC) (envelope-from guyyur@gmail.com) Received: by mail-ej1-x631.google.com with SMTP id l9so13874317ejx.3; Sun, 24 Jan 2021 03:01:26 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=KFhPjl8gqVO2T/NOgiPX3opBZkz7GS+f8cpiHwsrr/Q=; b=PvD4hsj7eNnQq5nPTcOkTYgQ7si9ojGYTMiAMn52my/oewqKNAFRAGJGc6GAr3Z9LH W5aMjYxT11RssXb9xvukHK1TerlcsE870DKnzO9NR0vHtLZ70EZkWtgoyA96dUB72KY5 y55KaC0eKziyN9ob0sLqiNmVXRk3SOy1EWRCh8Gdh+6SmwUd0Wvqt/BEke23CsNqATZ0 +2DBocq0jD3qIpjxjCYaQzZl48MzsbIrSdulgWE2AsZ6iXHsV+a7tJZbBOWFmZgsWU6V LSrahh0S0kzQbuVuWT1XEUqiF2KlV5gC8dlpTH1ZsldmGnZpR7sQ6WYqTN99XR971jNC D02A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=KFhPjl8gqVO2T/NOgiPX3opBZkz7GS+f8cpiHwsrr/Q=; b=NNnwdnm3TwDMqeGE4UMRbij2q2dLJOtMAi2/THyzJX6Vksi34emCxaU5CeRKqNZ/sL OwGPSwtgwiKe/mjS8ZxwfdcVriBquTVUmFHQda2wSMA5yqIbIjhTvKi1jM577d+kxeH6 zLYeJPqc2Be5O0hMF0DwYgj9cZRUXA/d9DCf/hH7tnOKrho8sLKw34Kwwp4CTLD9zkHA Ab4TN9GjKo2vsHNjKuQonujXtFlN4XVG1xbR15YPLBFcgiGu2qiRpbSiLRQByZ/lXsAN b/QapnO3ki3rG3A4B3k+tygquTcWvg/trCaA4ALyD+xgPLTcjqrJ4PJ8eLicZHMr+2q6 1PPA== X-Gm-Message-State: AOAM533YQ9yIExTYCX0NUEJiC0xFWE0mqwOQ2u+EEuizXKD9cjK/S7oY VmxvAoj2LorGUuMKZDmKss4op2tY0Y0= X-Google-Smtp-Source: ABdhPJxDOsnKcj3Qj/FHI3nLFD/sMqaYOBFreln3eVFnIdZOyHdQIChEI2ZC3guoPPqodZrFNPPlIQ== X-Received: by 2002:a17:906:3ac3:: with SMTP id z3mr180919ejd.449.1611486085434; Sun, 24 Jan 2021 03:01:25 -0800 (PST) Received: from ?IPv6:2a02:ed0:5dbf:5101:cff0:631e:e16e:a35f? ([2a02:ed0:5dbf:5101:cff0:631e:e16e:a35f]) by smtp.gmail.com with ESMTPSA id s3sm1055662ejn.47.2021.01.24.03.01.24 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sun, 24 Jan 2021 03:01:24 -0800 (PST) Subject: Re: adding existing ipv6 network route returns ENOMEM instead of EEXIST if loopback route also exists To: "Alexander V. Chernikov" , "freebsd-current@freebsd.org" References: <9b1bb259-1307-7776-cc0b-e7a8eced6ac3@gmail.com> <4229351606302594@mail.yandex.ru> From: Guy Yur Message-ID: <1fc009db-196f-f196-c115-c4a85f81f209@gmail.com> Date: Sun, 24 Jan 2021 13:01:23 +0200 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <4229351606302594@mail.yandex.ru> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-US X-Rspamd-Queue-Id: 4DNqn31JG0z4qtn X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=PvD4hsj7; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of guyyur@gmail.com designates 2a00:1450:4864:20::631 as permitted sender) smtp.mailfrom=guyyur@gmail.com X-Spamd-Result: default: False [-3.46 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.46)[-0.458]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::631:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::631:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::631:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 11:01:30 -0000 Hi, On 25/11/20 1:12 pm, Alexander V. Chernikov wrote: > 21.11.2020, 22:48, "Guy Yur" : >> Hi, >> >> When adding a route with a netmask, add_route() in route_ctl.c >> adds the route with destination address masked. >> If the add failed (for example, the route exists) it calls >> lookup_prefix() with the original unmasked destination. > Thank you for the report! Indeed, there is a problem w.r.t non-masked dst handling. > I'll look into that in the end of this week. Did you get a chance to look at it? I am currently using a workaround of setting RTAX_DST to the masked address before the call to lookup_prefix in add_route(): info->rti_info[RTAX_DST] = rt_key(rt); /* addition failed. Lookup prefix in the rib to determine the cause */ rt_orig = lookup_prefix(rnh, info, &rnd_orig); >> In a scenario where a loopback route was added followed >> by the network route being added, if the network route >> is added again and the network route destination is the >> same as the loopback route, lookup_prefix() will match on >> the loopback route, not finding the network route and >> add_route() will return ENOMEM instead of EEXIST. >> Adding the route with just the network part returns EEXIST as expected. >> >> Example: >> # route -6 add -host fd53::1111 -prefixlen 128 ::1 >> # route -6 add -net fd53::1111 -prefixlen 64 ::1 >> # route -6 add -net fd53::1111 -prefixlen 64 ::1 >> route: writing to routing socket: Cannot allocate memory >> add net fd53::1111: gateway ::1 fib 0: Cannot allocate memory >> # route -6 add -net fd53:: -prefixlen 64 ::1 >> add net fd53::: gateway ::1 fib 0: route already in table >> >> I was testing https://reviews.freebsd.org/D15406 >> changes applied to r367863. >> The changes call rtinit to add prefix route when >> interface address is added/updated and uses the >> interface address as the destination. >> rtinit returned ENOMEM instead of EEXIST >> causing dhcpcd to printCannot allocate memory. >> >> route commands above showing the problem were run >> in r367863 without D15406 changesas well. >> >> Thanks, >> Guy Yur >> >> _______________________________________________ >> freebsd-current@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-current >> To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" Thanks, Guy Yur From owner-freebsd-current@freebsd.org Sun Jan 24 12:11:09 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4C8994F9D0B for ; Sun, 24 Jan 2021 12:11:09 +0000 (UTC) (envelope-from donaldwillinger@gmail.com) Received: from mail-ot1-x32b.google.com (mail-ot1-x32b.google.com [IPv6:2607:f8b0:4864:20::32b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNsKS3GF7z3BqN for ; Sun, 24 Jan 2021 12:11:08 +0000 (UTC) (envelope-from donaldwillinger@gmail.com) Received: by mail-ot1-x32b.google.com with SMTP id n42so9938665ota.12 for ; Sun, 24 Jan 2021 04:11:08 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=message-id:subject:from:to:cc:date:in-reply-to:references :user-agent:mime-version:content-transfer-encoding; bh=t9HElsL1Bltarkzmuv0bSS0fPtxdkKZlhrkzLtt1VuY=; b=RG0oJLDp2BeISUdPtAcnoADFsA7N+Isy40IlC3NkFLmnGgjQXjF0n7/VtsBo10Ltb3 nBP65bPDP/WsId+BXjhL8K/i4JpjdjnKdrmd8Db6nVfx0I1Xf5m4DdyvaVMsrzescQtd q3LZV8jGJub6bASOM2QVLhhw81PPNmeNexH5XoMH8xcU8cg/XY66r14+kOOWytaAcY3C 2b1DtMka3S86snzRQLypyNDgAwJCOh9bTP0rda58dpoqcJ1zzro/xC5gBwgitQzmpeZw CHPmPbfEwgErlv+0x1tFh3t14/1QgzV91q9hS8PR3IOVfT6kf5GNZpXvBhjNsfSdY28X IrQg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:message-id:subject:from:to:cc:date:in-reply-to :references:user-agent:mime-version:content-transfer-encoding; bh=t9HElsL1Bltarkzmuv0bSS0fPtxdkKZlhrkzLtt1VuY=; b=Fy2wygaIANdlAn5n667DsQF/+Jq59aQpdM7vpjgVZ3y7oQkZNfegH5Ae3gOUoTocOA ZnBRg/3xcXwl8yjzUnsb0zzbw/I70QMUSVUHY4kaJRME74PjGXSXN9G7/8nWJqEXLBJg gxI0rFgSy7yp6Pj8J+tTcTSaO385MAsFS7UoDrKwVWr+yteAsepBK7zvbI3KmEcHgmD4 VMkx3+dfypQVhEQdu3m8nDgtpWxcrUutJJ4lmmWNAH1aolR2O+kiE9mUlfd3sZYX6Meq oEc0f5tkdF7nR2k3PiDzOWed501Drij7AV02lBAZ9VpQz6ZBXVnnweKYreF5RFRrnMSq FPQA== X-Gm-Message-State: AOAM5315mmWUTTNXrrPu8IKBSrCeVkjmhioF8R+tr1M9Rqc2cd07UU7W LPVMOyiIUH/TGBnSnBkT8lVgr9eYq1PUzGCW X-Google-Smtp-Source: ABdhPJwg7cz/tFL3yclrm2sOdbXb518kA8PpkH8yAiWJ3GiwpSnvQO3Y8br5awUs5PFbwkZAklTPIw== X-Received: by 2002:a9d:ae7:: with SMTP id 94mr5145595otq.94.1611490267116; Sun, 24 Jan 2021 04:11:07 -0800 (PST) Received: from ?IPv6:2600:380:7e2b:2581:ab0b:a09:b3b7:f1fe? ([2600:380:7e2b:2581:ab0b:a09:b3b7:f1fe]) by smtp.gmail.com with ESMTPSA id m20sm666751otn.63.2021.01.24.04.11.05 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sun, 24 Jan 2021 04:11:06 -0800 (PST) Message-ID: <926ce0f9809f8e1767762ce2663840fa31528e61.camel@gmail.com> Subject: Re: Which branch in git is 13.0-current? From: donaldwillinger@gmail.com To: David Wolfskill , "Russell L. Carter" Cc: freebsd-current@freebsd.org Date: Sun, 24 Jan 2021 06:11:04 -0600 In-Reply-To: References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> Content-Type: text/plain; charset="UTF-8" User-Agent: Evolution 3.38.0 MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4DNsKS3GF7z3BqN X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=RG0oJLDp; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of donaldwillinger@gmail.com designates 2607:f8b0:4864:20::32b as permitted sender) smtp.mailfrom=donaldwillinger@gmail.com X-Spamd-Result: default: False [-3.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::32b:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::32b:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; FROM_NO_DN(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::32b:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 12:11:09 -0000 I'm happy the number was changed. To many, the number "13" is considered to be bad luck. On Sat, 2021-01-23 at 17:51 -0800, David Wolfskill wrote: > On Sat, Jan 23, 2021 at 06:34:58PM -0700, Russell L. Carter wrote: > > ... > > > That is correct, 13-stable has been branched from 13-current > > > which has now > > > been bumped to 14-current. > > > Because it's a major version change going from 13 to 14, pkg is a > > > bit > > > agitated regarding the ABI. > > > > So has anyone tracking stable/12 and ports successfully completed > > the > > git checkout stable/13; make buildworld; make installworld; > > mergemaster > > drill?  I see I can checkout stable/13. > > With the substitution of "etcupdate" for "mergemaster," yes. > > Mind, I am using ports built under stable/12: I have installed the > misc/compat12x port. > > (My build machine is presently running poudriere under: > > FreeBSD freebeast.catwhisker.org 13.0-ALPHA2 FreeBSD 13.0-ALPHA2 > #1162 stable/13-c256208-gf76393a6305b: Sat Jan 23 07:09:19 PST > 2021     > root@freebeast.catwhisker.org:/common/S3/obj/usr/src/amd64.amd64/sys/ > GENERIC  amd64 1300136 1300136 > > building packages for stable/13.  I don't plan to use them right > away; this is mostly a bit of a stress-test for stable/13: bapt@ > called it "poudriere" for at least one good reason.) > > Current status: > > [13amd64-ports-home] [2021-01-23_22h27m11s] [parallel_build:] Queued: > 1038 Built: 568  Failed: 0    Skipped: 0    Ignored: 0    Tobuild: > 470   Time: 03:21:46 > > > > Do make.conf | src.conf | GENERIC have silent breaking changes? > > I usually, recklessly, assume no. > > My build machine (builds and) runs a GENERIC kernel.  It also builds > a couple of other kernels for stable/12 and stable/13; no issues > with either. > > > Ima throw the build->install as soon as the drill looks good. > > > > Russell > > .... > > I admit to having cheated a fair bit: I have also been tracking head. > > So last night, I "cloned" my "head" slice for use for stable/13; > there > was little to change, once that was done.  (Yes, I use MBR/BIOS > booting.) > > Boring details: > > * History: https://www.catwhisker.org/~david/FreeBSD/history/ > > * How I do stuff: > https://www.catwhisker.org/~david/FreeBSD/upgrade.html > > * How I keep sources in sync: >   https://www.catwhisker.org/~david/FreeBSD/repo-sync.html > > Peace, > david From owner-freebsd-current@freebsd.org Sun Jan 24 12:35:04 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E8FCF4FA417 for ; Sun, 24 Jan 2021 12:35:04 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNss4130xz3D1s for ; Sun, 24 Jan 2021 12:35:03 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.16.1/8.15.2) with ESMTP id 10OCZ2gm001760; Sun, 24 Jan 2021 12:35:02 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.16.1/8.16.1/Submit) id 10OCZ2S2001759; Sun, 24 Jan 2021 04:35:02 -0800 (PST) (envelope-from david) Date: Sun, 24 Jan 2021 04:35:02 -0800 From: David Wolfskill To: donaldwillinger@gmail.com Cc: freebsd-current@freebsd.org Subject: Re: Which branch in git is 13.0-current? Message-ID: Reply-To: current@freebsd.org Mail-Followup-To: current@freebsd.org, donaldwillinger@gmail.com, freebsd-current@freebsd.org References: <86h7n7a9jx.fsf@gmail.com> <000001d6f1a8$dcd03280$96709780$@gmail.com> <86ft2ra80q.fsf@gmail.com> <004101d6f1ac$62a619d0$27f24d70$@gmail.com> <2a44aadc-7588-5bee-ac95-38b6b26f5ba4@pinyon.org> <926ce0f9809f8e1767762ce2663840fa31528e61.camel@gmail.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="4WM8ckU26FjxZFH1" Content-Disposition: inline In-Reply-To: <926ce0f9809f8e1767762ce2663840fa31528e61.camel@gmail.com> X-Rspamd-Queue-Id: 4DNss4130xz3D1s X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of david@catwhisker.org designates 107.204.234.170 as permitted sender) smtp.mailfrom=david@catwhisker.org X-Spamd-Result: default: False [-4.40 / 15.00]; HAS_REPLYTO(0.00)[current@freebsd.org]; R_SPF_ALLOW(-0.20)[+ip4:107.204.234.170:c]; TO_DN_NONE(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; SIGNED_PGP(-2.00)[]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.204.234.170:from]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEFALL_USER(0.00)[david]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; SUBJECT_ENDS_QUESTION(1.00)[]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; DMARC_NA(0.00)[catwhisker.org]; SPAMHAUS_ZRD(0.00)[107.204.234.170:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 12:35:05 -0000 --4WM8ckU26FjxZFH1 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Jan 24, 2021 at 06:11:04AM -0600, donaldwillinger@gmail.com wrote: > I'm happy the number was changed. To many, the number "13" is > considered to be bad luck. > .... It was not "changed" for that reason. It's a natural progression from 11 to 12 to 13 to 14 (to 15 ...). It's the way stable/* branches of FreeBSD are created: they are branched off of head ("main") in sequence. "13" is the most recent (and still nascent, at this stage of development) stable branch; as a result, head is now designated as "14". Peace, david --=20 David H. Wolfskill david@catwhisker.org So Lindsey Graham thinks that Trump's incitement of the Capitol mob on 6 Jan should be without consequences? Graham suppoprts what the mob did??!? See https://www.catwhisker.org/~david/publickey.gpg for my public key. --4WM8ckU26FjxZFH1 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGTBAEBCgB9FiEE4owz2QxMJyaxAefyQLJg+bY2PckFAmANaXZfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldEUy OEMzM0Q5MEM0QzI3MjZCMTAxRTdGMjQwQjI2MEY5QjYzNjNEQzkACgkQQLJg+bY2 PclX2wgAh0yQkgJeyvjj1B51/yGzH4UrbArIUsQBB99vrGDyfdldcCOvRrY5KAuN so1/n6H+H014ltc/o4IRMX8pOSJPLKHgKZlU20ascqkNkWWIphfm4Njs+wvb9YwA czhavqDjDvxn9Wl4yZpPtpqS1ruEI8NlgOKWuhNzLQM66fLi2G8lF9ucqEt1B6ga oAJ93WYw8vFb2WoBuykSHz6S+TE5UdHIayyOi0hXofu+E1HDZCOQ9dzM8qYFIAZ9 6Sum66kF/IBmVtMRA+fw9xkTGFur5istpmWPkUBv2L6vPmk5MN1DobKOF02X9hZQ KptaGAygKNUJO7nc7CjW5XhTi8dcBA== =9OFo -----END PGP SIGNATURE----- --4WM8ckU26FjxZFH1-- From owner-freebsd-current@freebsd.org Sun Jan 24 12:51:20 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2AEDD4FB1B9 for ; Sun, 24 Jan 2021 12:51:20 +0000 (UTC) (envelope-from jbeich@freebsd.org) Received: from freefall.freebsd.org (freefall.freebsd.org [96.47.72.132]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "freefall.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNtCr0q7jz3FM0; Sun, 24 Jan 2021 12:51:20 +0000 (UTC) (envelope-from jbeich@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1611492680; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=qWasEaoeHPClx5M2BqJcxnhBfX2iWuGuP2rvoIldqvQ=; b=uFeg7mTUHN4WBz3TmoeEI4JRhzPr2bEarmWC5rXtwoVMXuGzn1u4rGySMM1lQ3eJMRrNRe riKR+GaLGTI6Dq4VfB9GYLWLhcWlF8KCPBH+/LbqFOU6ufQorJWSNzDE6OKsyGShlYGMpw 66rLDgTqXsqgSL1vKhIXFU6HZ5md8l3GNCCw4qbJ6BWfjX2qjukT1K/mHaW9pv4kroPvOc 6aK9HJOrrrrO9Dst0RPz6bfMGHydkjRC+whoZYajv3MUIPbDjNcKdVHPz1hSEFGzpI2NCd lOYszRLPu6fKAG5d4mmeJ1WOn3v/yJLSi5GoD4FnFJrAU6GbSjUSj+bd0TMi9w== Received: by freefall.freebsd.org (Postfix, from userid 1354) id 03A72E6C8; Sun, 24 Jan 2021 12:51:19 +0000 (UTC) From: Jan Beich To: Yasuhiro Kimura Cc: freebsd-current@freebsd.org Subject: Re: pkg for 14-current References: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> <20210124.191829.1703374243123280023.yasu@utahime.org> Date: Sun, 24 Jan 2021 13:51:17 +0100 In-Reply-To: <20210124.191829.1703374243123280023.yasu@utahime.org> (Yasuhiro Kimura's message of "Sun, 24 Jan 2021 19:18:29 +0900 (JST)") Message-ID: MIME-Version: 1.0 Content-Type: text/plain ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1611492680; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=qWasEaoeHPClx5M2BqJcxnhBfX2iWuGuP2rvoIldqvQ=; b=nlZrDL+017GErN+RDKM1T6G0zesKw931Ocl4uvuWybVHchPTN8ejgvzT1atIQ9BWIJ3+/E 3nJzvcDFnOf3p1h+mqnvxPH2aNkZQQRJ/lSbostc1ifozNezGSK8Ns/KayFd/shk7YaSHr AgP/Ve5StwDAZw3ymYWiq7yHUoENvm8fbVlHqWEMoGdr8hhfhE/cmA6oU0bGKQvW3xbZwW 5GC5ly4Uj01kBPwT+uJ24pKsGRgNSHdu+UbBEqdrhdnmWu8rBQ58IV0BIp2xzRwLOi0bgI 3zOZdeN5b6hbqoSsmTf165BKO9vK08Xly6Nb7jB8N++CglhNgaqY0ZRcEp4D5A== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1611492680; a=rsa-sha256; cv=none; b=Y+Rq2IHx8nnQHOQIxIZ8z2uT1JbYVoKh2eHM6JDcV0pDCbgUNQ+NhPSfiL9ehbXIzu2+SL mde28SFAQxY2lgJNc93wsaQe0ZxvzqbQS3SUE8vXGZ3GZ69e6VpNDv/lEDehDLpEzxB8/i 5wMhTFKtHJIu58CMU9dRfhq3q9fv9h6kgrSo56wq/c8AIdpabRirGCCg7ozZUrtCBg4BaD GZfKFihnw1rm4U5daag4y55/YfQTPKNWzNVv0r0WkuCl6fIGzxm5MZqPBI+KqMv0ZH3PLp Y6TVrpYjbsDVJh+6wrrRuK4A6/5txRCpRI9sRe8gM0CLo/MR8vJOp3JVKfReeQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 12:51:20 -0000 Yasuhiro Kimura writes: G> From: Masachika ISHIZUKA > Subject: pkg for 14-current > Date: Sun, 24 Jan 2021 19:11:28 +0900 (JST) > >> Hi. >> >> I updated to 14-current from 13-current and reinstalled ports-mgmt/pkg. >> I cannot get meta files for 14-current. >> How can I use pkg on 14-current ? >> >>> # pkg update >>> Updating FreeBSD repository catalogue... >>> pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/meta.txz: Not Found >>> repository FreeBSD has no meta file, using default settings >>> pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/packagesite.txz: Not Found >>> Unable to update repository FreeBSD >>> Error updating repositories! > > All what you can do is to wait until build of offical packages for > 14-CURRENT has completed unless you build them by yourself. Or temporarily redefine ABI as a workaround e.g., $ env ABI=FreeBSD:13:amd64 pkg install chromium From owner-freebsd-current@freebsd.org Sun Jan 24 13:05:38 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D97FF4FB947 for ; Sun, 24 Jan 2021 13:05:38 +0000 (UTC) (envelope-from jbtakk@iherebuywisely.com) Received: from aibo.runbox.com (aibo.runbox.com [91.220.196.211]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNtXK2qhvz3GMl for ; Sun, 24 Jan 2021 13:05:37 +0000 (UTC) (envelope-from jbtakk@iherebuywisely.com) Received: from [10.9.9.127] (helo=rmmprod05.runbox) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1l3f52-0002g0-NF; Sun, 24 Jan 2021 14:05:24 +0100 Received: from mail by rmmprod05.runbox with local (Exim 4.86_2) (envelope-from ) id 1l3f52-0004th-MB; Sun, 24 Jan 2021 14:05:24 +0100 Content-Type: text/plain; charset="utf-8" Content-Disposition: inline Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 Received: from [Authenticated alias (650894)] by runbox.com with http (RMM6); Sun, 24 Jan 2021 13:05:24 GMT From: "Jeffrey Bouquet" To: "Steve Kargl" CC: "Yasuhiro Kimura" , "freebsd-current" Subject: Re: Getting /usr/src to match specific git hash? Date: Sun, 24 Jan 2021 05:05:24 -0800 (PST) X-RMM-Aliasid: 650894 X-Mailer: RMM6 In-Reply-To: <20210124041403.GB73653@troutmask.apl.washington.edu> Message-Id: X-Rspamd-Queue-Id: 4DNtXK2qhvz3GMl X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of jbtakk@iherebuywisely.com has no SPF policy when checking 91.220.196.211) smtp.mailfrom=jbtakk@iherebuywisely.com X-Spamd-Result: default: False [-1.20 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; RWL_MAILSPIKE_GOOD(0.00)[91.220.196.211:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[iherebuywisely.com]; RBL_DBL_DONT_QUERY_IPS(0.00)[91.220.196.211:from]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[91.220.196.211:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:50304, ipnet:91.220.196.0/24, country:NO]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_IN_DNSWL_LOW(-0.10)[91.220.196.211:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 13:05:38 -0000 On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl wrote: > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > > From: Steve Kargl > > Subject: Getting /usr/src to match specific git hash? > > Date: Sat, 23 Jan 2021 19:58:52 -0800 > >=20 > > > Suppose one has an empty /usr/src. > > >=20 > > > Suppose further that one had to re-install a 32-bit > > > i386-*-freebsd with the 24 Dec 2020 image available > > > from freebsd.org. > > >=20 > > > uname -a for the booted kernel shows > > >=20 > > > % uname -a > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i= 386 > > >=20 > > > How does one use git to pull the exact sources that match > > > this specifc kernel? > >=20 > > cd /usr > > git clone https://git.freebsd.org/src.git > > cd src > > git checkout 3cc0c0d66a0 > >=20 >=20 > Thank you. >=20 > --=20 > Steve > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" Can this be put in /usr/src/UPDATING with an explanation of precisely how e= ach of the git commands populates or repopulated the directories in /usr???=20 From owner-freebsd-current@freebsd.org Sun Jan 24 13:35:45 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 130864FC587; Sun, 24 Jan 2021 13:35:45 +0000 (UTC) (envelope-from mj-mailinglist@gmx.de) Received: from mout.gmx.net (mout.gmx.net [212.227.17.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNvC32pq0z3HWZ; Sun, 24 Jan 2021 13:35:43 +0000 (UTC) (envelope-from mj-mailinglist@gmx.de) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1611495341; bh=TicyhXrpcCrncQ6+eSiPOH+3TlzhAcldsDPwb5N1rJ0=; h=X-UI-Sender-Class:From:To:Subject:Date; b=iJ2ea9trC+dN8vstKHfoVT3ytgvxEIlWme8U/vmRtZImgdJFXCoAIpi3CJgQoXLkE 0DepQ8Do9n0FEkzolAMxE9GrRoHXoJbGCa7vfzEWOhiWJqMjUV39P17E+i5gc40w9l 2W9T5S8YzaoBZY2pd5AjBkJ3iItwScNYCYpuNdaw= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from [46.142.71.81] ([46.142.71.81]) by web-mail.gmx.net (3c-app-gmx-bs28.server.lan [172.19.170.80]) (via HTTP); Sun, 24 Jan 2021 14:35:40 +0100 MIME-Version: 1.0 Message-ID: From: mj-mailinglist@gmx.de To: freebsd-current@freebsd.org, freebsd-questions@freebsd.org Subject: Files in /usr/share/misc Content-Type: text/plain; charset=UTF-8 Date: Sun, 24 Jan 2021 14:35:40 +0100 Importance: normal Sensitivity: Normal X-Priority: 3 X-Provags-ID: V03:K1:ISv4oLg8e1H77UfrDSztUNqR9+NVrJrvv5HcHWBAxlcfxQoXkaBzFUWgIHYxOJSjWNkl1 +JKZcCQY9kutskfooyREOGqvchBHsA0gEgxbe8c3Cn0YxewrEvmXcWVGyWaY4jbwWOmnBHY2Dml2 w9m2TCRgRjQWR/E7IOMlDSOtOmq4QBAqU4TXrNldYK9uaRZsjveRSJtZ4sCL0z4GJ1EUVxsGdU2L B3qM3CqTqUEo5FbZ1vnhXix1z6i+GfhqiFu+OvNACbhiKaUhlLhRjqyBa5XNyvC4jCTKZLVzJEQW C0= X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:8nONIhfqpLg=:OEwWyMZDi6jqqiHc7csyvT xhyGF7KXllRdADAxscmdFYabe+EITPqzmRgiplK3zGt0sJ+bD0QROLCp9Wr3x8bOKfq5LwKb/ pxgierGluLFUD/8QPNRz0tBvTzqKcmSdL/IVzV2pfZRWiszc4oRYBUjg89uM9ZlGBPV3Q537g 0Su2m+H07U3230IxGCNM9mFlcSWgkGEzakZuFmwHh3wpp/qdIOfanRQIycHLE0hldFrN+8Zj9 1Tr37k7YZ5Eb1pW0R8hXjztGnAwLvVwYDWFVZ6jXtbY3PudHH7H09YyvAQjXcca14bTe4ArNY TTDTmbF0oZC3fMy3KS6JD7t8HdSA1N9lLsrejwg1ZJMW+60KBQAvT3s0CwnkSYVgWSa409Z+z NnoszljMzIpA6bf9KmmQKgJuM2PC1N4xpAIvNMqevVXiVHDZ6J9CVgSJ0DQS3jXPIBGJnqvMv ozt0A+xUUKenpnCFHkkAlOzHR0fkeHYatk9IwX9c7/lpvUh9+1N66lNLP/SvQsyKJ3BOPhEP/ eo1sDVf6uVS9MP8YqsYj9CVlYp+XZaKwbfTBKm2sJHQ2g80+FJAACRMFLgwClSTbRnsQCCG5P tnIpV8YihZDQE= X-Rspamd-Queue-Id: 4DNvC32pq0z3HWZ X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmx.net header.s=badeba3b8450 header.b=iJ2ea9tr; dmarc=pass (policy=none) header.from=gmx.de; spf=pass (mx1.freebsd.org: domain of mj-mailinglist@gmx.de designates 212.227.17.21 as permitted sender) smtp.mailfrom=mj-mailinglist@gmx.de X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[gmx.de]; R_SPF_ALLOW(-0.20)[+ip4:212.227.17.0/27]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmx.net:+]; RCPT_COUNT_TWO(0.00)[2]; HAS_X_PRIO_THREE(0.00)[3]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[gmx.de,none]; RECEIVED_SPAMHAUS_PBL(0.00)[46.142.71.81:received]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmx.de]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.17.21:from]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmx.net:s=badeba3b8450]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[212.227.17.21:from:127.0.2.255]; FROM_NO_DN(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[212.227.17.21:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.17.21:from]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions,freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 13:35:45 -0000 While browsing the filesystem, i found the folder /usr/share/misc and now i am curious, what kind of files and why they were put there. The list on "13.0-ALPHA2 stable/13-f76393a63" looks like this: -r--r--r-- 1 root wheel 3170 Jan 24 09:18 ascii -r--r--r-- 1 root wheel 5265 Jun 25 2020 bc.library -r--r--r-- 1 root wheel 374 Jan 24 09:18 birthtoken -r--r--r-- 1 root wheel 43643 Jan 24 09:18 bsd-family-tree -r--r--r-- 1 root wheel 6633 Jan 24 09:18 committers-doc.dot -r--r--r-- 1 root wheel 23555 Jan 24 09:18 committers-ports.dot -r--r--r-- 1 root wheel 29343 Jan 24 09:18 committers-src.dot -r--r--r-- 1 root wheel 19304 Jan 24 09:18 definitions.units -r--r--r-- 1 root wheel 1390 Jan 24 09:18 flowers drwxr-xr-x 2 root wheel 2 Jun 25 2020 fonts -r--r--r-- 1 root wheel 3267 Jan 24 09:18 gprof.callg -r--r--r-- 1 root wheel 1064 Jan 24 09:18 gprof.flat -r--r--r-- 1 root wheel 25 Jan 24 09:18 init.ee -r--r--r-- 1 root wheel 15481 Jan 24 09:18 iso3166 -r--r--r-- 1 root wheel 12422 Jan 24 09:18 iso639 -r--r--r-- 1 root wheel 2391 Jan 24 09:18 latin1 -r--r--r-- 1 root wheel 1177518 Jan 24 09:18 magic -r--r--r-- 1 root wheel 6653320 Jan 24 09:18 magic.mgc -r--r--r-- 1 root wheel 941 Jan 24 09:18 mail.help -r--r--r-- 1 root wheel 1284 Jan 24 09:18 mail.tildehelp -r--r--r-- 1 root wheel 1133 Jan 24 09:18 mdoc.template -r--r--r-- 1 root wheel 582 Jan 24 09:18 operator -r--r--r-- 1 root wheel 4165 Jan 24 09:18 organization.dot -r--r--r-- 1 root wheel 1246724 Jan 24 09:18 pci_vendors -r--r--r-- 1 root wheel 10913 Jan 24 09:18 scsi_modes -r--r--r-- 1 root wheel 212427 Jan 24 09:18 termcap -r--r--r-- 1 root wheel 1343488 Jan 24 09:18 termcap.db -r--r--r-- 1 root wheel 37626 Jan 24 09:18 usb_hid_usages -r--r--r-- 1 root wheel 206318 Jan 24 09:18 usbdevs -r--r--r-- 1 root wheel 7081 Jan 24 09:18 windrv_stub.c There are - some more, some less technical "lookup" files, like: ascii, birthtoken, flowers, iso3166, iso639, latin1,... - some FreeBSD project related files, like: bsd-family-tree.dot, committers-*.dot, organization.dot These would better be part of the documentation. BTW, on 12.x they are out of date: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=251701 - some configuration an scripting examples, like: init.ee, gprof.callg, gprof.flat,... IMHO better placed in .../examples - development(?) related files, like: pci_vendors, scsi_modes, usb_hid_usages, usbdevs, windrv_stub.c I don't know if these files are used during build-/runtime - some files which are used during (build-?/)runtime: magic, magic.mgc, termcap, termcap.db Shouldn't these be in a more specific place? They are pretty static, so the "var" part in /var/db does not fit, but services.db is located there, too. - is the fonts folder in base, or did some port create it? I'm not sure. What is the history behind /usr/share/misc? -- Martin From owner-freebsd-current@freebsd.org Sun Jan 24 14:22:09 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AAE8E4FD42D; Sun, 24 Jan 2021 14:22:09 +0000 (UTC) (envelope-from yaneurabeya@gmail.com) Received: from mail-pg1-x52c.google.com (mail-pg1-x52c.google.com [IPv6:2607:f8b0:4864:20::52c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNwDc2vxLz3Lc3; Sun, 24 Jan 2021 14:22:08 +0000 (UTC) (envelope-from yaneurabeya@gmail.com) Received: by mail-pg1-x52c.google.com with SMTP id b21so334120pgk.7; Sun, 24 Jan 2021 06:22:08 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=content-transfer-encoding:from:mime-version:subject:date:message-id :references:cc:in-reply-to:to; bh=c0WFuJOEonScKpqnErrC6yBkNS5oKemfoDHl6me5VM8=; b=jBe4wZiiAW1sK+SCkEXuVDMyiTMcWh5b1ymwsg+L+e2Uqebr65jiEy55hdi1HgFzjb gWWl/ClM9NlgVqldL92gBd2V7cwArmIgjWWigtaKpBtRNps2IXMJ74v3khM98/VyFngM 83LiWqQGKddCxrvDqOGSoY9xIL76P3P81vWGgtLL11ciwzuRYW7sfC7J6OLj/WxxaMaF C64E8bs/9Dc323Kysa+HCldytDfI8g21slbqlji/PdbgPddjEkcwAhVfDZTFBUVd0Hlp aUveWE0N3DDU51BLSUFJLff1HVF6j0qRUobBYDXxswxk20Qjpn9yRBLyl+VCybKAudFJ sbiA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:content-transfer-encoding:from:mime-version :subject:date:message-id:references:cc:in-reply-to:to; bh=c0WFuJOEonScKpqnErrC6yBkNS5oKemfoDHl6me5VM8=; b=dQ+dQXHSZA+D8avRSvcBjcyUHU9q/+Otq/9YKKoZrvhZE1HHcwjmirb8oz7wPsd2Tv TlWuIdYiwbk2/N0+GNJs2eg7kJX90+r5VjjPWTzYUARTZkc3YllshEm8in6aO3sORsNv zbDhhDVB8AfbmqFN8DjBb00xrTzlc5F+10qgEwWZ9rZSViJ/DCV5kXvp7FVk3F72yOUf Iy5aRpij+/0CDaDt3DOoFPZ3M3oUI5rjjfzJf4hX5z/MOPH8usqwAlZZo1Nb4QgJlrFH i8vcYLys3/AIbxRWvNiU6PZKdQ5/+zp1w9CyzKMoZjsOCLWCR94U3X+oQ3UcOwGaf9Un ZxsA== X-Gm-Message-State: AOAM5307inTHdv/aTnozkXKunz/8baQocJetS2jo0KzAQ7Vt0lpAKn3s CNfS4mSnUq1rFM6ZObOeOvWDTB/RVOb8Eg== X-Google-Smtp-Source: ABdhPJypc7i2t/Llk1xzR+A5bl10OkNV3LvNmHlY/SjKaNm5T37T3vK7Wj4RUBWGJ5BEJSWAhbKPZg== X-Received: by 2002:a63:1c08:: with SMTP id c8mr6271560pgc.228.1611498126322; Sun, 24 Jan 2021 06:22:06 -0800 (PST) Received: from [192.168.20.31] (c-73-19-52-228.hsd1.wa.comcast.net. [73.19.52.228]) by smtp.gmail.com with ESMTPSA id fv19sm15228417pjb.20.2021.01.24.06.22.05 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sun, 24 Jan 2021 06:22:05 -0800 (PST) Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Enji Cooper Mime-Version: 1.0 (1.0) Subject: Re: Files in /usr/share/misc Date: Sun, 24 Jan 2021 06:22:04 -0800 Message-Id: <23EABDB4-09F6-4803-9251-4DFA77C3D2E9@gmail.com> References: Cc: freebsd-current@freebsd.org, freebsd-questions@freebsd.org In-Reply-To: To: mj-mailinglist@gmx.de X-Mailer: iPhone Mail (18C66) X-Rspamd-Queue-Id: 4DNwDc2vxLz3Lc3 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=jBe4wZii; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of yaneurabeya@gmail.com designates 2607:f8b0:4864:20::52c as permitted sender) smtp.mailfrom=yaneurabeya@gmail.com X-Spamd-Result: default: False [-1.51 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FREEMAIL_TO(0.00)[gmx.de]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::52c:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; RECEIVED_SPAMHAUS_PBL(0.00)[73.19.52.228:received]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(0.99)[0.988]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::52c:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::52c:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current,freebsd-questions] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 14:22:09 -0000 > On Jan 24, 2021, at 05:36, mj-mailinglist@gmx.de wrote: > What is the history behind /usr/share/misc? Hi Martin, Have you read =E2=80=9Cman hier=E2=80=9D, by chance? This might elucidat= e things a bit. Cheers, -Enji= From owner-freebsd-current@freebsd.org Sun Jan 24 14:53:48 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7D70E4FDFD9 for ; Sun, 24 Jan 2021 14:53:48 +0000 (UTC) (envelope-from bergerkos@yahoo.co.uk) Received: from sonic310-11.consmr.mail.ir2.yahoo.com (sonic310-11.consmr.mail.ir2.yahoo.com [77.238.177.32]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNwx70hLXz3NQH for ; Sun, 24 Jan 2021 14:53:46 +0000 (UTC) (envelope-from bergerkos@yahoo.co.uk) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611500024; bh=QqZDQe5DlsWYFdajifA9K1vsGg6rv1CM534l3COe8YP=; h=Date:From:To:Subject:From:Subject:Reply-To; b=rg+MsHWRfrgoSHqmQr4q9eYkIo21GFm9ypDZYt/Q7Ghb9RD44+EhqdbjtHGOJCUAjhj2aMVOjUAWdBs4CgdEBx0yYkOQMuvuCjP9cUK0+GmoonvDh9p5tUSpTxTpfliFWL1tjgDerUYZILSC4PEErbypUUbngOrn4GLfeOFZdhl9v+fb1O/BhezeoBjoR6OyMOiVVqHgihWcE8icwktOA9i3zgn9a5OhQjIce8ueDyCKtj43zfCNT3dTzO6tZlqVpSmD53ds0Zo0BobtMtOUCVT5hYw1Ucq9YQszQXFDzpvpByBNlXQ2kayOWZVjxEod9UMdKinqpB44F3YVhblrBQ== X-YMail-OSG: V0g8YlEVM1lZY0Hc6B3izJwbmPA_5VQ2imq7XI7M5ZSlu2BOczhVcuYjRNcfvh0 vb3KyBEg30O0lmUC5TaN3Q3WAH7npo9hW5Mau08atgAi12ULKZkN.NNEQXdfMZq5MOnUE8xSkri0 PkqyZeSRhgeAg7YeUMEXrS0rKl8zUcWtpl7dIffGweFS29.EyoCgo3KNKQifT6EBmKoUC6yyLMxz 5qKynYowPTpL6Y21EEAgysMygCVHYHpmSBTJuJM92QAJzV0kIFjay7nzgtfPL9Q_YKNVmOVx.Qyz yMeJL2g3yM_xCqJmPAaHUdd3PFc4iB08I9NYylXCkxHPOC2jZjDPCv4NEHDshNpLcEXYSbhffyJK dH5LWGpemIAAgvjdNA7No7vIslhMWDBvC99nfSnQ1PSr3Olq.zWE_9Ju8YLrSylSXQKcbKmFw1O4 YZ6mDWRrG3xxELCgFgKlGWfHjNYalDjN693cGfH4ZSHqs4ky_6RTH0DhMzI8kUtyjoSnXosZ00vV bX8wU6ESDTtY8kCY_XBLBhHUqN.xN9LNh8VO7cBzEzVovE5o4dXEXau2MmzZQF.CKKg3mrmATj56 2LFAzOYiieizOW35tDEEMwAtV0WZWmvdRGFCgD9V.eSD9j3.DoezilJP8WBN_rFVV6xRR0Q0uTO0 z4f6sWpC9c3g7GsMEXZJtxdhvQa25kCKgFDs.Ysmy8v8GqNDZmzZTv4Ti8932UFP95MGjNnlMPuc Pf41nbBX8hag2QGJ2zNJnLO.Lzl7XQTiJ9RhAJN64QGywLwBDN.Z68G50K.tLr7hJfvJ.jZ9m9uM JIryiyIEtXwSNCbIX6kUEWFZxrCaFy1wezBOis1caX_nbj2101joaAxXNE0WTNuQA2egNxQJD1Gx Vat2Fyh4B9FndJ48yeYbutsRSbvYyZflBRu928or2jbXCx6X5JTg55AbHi8hUEZkrqE0zpYCk.QR Y0_b6qlr9PujM16OkJlbNLgIbj5PBYmq17vXuhnNUZWIscX7EWPu41ktAGXpAYJM6cUoIhrgXYKR kmHJNVzCuy5qwqyGTE0RXgFurc_H0m97kFAmnmtN4ud3FT2iExp1Wbq5llNHydNe1Kvh63m4ZO.A dGH_cNEWgp4KTsnvNxjZXrJ37o5E83CysJPM4qZySljndl_sVyA6CNP1JBF17zVrYV5g1dflTuK3 VfTeVLQnV961rRAjLb5ALdCAjzyQKvuBvyA098AAmRrwUJET4NE2q.jESkwcXbf1sZAzINDBIea_ XHkdTnNRKAIX9G012xxe2IDoHbWkxwXjFTn7V9egc5EZ7560pp6AJPfKCKr.g16aGY0KJfIhBNcz uuAkHXiJk51OCZQsWzvpkMfPaJdtHWpMRVNVhZ.woNAab5BUvXj4efV4QmhN8xYTvvDwblNcO7_x 6SEel9oeq62ErX1Q10B2WQ4RbimKv6PM.IHUEm0iI8KeDqi.fXiPVJyxia4jk0YaDdSQjGkP6WOF 8TzoWPh9lCVQjJsBFdSqOaTp9Cw84_1whYhBrgcrdHeFcM8xdIbDs03b7pdHfgJjrXnxgqHXixqV BTtWLaPxcxQqTtjYST4.djkPqvJcedCy9ABjUNj_HU2zBNbgaqjdvWwhwc5u3YSoWr3FXPu3crQr _XqoaYN5ONcgkTUO9itrJVTinMFcJ7lNvu5dQiHrj6WY6Bx.CksiaQ5u70lEFqrqGkstQmvJTRKj 6wDkb1JjMASO7GYk_SCYNUCA_xAMC2k777u3jfLBxC_RUKeSLhKjBIK.vpO4e9hnmLzhDKj23zkj Lq0rRZADqWOFse.aKeIkSL29P1ikJZEPt10vD05rKooP0D59VQ9Pw0rouY9a0PlDlzI9MT51bmpE aF5_fHPs5iTyngRJ8C09lB0BhilMK.9UZcDGiVLjPmXG5H51REFhiBGGBDi.HpAi0jb32GyBaOIo 4aCqLsYJDEuJFl0ABUvlpZl9dhckBhYgXKuWb42Ejg6xvKLmdXpb.HgUX.DdSeoDR4Jaemf6wThJ MHwhtUokrNB6XaBoXlSbw2eJZWhoya9a2UVNYSsHOgQwxwlWjKFsZGX5e.R9m3xoXKndgJ.Oz_6Z U2W0J4i91Wq8nUckMBwHEvp.0ixhvB0ENZ033mZB_ujq..wUl8ezjAdM0u9RyRVApjrF_vJpo3Yj yRXFO7xHlc8FhZcmoVXyQjN6ExRAEINWWYh76JuVMtcugUnL1ZOf.K8J_EJyg8P3hmvOPQgNfuy6 yp_yLh3KdRW7HCTbCCY9pLvAb2MzH.tQCqUxIVfojF8yH2_2OFNJCFVMYXeLGAY9mwVdz6RTn9SM xmtJMOGZGoJVGmVMMJS0_p0TY6Mi.CSf2ioELVgBewmVxNUCjJcANO_gGkZcy_0VToXsG76g0227 euxq2qdFC5Xo8C9WaG7JZUSrNzmkaVS8pts5uYawEL6eMMxroOTVH.IQteM6S0LwWQbAafIhjaA- - Received: from sonic.gate.mail.ne1.yahoo.com by sonic310.consmr.mail.ir2.yahoo.com with HTTP; Sun, 24 Jan 2021 14:53:44 +0000 Date: Sun, 24 Jan 2021 14:53:41 +0000 (UTC) From: Kostya Berger To: FreeBSD Current Message-ID: <1384574721.390368.1611500021710@mail.yahoo.com> In-Reply-To: <992972141.8836030.1611441657314@mail.yahoo.com> References: <992972141.8836030.1611441657314.ref@mail.yahoo.com> <992972141.8836030.1611441657314@mail.yahoo.com> Subject: Re: 13-alpha2 libncurses removal breaks ports build MIME-Version: 1.0 X-Mailer: WebService/1.1.17501 YMailNorrin Mozilla/5.0 (X11; FreeBSD amd64; rv:84.0) Gecko/20100101 Firefox/84.0 X-Rspamd-Queue-Id: 4DNwx70hLXz3NQH X-Spamd-Bar: --- X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[77.238.177.32:from]; R_DKIM_ALLOW(-0.20)[yahoo.co.uk:s=s2048]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; FREEMAIL_FROM(0.00)[yahoo.co.uk]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[77.238.177.32:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.co.uk:+]; DMARC_POLICY_ALLOW(-0.50)[yahoo.co.uk,reject]; RCVD_IN_DNSWL_NONE(0.00)[77.238.177.32:from]; NEURAL_HAM_SHORT(-1.00)[-0.998]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[yahoo.co.uk]; ASN(0.00)[asn:34010, ipnet:77.238.176.0/22, country:GB]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current]; RWL_MAILSPIKE_POSSIBLE(0.00)[77.238.177.32:from] Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 14:53:48 -0000 OK, building ports against a clean installation of 13.0-ALPHA2 has no probl= em with ncurses.=20 But devel/glib20 fails for no obvious reason closer to the end of building = process... I just wonder: do I need to report this to port maintainers or w= ait till it settles up=C2=A0 somehow? A good deal of ports depend=C2=A0 on = it. With kindest regards, Kostya Berger =20 =20 On Sunday, 24 January 2021, 01:40:57 GMT+3, Kostya Berger wrote: =20 =20 Hi everyone,I don't seem to find any mentioning in the /usr/ports/UPDATING= about how one should handle the removal of libncurses.so.9 from base.=20 Source UPDATING only says:ncurses installation has been modified to only ke= ep the widechar =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 enabled version.=C2=A0 Increment= al build is broken for that change, so it =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 requires a clean build. If that means to just build all ports anew, then it doesn't work as ports d= on't seem to incorporate any change related to this one. It would seem defa= ult configuration should take into account this, but it doesn't. The ports just use --with-libncurses-prefix=3D/usr, and there is no ncurses= libs found there. This make it skip MOST of the ports I'm using. Working Copy Root Path: /usr/ports URL: https://svn.freebsd.org/ports/head Relative URL: ^/head Repository Root: https://svn.freebsd.org/ports Repository UUID: 35697150-7ecd-e111-bb59-0022644237b5 Revision: 562417 Node Kind: directory Schedule: normal Last Changed Author: 0mp Last Changed Rev: 562417 Last Changed Date: 2021-01-23 23:01:38 +0300 (Sat, 23 Jan 2021) With kindest regards, Kostya Berger =20 =20 From owner-freebsd-current@freebsd.org Sun Jan 24 16:01:04 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4F0EF4D0B59 for ; Sun, 24 Jan 2021 16:01:04 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qv1-xf2d.google.com (mail-qv1-xf2d.google.com [IPv6:2607:f8b0:4864:20::f2d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNyQd5bTBz3k3M for ; Sun, 24 Jan 2021 16:00:57 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qv1-xf2d.google.com with SMTP id p5so5095937qvs.7 for ; Sun, 24 Jan 2021 08:00:57 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=nTCjBiFN8ZU1lYLPh5j6r1R2Q2V0eN5R6L3KLxtqvBM=; b=gM4/ymkIhQY7K77pjKLg7DOZP8qfbiVBpU6MyG5aFZxrLMd23/Uwm8uKb0W5Lc3p4x VUc++pxesxZIjbQvVqKgA+d+XHN98NBhG8gkZOapNE2HDY4z1cgDuEBjBi5cPJdpgJ88 JVs8+rlxlvHp9SngfS3Ua6u59GsA991/T+mCFfdGphw24IswOzv0wnPTN/8HQP+MmsMr zRGX1rNMfbMI9E4bqy6UTtkycnIvFchA7sm67m+jNfsQzYAnFN7Tub1xqKupLnv1Ovsx +tZyi9vXgAKCHlEFrss+0p7okG4ZoQFG9IbPOGwnSy8lM3Q74ZpORGMfjSCgVbj1X3fC sFnA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=nTCjBiFN8ZU1lYLPh5j6r1R2Q2V0eN5R6L3KLxtqvBM=; b=A7rRwSFqZPG5b7rMD38e4aXaukXQHmlE4b+1vPZupOvycDGStZNsG9xBR5qwMNh5zZ s2tOvniVtKF6HdLru0PCtodoDALYaWx8CBwaTzTShgFUzTFwN0h4Khv3eKIGXZa8AKSv 3HCVFs0We9BC8skCb9cZiNVqLKIHl3iys+Q39m2JX3y/kj9foGV5vciJ1c9yoQxCfTnt HnLGC5GkeTRaZZYqMgNfP1q20p3HX/GJ55h1KHDOVL866LpQKTFnzvGRVEhIJbYTz/Q/ Z2/lLwv+axSR5zWpap7Ijwz8lvJQ2Li3fFo9W8mTLiSjZOaTBfXrncRKOXD2fncViyXw qJaw== X-Gm-Message-State: AOAM53380AtYe+LkKOJD93/YRnrqBFBYK0NNMpVR2HOHD9eefwTIzkCF RW0Z1WGWCzXbpfMefJk03S97ShdeD+8iUzvNJ0wLbpJG3kBqTA== X-Google-Smtp-Source: ABdhPJwosrV4d2CLHSx1R0gRRW8TrCeqRvH5YvRewG4UkUEnyxewmeUbsbHoQAcbmQt9R7mmBaNacoAGZk1S2fzpXEg= X-Received: by 2002:ad4:4c01:: with SMTP id bz1mr1682239qvb.62.1611504056487; Sun, 24 Jan 2021 08:00:56 -0800 (PST) MIME-Version: 1.0 References: <20210124041403.GB73653@troutmask.apl.washington.edu> In-Reply-To: From: Warner Losh Date: Sun, 24 Jan 2021 09:00:45 -0700 Message-ID: Subject: Re: Getting /usr/src to match specific git hash? To: Jeffrey Bouquet Cc: Steve Kargl , Yasuhiro Kimura , freebsd-current X-Rspamd-Queue-Id: 4DNyQd5bTBz3k3M X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=gM4/ymkI; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::f2d) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-1.76 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f2d:from]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f2d:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-0.76)[-0.760]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f2d:from]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; SUBJECT_ENDS_QUESTION(1.00)[]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 16:01:04 -0000 On Sun, Jan 24, 2021, 6:05 AM Jeffrey Bouquet wrote: > > > On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl < > sgk@troutmask.apl.washington.edu> wrote: > > > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > > > From: Steve Kargl > > > Subject: Getting /usr/src to match specific git hash? > > > Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > > > > > Suppose one has an empty /usr/src. > > > > > > > > Suppose further that one had to re-install a 32-bit > > > > i386-*-freebsd with the 24 Dec 2020 image available > > > > from freebsd.org. > > > > > > > > uname -a for the booted kernel shows > > > > > > > > % uname -a > > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > > > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC > i386 > > > > > > > > How does one use git to pull the exact sources that match > > > > this specifc kernel? > > > > > > cd /usr > > > git clone https://git.freebsd.org/src.git > > > cd src > > > git checkout 3cc0c0d66a0 > > > > > > > Thank you. > > > > -- > > Steve > > _______________________________________________ > > freebsd-current@freebsd.org mailing list > > https://lists.freebsd.org/mailman/listinfo/freebsd-current > > To unsubscribe, send any mail to " > freebsd-current-unsubscribe@freebsd.org" > > Can this be put in /usr/src/UPDATING with an explanation of precisely how > each > of the git commands populates or repopulated the directories in /usr??? > It is in the mini primer I wrote, along with how to bisect and other useful things. This will migrate into the handbook once the doc tree converts to asciidoc (happening this weekend). https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md Warner > > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > From owner-freebsd-current@freebsd.org Sun Jan 24 16:05:27 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 730B04D0F92 for ; Sun, 24 Jan 2021 16:05:27 +0000 (UTC) (envelope-from shawn.webb@hardenedbsd.org) Received: from mail-qt1-x831.google.com (mail-qt1-x831.google.com [IPv6:2607:f8b0:4864:20::831]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DNyWp1J2Pz3kZf for ; Sun, 24 Jan 2021 16:05:25 +0000 (UTC) (envelope-from shawn.webb@hardenedbsd.org) Received: by mail-qt1-x831.google.com with SMTP id t17so7943208qtq.2 for ; Sun, 24 Jan 2021 08:05:25 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hardenedbsd.org; s=google; h=date:from:to:cc:subject:message-id:references:mime-version :content-disposition:in-reply-to; bh=e2C3IL1NIgVeOuHOJWPd+AQvFlm1+ZV1w8UthTkcNMk=; b=f6j7wuyok593ARPa530HeeUWtW7WSgNNFP/xBMTpr4BDUPoJmxk4u3SeGVB8GmCOVk scMlp02cUYFLlO4+E9zUj2xZDpF/dlK2VdSx1myG1h8n25CjCusOwepvEKYaV6gGx/Ku p4pmALpaxGT7zNEBSmFV1l/UTyC7PRxREzCCRRQf6FNiMKIsnqKhEfyowEmQWi7cW2Jg lVl5iHiw0CbA1L8U/vMH7STF6XGlwQp56tsJC+s6W+iBaSglkpNW6N3HY7o21h4tsY36 kZICcsbaI6KzJfERNXyK7dfdM97o5bPxIqSNW9DtGaGe1CF2YuWk/O3lfj9mrVJyRLVN YNUg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:cc:subject:message-id:references :mime-version:content-disposition:in-reply-to; bh=e2C3IL1NIgVeOuHOJWPd+AQvFlm1+ZV1w8UthTkcNMk=; b=EDVzNeAJUTOvQWrqnk5GJjBrSVHcSII8pa6nWgC50hvTsLdyIUn8C0iLKU1iXNB+fB LCiCzVLYiUIlWHD531CDDJq4UCGXVfZI+3DhF7LnSOqpJd+LGrmZnt+QonYh+dJybrnN 5pDk0UMfMUEmnpaFmpWunFlsKGg5iCbONZ4dAQvZK5+cmqxsRxbrA79p6EbQTRlrr3Qt 9M1u3qq+dyqhaSuFhJ9RlgfkBfpo9ORyIWE5cE53i4L++k49Z+tYBQf+xJORJKGVvRg/ uXVAs934VNgBMZ48ClNfhbZv6VGrIT/uBDElGkECrZyE+OgrnVj351WpDzwWpj0dCxF6 sSLg== X-Gm-Message-State: AOAM531LCJ7AXNInnOD+LV4pQgQFmPDKHZCUBZb9R6oWXT0v8nJ/I0mL 6qI+SIZdMLTNGEx/vK98+RA68Q== X-Google-Smtp-Source: ABdhPJzNN1NhThcAmpwsyfHx7qArr2bHic3lYjBoAFOsMqy+dQMvwudAqUXABiJPy9A2ey4DU7+akQ== X-Received: by 2002:ac8:718f:: with SMTP id w15mr1877866qto.179.1611504325171; Sun, 24 Jan 2021 08:05:25 -0800 (PST) Received: from mutt-hbsd (pool-100-16-222-53.bltmmd.fios.verizon.net. [100.16.222.53]) by smtp.gmail.com with ESMTPSA id 138sm6202084qkd.80.2021.01.24.08.05.24 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sun, 24 Jan 2021 08:05:24 -0800 (PST) Date: Sun, 24 Jan 2021 11:05:23 -0500 From: Shawn Webb To: Warner Losh Cc: Jeffrey Bouquet , Steve Kargl , Yasuhiro Kimura , freebsd-current Subject: Re: Getting /usr/src to match specific git hash? Message-ID: <20210124160523.ygdwlgegk6nrwfm4@mutt-hbsd> X-Operating-System: FreeBSD mutt-hbsd 13.0-CURRENT-HBSD FreeBSD 13.0-CURRENT-HBSD X-PGP-Key: http://pgp.mit.edu/pks/lookup?op=vindex&search=0xFF2E67A277F8E1FA References: <20210124041403.GB73653@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="gjkq34kgt3vrncfa" Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DNyWp1J2Pz3kZf X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hardenedbsd.org header.s=google header.b=f6j7wuyo; dmarc=none; spf=pass (mx1.freebsd.org: domain of shawn.webb@hardenedbsd.org designates 2607:f8b0:4864:20::831 as permitted sender) smtp.mailfrom=shawn.webb@hardenedbsd.org X-Spamd-Result: default: False [-3.96 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCPT_COUNT_FIVE(0.00)[5]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[hardenedbsd.org:+]; NEURAL_HAM_SHORT(-0.86)[-0.860]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::831:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RECEIVED_SPAMHAUS_PBL(0.00)[100.16.222.53:received]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[hardenedbsd.org:s=google]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[hardenedbsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::831:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::831:from]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 16:05:27 -0000 --gjkq34kgt3vrncfa Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Jan 24, 2021 at 09:00:45AM -0700, Warner Losh wrote: > On Sun, Jan 24, 2021, 6:05 AM Jeffrey Bouquet > wrote: >=20 > > > > > > On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl < > > sgk@troutmask.apl.washington.edu> wrote: > > > > > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > > > > From: Steve Kargl > > > > Subject: Getting /usr/src to match specific git hash? > > > > Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > > > > > > > Suppose one has an empty /usr/src. > > > > > > > > > > Suppose further that one had to re-install a 32-bit > > > > > i386-*-freebsd with the 24 Dec 2020 image available > > > > > from freebsd.org. > > > > > > > > > > uname -a for the booted kernel shows > > > > > > > > > > % uname -a > > > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > > > > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENER= IC > > i386 > > > > > > > > > > How does one use git to pull the exact sources that match > > > > > this specifc kernel? > > > > > > > > cd /usr > > > > git clone https://git.freebsd.org/src.git > > > > cd src > > > > git checkout 3cc0c0d66a0 > > > > > > > > > > Thank you. > > > > > > -- > > > Steve > > > _______________________________________________ > > > freebsd-current@freebsd.org mailing list > > > https://lists.freebsd.org/mailman/listinfo/freebsd-current > > > To unsubscribe, send any mail to " > > freebsd-current-unsubscribe@freebsd.org" > > > > Can this be put in /usr/src/UPDATING with an explanation of precisely h= ow > > each > > of the git commands populates or repopulated the directories in /usr??? > > >=20 > It is in the mini primer I wrote, along with how to bisect and other usef= ul > things. This will migrate into the handbook once the doc tree converts to > asciidoc (happening this weekend). >=20 > https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md I'm glad this is moving to FreeBSD's documentation. Following the process of FreeBSD's migration to git has been a bit troublesome with some docs somewhere other docs elsewhere. Thanks, --=20 Shawn Webb Cofounder / Security Engineer HardenedBSD GPG Key ID: 0xFF2E67A277F8E1FA GPG Key Fingerprint: D206 BB45 15E0 9C49 0CF9 3633 C85B 0AF8 AB23 0FB2 https://git-01.md.hardenedbsd.org/HardenedBSD/pubkeys/src/branch/master/Sha= wn_Webb/03A4CBEBB82EA5A67D9F3853FF2E67A277F8E1FA.pub.asc --gjkq34kgt3vrncfa Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEA6TL67gupaZ9nzhT/y5nonf44foFAmANmsEACgkQ/y5nonf4 4fq/lA//RuyxQl9WEOi4mPYFufPFX+8RZpMcTvqBOP3koO6qr9ONdgUtIS254Nkm lTflwSqjRYuQqaSdPITJ2feCUzjdB58X5gqJWJc3zdFj8U+Xw+4wHAF6BaWLBVH8 TO4/2IgT882LTqRaKzz6tnOAk5g3JhjREo+FX2idGUcJUYOIV5zhMVIIlmsE8Iq6 4AMlArcvKS/IbnpQ+f4Cho6gdZwCfmnhEGZYgTCM5iI2p5SyEuDC+W4VICZMZ6wK k8QgLRm3ws9Pqn533IQhA/I5eLvFUS0yITFRiZwloWwAKTCXd2y/6amp9qNy184s GuEf3ay4EBNyrh3dk84zyAlURo/JlS+mE02AYHxn25qc4JwnYUQtW18Kh/D62XkC eH7aR7T4FbubcPOymfAPJSBrtR/C+wyMXC29AstsQl231qzFKIESqayxoUYbvEb4 jrL8bISmokggOrNS5IjsU+UCPNQrkJM1EUcbNU9nW0gJr4N3A+kVsEGtj6PAr9NT y8QcGk/TwvlM318vjv1tylP/gWAlw7hHHdBj1UKFx3ZkUwvPTGesVB+81ktN/6h0 HlXU3xVFA2iODqJMhkEnxL6wQp6PMcHXz4A5vQtE5USgHsaoYVycErQjhQiJkmrO HhDrCrZytR2exwQ48TY7OWzkZJnXUv1pnn9fDYWfmsBS6X9jC9s= =LgMw -----END PGP SIGNATURE----- --gjkq34kgt3vrncfa-- From owner-freebsd-current@freebsd.org Sun Jan 24 17:18:00 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 62E634D2CA5 for ; Sun, 24 Jan 2021 17:18:00 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (phouka1.phouka.net [107.170.196.116]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "phouka.net", Issuer "Go Daddy Secure Certificate Authority - G2" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP07V4wW4z3pbZ for ; Sun, 24 Jan 2021 17:17:58 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (localhost [127.0.0.1]) by phouka1.phouka.net (8.16.1/8.16.1) with ESMTPS id 10OHGglk066497 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sun, 24 Jan 2021 09:16:42 -0800 (PST) (envelope-from warlock@phouka1.phouka.net) Received: (from warlock@localhost) by phouka1.phouka.net (8.16.1/8.16.1/Submit) id 10OHGgY0066496; Sun, 24 Jan 2021 09:16:42 -0800 (PST) (envelope-from warlock) Date: Sun, 24 Jan 2021 09:16:41 -0800 From: John Kennedy To: Kostya Berger Cc: FreeBSD Current Subject: Re: 13-alpha2 libncurses removal breaks ports build Message-ID: References: <992972141.8836030.1611441657314.ref@mail.yahoo.com> <992972141.8836030.1611441657314@mail.yahoo.com> <1384574721.390368.1611500021710@mail.yahoo.com> MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <1384574721.390368.1611500021710@mail.yahoo.com> X-Rspamd-Queue-Id: 4DP07V4wW4z3pbZ X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of warlock@phouka1.phouka.net has no SPF policy when checking 107.170.196.116) smtp.mailfrom=warlock@phouka1.phouka.net X-Spamd-Result: default: False [-1.05 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.170.196.116:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[phouka.net]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[107.170.196.116:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-0.25)[-0.246]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[yahoo.co.uk]; FORGED_SENDER(0.30)[warlock@phouka.net,warlock@phouka1.phouka.net]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:14061, ipnet:107.170.192.0/18, country:US]; FROM_NEQ_ENVFROM(0.00)[warlock@phouka.net,warlock@phouka1.phouka.net]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 17:18:00 -0000 On Sun, Jan 24, 2021 at 02:53:41PM +0000, Kostya Berger wrote: > OK, building ports against a clean installation of 13.0-ALPHA2 has no problem with ncurses. > But devel/glib20 fails for no obvious reason closer to the end of building process... I just wonder: do I need to report this to port maintainers or wait till it settles up somehow? A good deal of ports depend on it. Hmm. My compile was fine. From the top of my poudriere build log: =>> Building devel/glib20 build started at Thu Jan 21 20:15:35 PST 2021 port directory: /usr/ports/devel/glib20 package name: glib-2.66.4_1,1 building for: FreeBSD 13-master-job-02 13.0-ALPHA2 FreeBSD 13.0-ALPHA2 1300136 amd64 maintained by: desktop@FreeBSD.org Makefile ident: Poudriere version: 3.3.6 Host OSVERSION: 1300136 Jail OSVERSION: 1300136 I'd open a PR with your details. From owner-freebsd-current@freebsd.org Sun Jan 24 18:01:18 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 990FB4D486F for ; Sun, 24 Jan 2021 18:01:18 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qk1-x72e.google.com (mail-qk1-x72e.google.com [IPv6:2607:f8b0:4864:20::72e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP15T5W4Hz3sV6 for ; Sun, 24 Jan 2021 18:01:17 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qk1-x72e.google.com with SMTP id a12so506540qkh.10 for ; Sun, 24 Jan 2021 10:01:17 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=Mlm4u6O/slY0PvJp8e16cCmAA/NEMiGrpc9VLWNuGqs=; b=s8jqGyWpfGBQwBBoS2GFHjgZfv45cwCbb4QISFAGcOUg3Xr0mNpZzhbVGYpDmb3eA7 qj3iwp2eOXINURbiNjpc+/Ts5LBNqvZGA1eY+wf1PwIIacOQ1N5Z+PGrB4ohAgKApFhC hPgic59i1YbB4nJuJcaWOjcAioEPiZJYUJpdXd0Xwb6KEJJ5EFQGkmvD7k5bSPiMZ/EW jgIT4Hze7bEC5MjJRj6VQ/9v4yASbvnZB5pm9oqF1fE/KbEtlEKVKefs8g7OLhR5Lw2E FrNFDxHkm2F3gsl4lPiLJ3SYpnGySkNfDBxVeyEJilu5Kq6WQRca5JTvYkel75NO/GXl kvOw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=Mlm4u6O/slY0PvJp8e16cCmAA/NEMiGrpc9VLWNuGqs=; b=Rll7leKvTTCtAjU1GfeWlZCWjgJtjsgWsZSiCu+lt91b5ao0bxPoA1ZqipwXXUSF1C YNUCWjaVIfsRXfPW/uWeJFHZ6wMIezjRoqUl+2OHRj/EQYzeScMzBfYL77h7Tipuvml2 ziirn/iMo1xblFMKyDtXwORHyjLOL36160+/xT1/V11Ak0lYVICHE+Y3DTUe7SDAr7wU xBswcQ657v6jiCjZC6KT2dUaqvj2TsK4UhGm1eN46U1ePS7DhAPRmiBkjBrslyWx0Glb CMTYg+HNx3ElbjrUFWfL4WtVakntcvfUub/KIklwukAp9FKrww/AM5Uo345zhULTIKgu UXLA== X-Gm-Message-State: AOAM5311C5ay/Ivbobrk/D+b6aBZohLEIJtqpGDU0sXP7RdCOGmlzuKU Beso/zePlsDkMa0qsu/zhPh+bwvQUfaxWuqW8z+cZww8hnzSNg== X-Google-Smtp-Source: ABdhPJyFh6nGEhtJgh/vIfEOGeO73vcipUX4Bdjh0COECgUlNw0eg46epeDYLz/0TxZDpmBMskQxvZwsDIsnMNrwU2M= X-Received: by 2002:ae9:f813:: with SMTP id x19mr1722002qkh.359.1611511276799; Sun, 24 Jan 2021 10:01:16 -0800 (PST) MIME-Version: 1.0 References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124160523.ygdwlgegk6nrwfm4@mutt-hbsd> In-Reply-To: <20210124160523.ygdwlgegk6nrwfm4@mutt-hbsd> From: Warner Losh Date: Sun, 24 Jan 2021 11:01:05 -0700 Message-ID: Subject: Re: Getting /usr/src to match specific git hash? To: Shawn Webb Cc: Jeffrey Bouquet , Steve Kargl , Yasuhiro Kimura , freebsd-current X-Rspamd-Queue-Id: 4DP15T5W4Hz3sV6 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=s8jqGyWp; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::72e) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-0.15 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::72e:from]; NEURAL_SPAM_SHORT(0.85)[0.851]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; RCPT_COUNT_FIVE(0.00)[5]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::72e:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::72e:from]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 18:01:18 -0000 On Sun, Jan 24, 2021, 9:05 AM Shawn Webb wrote: > On Sun, Jan 24, 2021 at 09:00:45AM -0700, Warner Losh wrote: > > On Sun, Jan 24, 2021, 6:05 AM Jeffrey Bouquet > > > wrote: > > > > > > > > > > > On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl < > > > sgk@troutmask.apl.washington.edu> wrote: > > > > > > > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > > > > > From: Steve Kargl > > > > > Subject: Getting /usr/src to match specific git hash? > > > > > Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > > > > > > > > > Suppose one has an empty /usr/src. > > > > > > > > > > > > Suppose further that one had to re-install a 32-bit > > > > > > i386-*-freebsd with the 24 Dec 2020 image available > > > > > > from freebsd.org. > > > > > > > > > > > > uname -a for the booted kernel shows > > > > > > > > > > > > % uname -a > > > > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > > > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > > > > > root@releng1.nyi.freebsd.org: > /usr/obj/usr/src/i386.i386/sys/GENERIC > > > i386 > > > > > > > > > > > > How does one use git to pull the exact sources that match > > > > > > this specifc kernel? > > > > > > > > > > cd /usr > > > > > git clone https://git.freebsd.org/src.git > > > > > cd src > > > > > git checkout 3cc0c0d66a0 > > > > > > > > > > > > > Thank you. > > > > > > > > -- > > > > Steve > > > > _______________________________________________ > > > > freebsd-current@freebsd.org mailing list > > > > https://lists.freebsd.org/mailman/listinfo/freebsd-current > > > > To unsubscribe, send any mail to " > > > freebsd-current-unsubscribe@freebsd.org" > > > > > > Can this be put in /usr/src/UPDATING with an explanation of precisely > how > > > each > > > of the git commands populates or repopulated the directories in /usr??? > > > > > > > It is in the mini primer I wrote, along with how to bisect and other > useful > > things. This will migrate into the handbook once the doc tree converts to > > asciidoc (happening this weekend). > > > > https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md > > I'm glad this is moving to FreeBSD's documentation. Following the > process of FreeBSD's migration to git has been a bit troublesome with > some docs somewhere other docs elsewhere. > Pointers have been posted early and often though. I don't buy it was that big a deal.. Warner Thanks, > > -- > Shawn Webb > Cofounder / Security Engineer > HardenedBSD > > GPG Key ID: 0xFF2E67A277F8E1FA > GPG Key Fingerprint: D206 BB45 15E0 9C49 0CF9 3633 C85B 0AF8 AB23 0FB2 > > https://git-01.md.hardenedbsd.org/HardenedBSD/pubkeys/src/branch/master/Shawn_Webb/03A4CBEBB82EA5A67D9F3853FF2E67A277F8E1FA.pub.asc > From owner-freebsd-current@freebsd.org Sun Jan 24 18:05:45 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8E2BF4D4BC6 for ; Sun, 24 Jan 2021 18:05:45 +0000 (UTC) (envelope-from sjg@juniper.net) Received: from mx0b-00273201.pphosted.com (mx0b-00273201.pphosted.com [67.231.152.164]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.pphosted.com", Issuer "Thawte RSA CA 2018" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP1Bc6n24z3t2W for ; Sun, 24 Jan 2021 18:05:44 +0000 (UTC) (envelope-from sjg@juniper.net) Received: from pps.filterd (m0108162.ppops.net [127.0.0.1]) by mx0b-00273201.pphosted.com (8.16.0.43/8.16.0.43) with SMTP id 10OI5WRP022356; Sun, 24 Jan 2021 10:05:44 -0800 Received: from nam12-bn8-obe.outbound.protection.outlook.com (mail-bn8nam12lp2173.outbound.protection.outlook.com [104.47.55.173]) by mx0b-00273201.pphosted.com with ESMTP id 368jxf9p31-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT); Sun, 24 Jan 2021 10:05:44 -0800 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=GXJ39O+oV3Q6WNzzyTWJb9Bp+PIuvUO7Gg5d2m3I69o+q+mrmZCfCBSQa+JIbqfvHBBZ9sPIFsT5a9CLQJt9v6oO6Q34iy0m/7agDIIMgluqho53gVoWtupDmlkqP/9hpVWZLkCW/KZN8ECjg68U9hvc4FULlW93xxrJ6nX2QTRWp9IfJaQAqnYOgfozPeVpaE7SDN8s6V7U2C5hW/ppBM5Yv+Asz8YtRMV6IHuTaxxQ48jyIzeciO5ak89kRTRrGpwI9N+ka7NX6odOax/p9sqwepF1Dj4dVJYb2Y3FdODjWuJJcVbpuucXnl8jx+KSCCVXzwfh3aKdpqAvstHDpQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=4JVY33Zd1LKdKxYFXynuVWt4rGCq5vfBIm8fWBzkzJQ=; b=VLp+Kjhii2eElnwjw8rvHAuFpSZBrxrCNPJo290jTDvm315eqdKrduHb2MNYfXLmEkFODvrBevlSqNmYSSNB6DqjiBQJ9R1YOMmrV0DG6k4xUQre0MaSh4kXea3Q13YUdgZX8VWmbc1O8NgZutsnl84w6vsZIcF/ulu/XeN6QJ4McYRA/mOLbeMNV+crzA05N8kWmZOU+H2dEC0vJ+L3U8J2cpgzEVPWxAZ0fD115t8iiZuVeCzutFZ0QqNv7UpUBA/rKScrAsZu2U7GeqMkuVQGoJhYmMXVuF8bi/95CqlnrgXRUtae2mZD/w7r+4FWXB3fCdQ5EfFTmlW1Ga5E7g== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=softfail (sender ip is 66.129.239.13) smtp.rcpttodomain=troutmask.apl.washington.edu smtp.mailfrom=juniper.net; dmarc=fail (p=reject sp=reject pct=100) action=oreject header.from=juniper.net; dkim=none (message not signed); arc=none Received: from MW4PR03CA0329.namprd03.prod.outlook.com (2603:10b6:303:dd::34) by BN7PR05MB5938.namprd05.prod.outlook.com (2603:10b6:408:d::13) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3805.7; Sun, 24 Jan 2021 18:05:40 +0000 Received: from MW2NAM12FT041.eop-nam12.prod.protection.outlook.com (2603:10b6:303:dd:cafe::fe) by MW4PR03CA0329.outlook.office365.com (2603:10b6:303:dd::34) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3784.12 via Frontend Transport; Sun, 24 Jan 2021 18:05:40 +0000 X-MS-Exchange-Authentication-Results: spf=softfail (sender IP is 66.129.239.13) smtp.mailfrom=juniper.net; troutmask.apl.washington.edu; dkim=none (message not signed) header.d=none;troutmask.apl.washington.edu; dmarc=fail action=oreject header.from=juniper.net; Received-SPF: SoftFail (protection.outlook.com: domain of transitioning juniper.net discourages use of 66.129.239.13 as permitted sender) Received: from P-EXFEND-EQX-02.jnpr.net (66.129.239.13) by MW2NAM12FT041.mail.protection.outlook.com (10.13.181.1) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.3805.6 via Frontend Transport; Sun, 24 Jan 2021 18:05:39 +0000 Received: from P-EXBEND-EQX-03.jnpr.net (10.104.8.56) by P-EXFEND-EQX-02.jnpr.net (10.104.8.55) with Microsoft SMTP Server (TLS) id 15.0.1497.2; Sun, 24 Jan 2021 10:05:39 -0800 Received: from P-EXBEND-EQX-02.jnpr.net (10.104.8.53) by P-EXBEND-EQX-03.jnpr.net (10.104.8.56) with Microsoft SMTP Server (TLS) id 15.0.1497.2; Sun, 24 Jan 2021 10:05:39 -0800 Received: from p-mailhub01.juniper.net (10.104.20.6) by P-EXBEND-EQX-02.jnpr.net (10.104.8.53) with Microsoft SMTP Server (TLS) id 15.0.1497.2 via Frontend Transport; Sun, 24 Jan 2021 10:05:39 -0800 Received: from kaos.jnpr.net (kaos.jnpr.net [172.23.255.201]) by p-mailhub01.juniper.net (8.14.4/8.11.3) with ESMTP id 10OI5cpV026692; Sun, 24 Jan 2021 10:05:38 -0800 (envelope-from sjg@juniper.net) Received: by kaos.jnpr.net (Postfix, from userid 1377) id B5CA52BE55; Sun, 24 Jan 2021 10:05:38 -0800 (PST) Received: from kaos.jnpr.net (localhost [127.0.0.1]) by kaos.jnpr.net (Postfix) with ESMTP id B438B2BD72; Sun, 24 Jan 2021 10:05:38 -0800 (PST) To: Steve Kargl CC: , Subject: Re: Getting /usr/src to match specific git hash? In-Reply-To: <20210124035852.GA73653@troutmask.apl.washington.edu> References: <20210124035852.GA73653@troutmask.apl.washington.edu> Comments: In-reply-to: Steve Kargl message dated "Sat, 23 Jan 2021 19:58:52 -0800." From: "Simon J. Gerraty" X-Mailer: MH-E 8.6+git; nmh 1.7.1; GNU Emacs 27.1 MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <13615.1611511538.1@kaos.jnpr.net> Date: Sun, 24 Jan 2021 10:05:38 -0800 Message-ID: <18487.1611511538@kaos.jnpr.net> X-EXCLAIMER-MD-CONFIG: e3cb0ff2-54e7-4646-8a04-0dae4ac7b136 X-EOPAttributedMessage: 0 X-MS-Office365-Filtering-HT: Tenant X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: b67aeacd-d74a-4673-e7a3-08d8c092a8a3 X-MS-TrafficTypeDiagnostic: BN7PR05MB5938: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:3513; X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: X3602bNrNFx2YmehCYZsQkIWIoZ2FhfftV6j19Qc+ASnx0WMEum496LAjan3vSn6OGwAtonQnoPR0bvfEJkUXZ/T32p+4B12rg9E3sCVsbhh/wb33TfUhMyS+IUvGQThmcNwcbEVaxy0BsH611ytIUKtNXm/1fz+8/0wE7OIYVmtz6oiahUxy6MoKyGK1IglrnCPbpu3x6qa3sFdBzruR718+OS8GIMKDcByPmAlgNr/QJGMRbCKur0RTkDhRpZxYBbJS03ul0uTU3aT9oOYHumsZfr4fU2fcx529aHNLxHVH5DFVS2KwAEl5xTtjIHnZSdqYz5g8rDu4MPxD6pE9WzAUpGhmxNuBPow16Ai0x01mkYakMlAJxYKZ3OL77eDg2F45TQ8JnHDYunVJ34JVj2pVER0g+Lq5XDTC9PQ95Xof/fXZlsdl9xhDIP0sGrnJvZ3wxqg1FsHmbRNfdDlZ3lhfes9B0F53io/sMF/jp+k6cslwR+rtYSbEvpK08kDuDsaNbWbvPcbW8RxkWr4/8x//X7MOnXIko5wMZqSDe98aKJF9vrLrZIN5xhWQWUK+MgYgvm7PTsq+Sq08U9XDAVw1/hCWfmLUzrafhclvtxn44kxoPWdA+6dFPj9ybiX X-Forefront-Antispam-Report: CIP:66.129.239.13; CTRY:US; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:P-EXFEND-EQX-02.jnpr.net; PTR:InfoDomainNonexistent; CAT:NONE; SFS:(4636009)(136003)(346002)(376002)(396003)(39860400002)(46966006)(82740400003)(4326008)(4744005)(82310400003)(336012)(70586007)(356005)(8936002)(70206006)(26005)(186003)(7126003)(7696005)(47076005)(54906003)(81166007)(6916009)(86362001)(316002)(107886003)(478600001)(2906002)(9686003)(8676002)(5660300002)(55016002)(6266002)(36610700001); DIR:OUT; SFP:1102; X-OriginatorOrg: juniper.net X-MS-Exchange-CrossTenant-OriginalArrivalTime: 24 Jan 2021 18:05:39.8907 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: b67aeacd-d74a-4673-e7a3-08d8c092a8a3 X-MS-Exchange-CrossTenant-Id: bea78b3c-4cdb-4130-854a-1d193232e5f4 X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=bea78b3c-4cdb-4130-854a-1d193232e5f4; Ip=[66.129.239.13]; Helo=[P-EXFEND-EQX-02.jnpr.net] X-MS-Exchange-CrossTenant-AuthSource: MW2NAM12FT041.eop-nam12.prod.protection.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Anonymous X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem X-MS-Exchange-Transport-CrossTenantHeadersStamped: BN7PR05MB5938 X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-24_06:2021-01-22, 2021-01-24 signatures=0 X-Proofpoint-Spam-Details: rule=outbound_spam_notspam policy=outbound_spam score=0 malwarescore=0 suspectscore=0 adultscore=0 clxscore=1011 priorityscore=1501 mlxlogscore=488 phishscore=0 spamscore=0 impostorscore=0 bulkscore=0 lowpriorityscore=0 mlxscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2009150000 definitions=main-2101240117 X-Rspamd-Queue-Id: 4DP1Bc6n24z3t2W X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.10 / 15.00]; RCVD_TLS_LAST(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[juniper.net:s=PPS1017,juniper.net:s=selector1]; FREEFALL_USER(0.00)[sjg]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:67.231.152.164]; MIME_GOOD(-0.10)[text/plain]; NEURAL_HAM_LONG(-1.00)[-1.000]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; RWL_MAILSPIKE_EXCELLENT(0.00)[67.231.152.164:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[juniper.net:+]; DMARC_POLICY_ALLOW(-0.50)[juniper.net,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:22843, ipnet:67.231.152.0/24, country:US]; RCVD_COUNT_SEVEN(0.00)[11]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_IN_DNSWL_LOW(-0.10)[67.231.152.164:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 18:05:45 -0000 Steve Kargl wrote: > Suppose further that one had to re-install a 32-bit > i386-*-freebsd with the 24 Dec 2020 image available > from freebsd.org. > > uname -a for the booted kernel shows > > % uname -a > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i386 > > How does one use git to pull the exact sources that match > this specifc kernel? As others have described, you can clone and 'git checkout 3cc0c0d66a0' but that "-dirty" above implies the tree had changes, so you cannot reproduce "the exact sources". --sjg From owner-freebsd-current@freebsd.org Sun Jan 24 19:14:48 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EBEA44D6E03 for ; Sun, 24 Jan 2021 19:14:48 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP2kJ0NfHz4S8Q for ; Sun, 24 Jan 2021 19:14:47 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10OJEjBv076850 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sun, 24 Jan 2021 11:14:45 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10OJEju2076849; Sun, 24 Jan 2021 11:14:45 -0800 (PST) (envelope-from sgk) Date: Sun, 24 Jan 2021 11:14:45 -0800 From: Steve Kargl To: Warner Losh Cc: Jeffrey Bouquet , Yasuhiro Kimura , freebsd-current Subject: Re: Getting /usr/src to match specific git hash? Message-ID: <20210124191445.GA76809@troutmask.apl.washington.edu> References: <20210124041403.GB73653@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DP2kJ0NfHz4S8Q X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-1.58 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM,none]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-0.58)[-0.579]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 19:14:49 -0000 On Sun, Jan 24, 2021 at 09:00:45AM -0700, Warner Losh wrote: > On Sun, Jan 24, 2021, 6:05 AM Jeffrey Bouquet > wrote: > > > > > > > On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl < > > sgk@troutmask.apl.washington.edu> wrote: > > > > > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > > > > From: Steve Kargl > > > > Subject: Getting /usr/src to match specific git hash? > > > > Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > > > > > > > Suppose one has an empty /usr/src. > > > > > > > > > > Suppose further that one had to re-install a 32-bit > > > > > i386-*-freebsd with the 24 Dec 2020 image available > > > > > from freebsd.org. > > > > > > > > > > uname -a for the booted kernel shows > > > > > > > > > > % uname -a > > > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > > > > root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC > > i386 > > > > > > > > > > How does one use git to pull the exact sources that match > > > > > this specifc kernel? > > > > > > > > cd /usr > > > > git clone https://git.freebsd.org/src.git > > > > cd src > > > > git checkout 3cc0c0d66a0 > > > > > > > > > > Thank you. > > > > > > > Can this be put in /usr/src/UPDATING with an explanation of precisely how > > each > > of the git commands populates or repopulated the directories in /usr??? > > > > It is in the mini primer I wrote, along with how to bisect and other useful > things. This will migrate into the handbook once the doc tree converts to > asciidoc (happening this weekend). > > https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md > Any advice on how to jump, say, 4 days ahead of the current date of the src/ tree? That is, I have src/ that should correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? My past week experience with top-of-tree suggests doing a bisection would be frought with peril. My laptop runs well with 24 Dec 2020 kernel/world. Getting to top-of-tree, one has to deal with (1) infinite recursion in wpa_supplicant, (2) possible locking issue in UFS (30 second system freezes), (3) memory alignment messages from the kernel, (4) processes being killed with out-of-swapspace messages even though I have 4 GB of untouched swap space. Might be associated with (3). (5) graphic console mess (6) pilot-error of using -march=core2, which matches the processor in the laptop, to build kernel/world but manifests a llvm bug I would like to creep up on the issues. -- Steve From owner-freebsd-current@freebsd.org Sun Jan 24 19:15:42 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B6A174D6DC9 for ; Sun, 24 Jan 2021 19:15:42 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP2lK5S4yz4SX4 for ; Sun, 24 Jan 2021 19:15:41 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id A77004D4E1; Mon, 25 Jan 2021 04:15:31 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611515731; bh=hmRuqIKfkUQX033+fNeIWB3QQJxKyh9rmXLTnClGIyg=; h=Date:To:Cc:Subject:From:In-Reply-To:References; b=YLMDQEDvOIFpi+aiUfLpqWKOQAPWkWQodqZ1t14SV9M5A7tN57Pt1UdScqS2REqa+ DBaLSz3lekWambCdxAFU4DG4Jt2S6vXf78pJhV5+KHxW/ivgQaihNSnL9ss5HSqGuP JeTBh+Msl6ibVZZECnELG2rVYXKXnmoflFbc27nVINLHUzBxlxde89H9P9cGghP/Ql Yr3SuGHr8hLzSI0m68UW6PkY//d7hY+JvOPAC2RjL4zZ20Q/DfmFXju4sIAaINurML AD/YKSC7yHuxa3b6tKjNzmIrgEsLPBAUxJ8AU/hQ+p80WF2pwtx+mLfcJra7AP5U+5 3BBeMtaRo6dgw== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384)) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 9CD5E4C65B; Mon, 25 Jan 2021 04:15:30 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Mon, 25 Jan 2021 04:15:24 +0900 (JST) Message-Id: <20210125.041524.2140874210852374119.yasu@utahime.org> To: sjg@juniper.net Cc: sgk@troutmask.apl.washington.edu, freebsd-current@freebsd.org Subject: Re: Getting /usr/src to match specific git hash? From: Yasuhiro Kimura In-Reply-To: <18487.1611511538@kaos.jnpr.net> References: <20210124035852.GA73653@troutmask.apl.washington.edu> <18487.1611511538@kaos.jnpr.net> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DP2lK5S4yz4SX4 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=YLMDQEDv; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [0.30 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[utahime.org]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 19:15:42 -0000 From: "Simon J. Gerraty" Subject: Re: Getting /usr/src to match specific git hash? Date: Sun, 24 Jan 2021 10:05:38 -0800 > As others have described, you can clone and 'git checkout 3cc0c0d66a0' > but that "-dirty" above implies the tree had changes, so you cannot > reproduce "the exact sources". There was bug in sys/conf/newvers.sh that reports the result of dirtyness check in reverse. It was introduced at commit 029ca1842fa on 2002/12/17 and fixed at commit 17eba5e32a2 on 2020/12/23. And commit 3cc0c0d66a0 is between them. So in this case "3cc0c0d66a0-c255241(main)-dirty" means there isn't any change in src tree. Just FYI. --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Sun Jan 24 19:28:01 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D1BAC4D74FA for ; Sun, 24 Jan 2021 19:28:01 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP31X5nHxz4T1S for ; Sun, 24 Jan 2021 19:28:00 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.16.1/8.15.2) with ESMTP id 10OJRwb1006192; Sun, 24 Jan 2021 19:27:58 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.16.1/8.16.1/Submit) id 10OJRva4006191; Sun, 24 Jan 2021 11:27:57 -0800 (PST) (envelope-from david) Date: Sun, 24 Jan 2021 11:27:57 -0800 From: David Wolfskill To: Steve Kargl Cc: freebsd-current Subject: Re: Getting /usr/src to match specific git hash? Message-ID: Reply-To: current@freebsd.org Mail-Followup-To: current@freebsd.org, Steve Kargl , freebsd-current References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124191445.GA76809@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="8gf0KpJteDrL5fMB" Content-Disposition: inline In-Reply-To: <20210124191445.GA76809@troutmask.apl.washington.edu> X-Rspamd-Queue-Id: 4DP31X5nHxz4T1S X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of david@catwhisker.org designates 107.204.234.170 as permitted sender) smtp.mailfrom=david@catwhisker.org X-Spamd-Result: default: False [-2.78 / 15.00]; HAS_REPLYTO(0.00)[current@freebsd.org]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.204.234.170:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEFALL_USER(0.00)[david]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:107.204.234.170]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; SUBJECT_ENDS_QUESTION(1.00)[]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; DMARC_NA(0.00)[catwhisker.org]; SPAMHAUS_ZRD(0.00)[107.204.234.170:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_SPAM_SHORT(0.62)[0.616]; ARC_NA(0.00)[]; RCVD_TLS_LAST(0.00)[]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 19:28:01 -0000 --8gf0KpJteDrL5fMB Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Jan 24, 2021 at 11:14:45AM -0800, Steve Kargl wrote: > ... > Any advice on how to jump, say, 4 days ahead of the current > date of the src/ tree? That is, I have src/ that should > correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? I (happen to) track FreeBSD head, stable/12 (and now, stable/13) daily on a couple of machines. In the course of that effort, the machines are set up to append the output of uname -vpUK to a file that gets copied to where my Web server can see it. (Other files are also copied, in case they might prove useful.) These are accessible from https://www.catwhisker.org/~david/FreeBSD/history/ I believe that the file that would address your immediate concern is https://www.catwhisker.org/~david/FreeBSD/history/freebeast_uname_amd64.13.= txt (There is no update for stable/13 today, as there were no chnages to stable/13 sources since stable/13-c256208-gf76393a6305b at the time I updated my local private git mirrors his morning.) > ....=20 Peace, david --=20 David H. Wolfskill david@catwhisker.org Note that political parties are not mentioned in the US Constitution at all. See https://www.catwhisker.org/~david/publickey.gpg for my public key. --8gf0KpJteDrL5fMB Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGTBAEBCgB9FiEE4owz2QxMJyaxAefyQLJg+bY2PckFAmANyj1fFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldEUy OEMzM0Q5MEM0QzI3MjZCMTAxRTdGMjQwQjI2MEY5QjYzNjNEQzkACgkQQLJg+bY2 PckGwAgAqLTwfCXEgjaLwbXgM+6Rgyfjmh4RydAZ3xXInIUHjUncpLZjUkbek2d5 ASr/pfEvAM3p2OSBIJEnPKGkoXfaYSXtoKnRTvJ2hv2StzCv5guo1UbYZX1yEAD1 Shntwo6+GkpRMvqItsJdhfZxRyoodFMyswULK5FxFYPZqTKF9fbBMMTc6y0seolf RXmnLA5XHuHg15XdrRlU8PIK3oVlSf6PUZaIh6ERvee0eHaouUkVgZ3RI7158x06 X1dF7q9iANhoSW2FDH4kVncXmWXfU4MVFo20Dp/ND/P6CcjVmp5R9A0d21H3St5F SFDgA3wFfAOhe7iSFIKgpPvPAd9DaQ== =Wcdm -----END PGP SIGNATURE----- --8gf0KpJteDrL5fMB-- From owner-freebsd-current@freebsd.org Sun Jan 24 22:22:32 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0C10E4DD264 for ; Sun, 24 Jan 2021 22:22:32 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qk1-x732.google.com (mail-qk1-x732.google.com [IPv6:2607:f8b0:4864:20::732]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP6tt6YvVz4h6r for ; Sun, 24 Jan 2021 22:22:30 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qk1-x732.google.com with SMTP id c7so10859665qke.1 for ; Sun, 24 Jan 2021 14:22:30 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=EamgXS7pSzaVWCU0Eb6CxqyNr37qSi/B8bychqJlFnY=; b=KXDajwqdx2aNrlUmXGFt2IHg1NJZwzU9Z8VFl9qP2eI4X7wEbZGxVY8Hl1zMpILksd 4vKepYo6xBLUS2L8cAFgbRUvmW8KMugygdrqieFeRoL1vn0dM9SDnurCIbytdKZw0Yhw R3z47sh/wlScxfrgEbSkjsi1lGGXIxe0yKwxg5r6zs3VdheZb8z84H6A9lOkBaiCo3L6 RPTauCFF8ttlU0RsFE4L8yLrdxCWjdR7b8QAcRHAycM1FteVtxPeWVKc5Sl2n/foLmxf aU1dnu+azH05D6nS5l9UPQ4xnVwD6vYAH2tRbZEk1c6WqAf6fZRJYUw3PvxO29HOfCBZ 4erQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=EamgXS7pSzaVWCU0Eb6CxqyNr37qSi/B8bychqJlFnY=; b=pmTCf9bVXLTIl5FzSZ/O3AL2zPhnsJivRrxFM93SR7OQANrLmuteYfLW71Riyz13uH rkjDtrYzaZOGg/yDx/8XsxydSlYqJyD4eV6OjVSHe0YdsAzg2eI/9XIcAc1gvtDKfm6k 17VZEY33lI10Fe1n8xwdPflObZ6UmsIXtWEvMb9fOLe0BqJ7p3tkJArtWfkQKEeejgFv I1/7Bo83KxZWZSW25vqhCnn0dblmHFdZpryae21ACeTA5PnoMhgTWIi7hntFJt4epKiv 4XVY8fSHfitfY7XT4hkSW8xBui/wWbz0jeJgMHaWkG72KG0MQ1CYw9ymjvAimvdP44FR uwJg== X-Gm-Message-State: AOAM5312S6fdcmQVAibY6xKO7T25cykC1RZrRGznilASF5416ejXFcrt ArfLmfltTw5l8TNwQfWwaBtNuWmR2GkOE1QIpmcvtx/KAJaHQ+bW X-Google-Smtp-Source: ABdhPJzG61Pdq1MAmb6WcjGrh6ZhJ6/TSlRWfkR4gtgtPx4YXl6fZdykG1toHSZFPRHtsak9bONkXufh8Rtxcd3RHTY= X-Received: by 2002:a37:a34f:: with SMTP id m76mr2796415qke.89.1611526949645; Sun, 24 Jan 2021 14:22:29 -0800 (PST) MIME-Version: 1.0 References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124191445.GA76809@troutmask.apl.washington.edu> In-Reply-To: <20210124191445.GA76809@troutmask.apl.washington.edu> From: Warner Losh Date: Sun, 24 Jan 2021 15:22:18 -0700 Message-ID: Subject: Re: Getting /usr/src to match specific git hash? To: Steve Kargl Cc: Jeffrey Bouquet , Yasuhiro Kimura , freebsd-current X-Rspamd-Queue-Id: 4DP6tt6YvVz4h6r X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=KXDajwqd; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::732) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-2.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::732:from]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::732:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::732:from]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; SUBJECT_ENDS_QUESTION(1.00)[]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 22:22:32 -0000 On Sun, Jan 24, 2021, 12:14 PM Steve Kargl wrote: > On Sun, Jan 24, 2021 at 09:00:45AM -0700, Warner Losh wrote: > > On Sun, Jan 24, 2021, 6:05 AM Jeffrey Bouquet > > > wrote: > > > > > > > > > > > On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl < > > > sgk@troutmask.apl.washington.edu> wrote: > > > > > > > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > > > > > From: Steve Kargl > > > > > Subject: Getting /usr/src to match specific git hash? > > > > > Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > > > > > > > > > Suppose one has an empty /usr/src. > > > > > > > > > > > > Suppose further that one had to re-install a 32-bit > > > > > > i386-*-freebsd with the 24 Dec 2020 image available > > > > > > from freebsd.org. > > > > > > > > > > > > uname -a for the booted kernel shows > > > > > > > > > > > > % uname -a > > > > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > > > > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > > > > > > root@releng1.nyi.freebsd.org: > /usr/obj/usr/src/i386.i386/sys/GENERIC > > > i386 > > > > > > > > > > > > How does one use git to pull the exact sources that match > > > > > > this specifc kernel? > > > > > > > > > > cd /usr > > > > > git clone https://git.freebsd.org/src.git > > > > > cd src > > > > > git checkout 3cc0c0d66a0 > > > > > > > > > > > > > Thank you. > > > > > > > > > > Can this be put in /usr/src/UPDATING with an explanation of precisely > how > > > each > > > of the git commands populates or repopulated the directories in /usr??? > > > > > > > It is in the mini primer I wrote, along with how to bisect and other > useful > > things. This will migrate into the handbook once the doc tree converts to > > asciidoc (happening this weekend). > > > > https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md > > > > Any advice on how to jump, say, 4 days ahead of the current > date of the src/ tree? That is, I have src/ that should > correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? > You could use git bisect, but as you say, the laundry list is extensive. Git doesn't offer checkout by date, alas. So here's some tools to help you out. First, let's get a count of how many commits behind main you are at the moment. Use 'git log --oneline --first-parent HEAD..main | wc' to get a count of the number of commits between what you have checked out and the tip of current. My count is 994, but I just updated, so your count will differ and that's OK.The --first-parent in the git log above is critical, since otherwise a number of commits from vendor merges in the vendor branches will appear in git log's output, throwing the count off). Now, this is 1 month worth of -current. 4 days in the month is about 13%. However, let's keep things simple and step forward 100 commits at a time (which is 10% of 1000). The precise numbers don't matter, but it works out well in this case. So, your commit is: % git log -1 3cc0c0d66a0 Author: Li-Wen Hsu Date: Sun Dec 20 02:59:44 2020 +0000 Mark the repository as being converted to Git. which is the last subversion commit. It's also head~994, you can do a 'git log -1 main~900' to verify that. So, let's move forward 94 commits. This would be: % git log main~900 commit 8d405efd73d3991fe1647f91a2b7c9989dd5f18f Author: Ulrich Sprlein Date: Wed Dec 23 22:29:34 2020 +0100 Fix newvers.sh to no longer print an outdated SVN rev which is 3 days newer and may be a good place to start: % git checkout main~900 and that will move you forward 94 commits. Do it again with main~800, etc to find a spot that's good for you. Not as convenient as giving dates, but once you have a count of the number of commits between where you are and head, you can use that number to decide how far forward to go. You can adjust this as needed. If you don't do a git pull during this process (and you likely shouldn't) these numbers will be stable, and a lot easier to work with than hashes. I've found I like to move N commits rather than N days. Hope this is helpful. Sadly I found no way to say HEAD+50 commits directly in git, but maybe one of the more knowledgeable folks on this list can give a better hint there. Warner My past week experience with top-of-tree suggests doing > a bisection would be frought with peril. My laptop runs > well with 24 Dec 2020 kernel/world. Getting to top-of-tree, > one has to deal with > (1) infinite recursion in wpa_supplicant, > (2) possible locking issue in UFS (30 second system freezes), > (3) memory alignment messages from the kernel, > (4) processes being killed with out-of-swapspace messages > even though I have 4 GB of untouched swap space. Might > be associated with (3). > (5) graphic console mess > (6) pilot-error of using -march=core2, which matches the > processor in the laptop, to build kernel/world but > manifests a llvm bug > > I would like to creep up on the issues. > > -- > Steve > From owner-freebsd-current@freebsd.org Sun Jan 24 22:29:49 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4B9904DD9EA for ; Sun, 24 Jan 2021 22:29:49 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qt1-x836.google.com (mail-qt1-x836.google.com [IPv6:2607:f8b0:4864:20::836]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP73J495dz4hbG for ; Sun, 24 Jan 2021 22:29:48 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qt1-x836.google.com with SMTP id c12so8447992qtv.5 for ; Sun, 24 Jan 2021 14:29:48 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=LBN1L0zSMhpuSmyWvAx+9CqVqOHfKVCvQmeJg0tzhmI=; b=QjhyHt7NObb+3KATyg3RpC1pDKx86++cbfrZBY7JZ/xwuucWJKXkaWrYmtKMSyVUH2 Ekdsj6pNth/UPMtKvxXT/lqQO/A578AM/0BSitGivDbU5lOOLOQ6nVSuBZWtnkPUxBo5 lP2cq6mAjO5OvOQBxpYzeX7QQ7K6+ymFh8Y1EAg2GeTaQNkC2doCjkzvgaRptIvoRzU1 gv5nqDJ+X7Ab4UbUQRkQzKa3mg/josOKRK0+xlHyBnXv4HkWpbZI055MnVVUmBH3eG5z NA/G6i3d5g9Iz44emycvwrTUu+rqKHfCx2F5J9HzB0pKAgP7VsWF8S8UH3HkD7BkWhFN 1xiw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=LBN1L0zSMhpuSmyWvAx+9CqVqOHfKVCvQmeJg0tzhmI=; b=mewH9Ujx5oO/rpIaVu/QDZ0bdV6tLiMITgDwp+dNwc2wY4IvUH+/EXX5um5MojEtNP OFklxRpZcipxEsm7m+p4tLyUpI0SuvZzIa54onIjGPezQOEODOX8zxLDHHxbFCE2r8RV R/7+32TdJfRSrfKOCOifBz7pmh3olpJbbkelCUxC/rvFlGkujnrV6FN+03NK8LIN+voL /1PzEKkUxUEiZuODlXLzrANsk1jH2FCYhQeiveuDJ1TO0Wam11OSEKFBkzfK+nT8HNEr 7U/N1+Syryj8Fm5tGqyGOV/UtwMvtb9+9W4aMxrfina9fW6xU8ej8OfjhdpOCSqdgfud oFfQ== X-Gm-Message-State: AOAM532ydnttM5guEHoVR6hbCtm7D5MzdjQBIG3cgKRLVNPlQE2FOfkk SuUD+pg8O7JTTAn0ZmSItDyVPujyJDvRYSAwrJqOcEQ8B3hPCw== X-Google-Smtp-Source: ABdhPJxRfrwBw3/COHLt1tCm6Ya/5zK5X34wIscfwBhJBas8kkK7TVLPgkjhDqoiLWFbqPq4W51bhwXcD3zH0xuHgWU= X-Received: by 2002:aed:2de2:: with SMTP id i89mr2261014qtd.73.1611527387226; Sun, 24 Jan 2021 14:29:47 -0800 (PST) MIME-Version: 1.0 References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124191445.GA76809@troutmask.apl.washington.edu> In-Reply-To: From: Warner Losh Date: Sun, 24 Jan 2021 15:29:36 -0700 Message-ID: Subject: Re: Getting /usr/src to match specific git hash? To: Steve Kargl Cc: Jeffrey Bouquet , Yasuhiro Kimura , freebsd-current X-Rspamd-Queue-Id: 4DP73J495dz4hbG X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=QjhyHt7N; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::836) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-2.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::836:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::836:from]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::836:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 22:29:49 -0000 On Sun, Jan 24, 2021 at 3:22 PM Warner Losh wrote: > > > On Sun, Jan 24, 2021, 12:14 PM Steve Kargl < > sgk@troutmask.apl.washington.edu> wrote: > >> On Sun, Jan 24, 2021 at 09:00:45AM -0700, Warner Losh wrote: >> > On Sun, Jan 24, 2021, 6:05 AM Jeffrey Bouquet < >> jbtakk@iherebuywisely.com> >> > wrote: >> > >> > > >> > > >> > > On Sat, 23 Jan 2021 20:14:03 -0800, Steve Kargl < >> > > sgk@troutmask.apl.washington.edu> wrote: >> > > >> > > > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: >> > > > > From: Steve Kargl >> > > > > Subject: Getting /usr/src to match specific git hash? >> > > > > Date: Sat, 23 Jan 2021 19:58:52 -0800 >> > > > > >> > > > > > Suppose one has an empty /usr/src. >> > > > > > >> > > > > > Suppose further that one had to re-install a 32-bit >> > > > > > i386-*-freebsd with the 24 Dec 2020 image available >> > > > > > from freebsd.org. >> > > > > > >> > > > > > uname -a for the booted kernel shows >> > > > > > >> > > > > > % uname -a >> > > > > > FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ >> > > > > > 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ >> > > > > > root@releng1.nyi.freebsd.org: >> /usr/obj/usr/src/i386.i386/sys/GENERIC >> > > i386 >> > > > > > >> > > > > > How does one use git to pull the exact sources that match >> > > > > > this specifc kernel? >> > > > > >> > > > > cd /usr >> > > > > git clone https://git.freebsd.org/src.git >> > > > > cd src >> > > > > git checkout 3cc0c0d66a0 >> > > > > >> > > > >> > > > Thank you. >> > > > >> > > >> > > Can this be put in /usr/src/UPDATING with an explanation of precisely >> how >> > > each >> > > of the git commands populates or repopulated the directories in >> /usr??? >> > > >> > >> > It is in the mini primer I wrote, along with how to bisect and other >> useful >> > things. This will migrate into the handbook once the doc tree converts >> to >> > asciidoc (happening this weekend). >> > >> > https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md >> > >> >> Any advice on how to jump, say, 4 days ahead of the current >> date of the src/ tree? That is, I have src/ that should >> correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? >> > > You could use git bisect, but as you say, the laundry list is extensive. > > Git doesn't offer checkout by date, alas. So here's some tools to help you > out. > > First, let's get a count of how many commits behind main you are at the > moment. Use 'git log --oneline --first-parent HEAD..main | wc' to get a > count of the number of commits between what you have checked out and the > tip of current. My count is 994, but I just updated, so your count will > differ and that's OK.The --first-parent in the git log above is critical, > since otherwise a number of commits from vendor merges in the vendor > branches will appear in git log's output, throwing the count off). > > Now, this is 1 month worth of -current. 4 days in the month is about 13%. > However, let's keep things simple and step forward 100 commits at a time > (which is 10% of 1000). The precise numbers don't matter, but it works out > well in this case. > > So, your commit is: > % git log -1 3cc0c0d66a0 > Author: Li-Wen Hsu > Date: Sun Dec 20 02:59:44 2020 +0000 > > Mark the repository as being converted to Git. > > which is the last subversion commit. It's also head~994, you can do a 'git > log -1 main~900' to verify that. So, let's move forward 94 commits. This > would be: > The 'main~900' should be 'main~994' here since you are verifying main~944. Also 'head~994' was a typo for 'main~994'. Sorry for any confusion these mistakes caused. > % git log main~900 > commit 8d405efd73d3991fe1647f91a2b7c9989dd5f18f > Author: Ulrich Sprlein > Date: Wed Dec 23 22:29:34 2020 +0100 > > Fix newvers.sh to no longer print an outdated SVN rev > > which is 3 days newer and may be a good place to start: > > % git checkout main~900 > > and that will move you forward 94 commits. Do it again with main~800, etc > to find a spot that's good for you. Not as convenient as giving dates, but > once you have a count of the number of commits between where you are and > head, you can use that number to decide how far forward to go. > > You can adjust this as needed. If you don't do a git pull during this > process (and you likely shouldn't) these numbers will be stable, and a lot > easier to work with than hashes. I've found I like to move N commits rather > than N days. > > Hope this is helpful. Sadly I found no way to say HEAD+50 commits directly > in git, but maybe one of the more knowledgeable folks on this list can give > a better hint there. > > Warner > > > My past week experience with top-of-tree suggests doing >> a bisection would be frought with peril. My laptop runs >> well with 24 Dec 2020 kernel/world. Getting to top-of-tree, >> one has to deal with >> (1) infinite recursion in wpa_supplicant, >> (2) possible locking issue in UFS (30 second system freezes), >> (3) memory alignment messages from the kernel, >> (4) processes being killed with out-of-swapspace messages >> even though I have 4 GB of untouched swap space. Might >> be associated with (3). >> (5) graphic console mess >> (6) pilot-error of using -march=core2, which matches the >> processor in the laptop, to build kernel/world but >> manifests a llvm bug >> >> I would like to creep up on the issues. >> >> -- >> Steve >> > From owner-freebsd-current@freebsd.org Sun Jan 24 22:40:50 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 072634DDE3C for ; Sun, 24 Jan 2021 22:40:50 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP7J11fmkz4hpZ for ; Sun, 24 Jan 2021 22:40:48 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10OMekLd077472 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Sun, 24 Jan 2021 14:40:46 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10OMekLu077471; Sun, 24 Jan 2021 14:40:46 -0800 (PST) (envelope-from sgk) Date: Sun, 24 Jan 2021 14:40:46 -0800 From: Steve Kargl To: Warner Losh Cc: Jeffrey Bouquet , Yasuhiro Kimura , freebsd-current Subject: Re: Getting /usr/src to match specific git hash? Message-ID: <20210124224046.GA77416@troutmask.apl.washington.edu> References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124191445.GA76809@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DP7J11fmkz4hpZ X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-2.00 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; MAILMAN_DEST(0.00)[freebsd-current]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM, none] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 22:40:50 -0000 On Sun, Jan 24, 2021 at 03:22:18PM -0700, Warner Losh wrote: > On Sun, Jan 24, 2021, 12:14 PM Steve Kargl > wrote: > >> >> Any advice on how to jump, say, 4 days ahead of the current >> date of the src/ tree? That is, I have src/ that should >> correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? >> > > You could use git bisect, but as you say, the laundry list is extensive. > > Git doesn't offer checkout by date, alas. So here's some tools to help you > out. > > First, let's get a count of how many commits behind main you are at the > moment. Use 'git log --oneline --first-parent HEAD..main | wc' to get a > count of the number of commits between what you have checked out and the > tip of current. My count is 994, but I just updated, so your count will > differ and that's OK.The --first-parent in the git log above is critical, > since otherwise a number of commits from vendor merges in the vendor > branches will appear in git log's output, throwing the count off). > > Now, this is 1 month worth of -current. 4 days in the month is about 13%. > However, let's keep things simple and step forward 100 commits at a time > (which is 10% of 1000). The precise numbers don't matter, but it works out > well in this case. > > So, your commit is: > % git log -1 3cc0c0d66a0 > Author: Li-Wen Hsu > Date: Sun Dec 20 02:59:44 2020 +0000 > > Mark the repository as being converted to Git. > > which is the last subversion commit. It's also head~994, you can do a 'git > log -1 main~900' to verify that. So, let's move forward 94 commits. This > would be: > > % git log main~900 > commit 8d405efd73d3991fe1647f91a2b7c9989dd5f18f > Author: Ulrich Sprlein > Date: Wed Dec 23 22:29:34 2020 +0100 > > Fix newvers.sh to no longer print an outdated SVN rev > > which is 3 days newer and may be a good place to start: > > % git checkout main~900 > > and that will move you forward 94 commits. Do it again with main~800, etc > to find a spot that's good for you. Not as convenient as giving dates, but > once you have a count of the number of commits between where you are and > head, you can use that number to decide how far forward to go. > > You can adjust this as needed. If you don't do a git pull during this > process (and you likely shouldn't) these numbers will be stable, and a lot > easier to work with than hashes. I've found I like to move N commits rather > than N days. > > Hope this is helpful. Sadly I found no way to say HEAD+50 commits directly > in git, but maybe one of the more knowledgeable folks on this list can give > a better hint there. > > Warner Thanks for the thorough reply! After David's response I started to think (yes, I should do that more often) about the mailing list archive dev-commits-src-main. Each subject line starts with, for example, "git: 68dc94c7d314 - main -". I assume that the hash value is sufficient to grab a src/ up to and including the commit. Will the following % cd /usr/src # This is at 3cc0c0d66a0 % git checkout 68dc94c7d314 # Update to last commit in 2020. bring the src/ update to 68dc94c7d314 or do I need to use 'git pull 68dc94c7d314'? -- Steve From owner-freebsd-current@freebsd.org Sun Jan 24 23:19:42 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3C57A4DEE6F for ; Sun, 24 Jan 2021 23:19:42 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DP88t09x9z4kvC for ; Sun, 24 Jan 2021 23:19:42 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 060AE4DEE6E; Sun, 24 Jan 2021 23:19:42 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 04B764DEE6D for ; Sun, 24 Jan 2021 23:19:42 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP88s5dwyz4ksH for ; Sun, 24 Jan 2021 23:19:41 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1611530379; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=eFsXfQ60DTC47BSyJUn6zxLA/og=; b=P0zMn+X8GXDMhgzDvlepivniJ60HFU0lanVJXZrm0kkSWpPVgvmv/ISqhSnErDk5 YQm6NoNxhAZxV56Sl6DsbesQBFOHRpj/dTEmBZWPLPaXQFvFZZgunl2XIdZww5PL XfMHaJy2LJ5/gI5NybMSsMLC7l1neRdaaDQ3BWM3Qs2yhETWn8fs5vkczmfhxCj8 VUiTQyq4u3wqmpJw9WQ16IOdgy7+Jo4UdntAemwZyZYr33UyRSjZ5UulYzsLxePs 3lsl0xfDnrxrybMQPC6r1T9oLh+ICzaml+5fa6zpoJS5lRn7PpHbrvKbiviWpYkL 0UpKyDZZjdEDAGkYLB1IoA==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.3 cv=WI8BoUkR c=1 sm=1 tr=0 cx=a_idp_x a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=EmqxpYm9HcoA:10 a=48faUk6PgeAA:10 a=LfHbLNSW0RYK-v-Bdk0A:9 a=CjuIK1q_8ugA:10 a=pHzHmUro8NiASowvMSCR:22 a=nt3jZW36AmriUCFCBwmW:22 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:53061] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id 9B/5C-14242-A800E006; Sun, 24 Jan 2021 18:19:39 -0500 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24590.137.690675.515036@jerusalem.litteratus.org> Date: Sun, 24 Jan 2021 18:19:37 -0500 From: Robert Huff To: current@freebsd.org, x11@freebsd.org Subject: loading drm crashes system X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verditct: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledrvddvgddtjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfujgfpteevqfftnfgvrghrnhhinhhgpdftvefppdfqfgfvnecuuegrihhlohhuthemuceftddunecunecujfgurhepgggtgffkfffhvffuofesthejredtredtvdenucfhrhhomheptfhosggvrhhtucfjuhhffhcuoehrohgsvghrthhhuhhffhesrhgtnhdrtghomheqnecuggftrfgrthhtvghrnhepteehtedugefgtdeiveefueekffejffdvveelkedtueffkefhheektdeukefhteetnecuffhomhgrihhnpegsohhothdrihhnnecukfhppedvtdelrdeirddvfedtrdegkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdeirddvfedtrdegkeenpdhmrghilhhfrhhomheprhhosggvrhhthhhufhhfsehrtghnrdgtohhmnedprhgtphhtthhopegtuhhrrhgvnhhtsehfrhgvvggsshgurdhorhhgne X-Rspamd-Queue-Id: 4DP88s5dwyz4ksH X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=P0zMn+X8; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-5.10 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24:c]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[rcn.com:dkim]; RWL_MAILSPIKE_POSSIBLE(0.00)[69.168.97.78:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; SPAMHAUS_ZRD(0.00)[69.168.97.78:from:127.0.2.255]; DKIM_TRACE(0.00)[rcn.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[69.168.97.78:from]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[current]; RCVD_IN_DNSWL_LOW(-0.10)[69.168.97.78:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 24 Jan 2021 23:19:42 -0000 Hello: On a system now running: 14.0-CURRENT FreeBSD 14.0-CURRENT #0 main-d6327ae8c1: Sun Jan 24 14:16:54 EST 2021 amd64 (src+ports updated at midnight US EST) with PORTS_MODULES="drm-current-kmod gpu-firmware-kmod", starting the system _without_ loading drm results in a usable system. Loading drm - whether via kldlist in rc.conf or by kldload at the console immediately after start-up - instantly crashes the system; the screen goes blank and the lights on the monitor report no signal from the system. There is nothing in dmesg.boot. In messages I find (75 lines follow): Jan 24 17:35:22 jerusalem kernel: [drm:drm_core_init] Initialized Jan 24 17:35:22 jerusalem kernel: [drm] radeon kernel modesetting enabled. Jan 24 17:35:22 jerusalem kernel: drmn0: on vgapci0 Jan 24 17:35:22 jerusalem kernel: vgapci0: child drmn0 requested pci_enable_io Jan 24 17:35:22 jerusalem kernel: [drm:drm_minor_register] Jan 24 17:35:22 jerusalem kernel: [drm:drm_minor_register] new minor registered 128 Jan 24 17:35:22 jerusalem kernel: [drm:drm_minor_register] Jan 24 17:35:22 jerusalem kernel: [drm:drm_minor_register] new minor registered 0 Jan 24 17:35:22 jerusalem kernel: [drm] initializing kernel modesetting (RS780 0x1002:0x9614 0x1849:0x9614 0x00). Jan 24 17:35:22 jerusalem kernel: [drm:radeon_get_bios] ATOMBIOS detected Jan 24 17:35:22 jerusalem kernel: [drm ERROR :radeon_atombios_init] Unable to find PCI I/O BAR; using MMIO for ATOM IIO Jan 24 17:35:22 jerusalem kernel: [drm:atom_allocate_fb_scratch] atom firmware requested 17ffb000 20kb Jan 24 17:35:22 jerusalem kernel: drmn0: VRAM: 384M 0x00000000C0000000 - 0x00000000D7FFFFFF (384M used) Jan 24 17:35:22 jerusalem kernel: drmn0: GTT: 512M 0x00000000A0000000 - 0x00000000BFFFFFFF Jan 24 17:35:22 jerusalem kernel: [drm] Detected VRAM RAM=384M, BAR=256M Jan 24 17:35:22 jerusalem kernel: [drm] RAM width 32bits DDR Jan 24 17:35:22 jerusalem kernel: [drm] radeon: 384M of VRAM memory ready Jan 24 17:35:22 jerusalem kernel: [drm] radeon: 512M of GTT memory ready. Jan 24 17:35:22 jerusalem kernel: [drm:r600_init_microcode] Jan 24 17:35:22 jerusalem kernel: [drm] Loading RS780 Microcode Jan 24 17:35:23 jerusalem kernel: drmn0: fail (0) to get firmware image with name: radeon/RS780_pfp.bin Jan 24 17:35:23 jerusalem kernel: drmn0: successfully loaded firmware image with mapped name: radeon_RS780_pfp_bin Jan 24 17:35:23 jerusalem kernel: drmn0: fail (0) to get firmware image with name: radeon/RS780_me.bin Jan 24 17:35:23 jerusalem kernel: drmn0: successfully loaded firmware image with mapped name: radeon_RS780_me_bin Jan 24 17:35:24 jerusalem kernel: drmn0: fail (0) to get firmware image with name: radeon/R600_rlc.bin Jan 24 17:35:24 jerusalem kernel: drmn0: successfully loaded firmware image with mapped name: radeon_R600_rlc_bin Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] 3 Power State(s) Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] State 0: Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] Default[drm:radeon_pm_print_states] 1 Clock Mode(s) Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] 0 e: 800000 Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] State 1: Performance Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] 1 Clock Mode(s) Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] 0 e: 500000 Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] State 2: Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] 1 Clock Mode(s) Jan 24 17:35:24 jerusalem kernel: [drm:radeon_pm_print_states] 0 e: 500000 Jan 24 17:35:24 jerusalem kernel: [drm] radeon: power management initialized Jan 24 17:35:24 jerusalem kernel: drmn0: fail (0) to get firmware image with name: radeon/RS780_uvd.bin Jan 24 17:35:24 jerusalem kernel: drmn0: successfully loaded firmware image with mapped name: radeon_RS780_uvd_bin Jan 24 17:35:24 jerusalem kernel: [drm] GART: num cpu pages 131072, num gpu pages 131072 Jan 24 17:35:34 jerusalem kernel: [drm] PCIE GART of 512M enabled (table at 0x00000000C0146000). Jan 24 17:35:34 jerusalem kernel: drmn0: WB enabled Jan 24 17:35:34 jerusalem kernel: drmn0: fence driver on ring 0 use gpu addr 0x00000000a0000c00 and cpu addr 0x0xfffff801cb29cc00 Jan 24 17:35:34 jerusalem kernel: drmn0: fence driver on ring 5 use gpu addr 0x00000000c0056038 and cpu addr 0x0xfffff800d0056038 Jan 24 17:35:34 jerusalem kernel: [drm] Supports vblank timestamp caching Rev 2 (21.10.2013). Jan 24 17:35:34 jerusalem kernel: [drm] Driver supports precise vblank timestamp query. Jan 24 17:35:34 jerusalem kernel: drmn0: radeon: MSI limited to 32-bit Jan 24 17:35:34 jerusalem kernel: [drm:drm_irq_install] irq=18 Jan 24 17:35:34 jerusalem kernel: [drm] radeon: irq initialized. Jan 24 17:35:34 jerusalem kernel: [drm:r600_irq_process] r600_irq_process start: rptr 0, wptr 32 Jan 24 17:35:34 jerusalem kernel: [drm:r600_irq_process] IH: D1 flip Jan 24 17:35:34 jerusalem kernel: [drm:r600_irq_process] IH: D2 flip Jan 24 17:35:34 jerusalem kernel: [drm] ring test on 0 succeeded in 1 usecs Jan 24 17:35:34 jerusalem kernel: [drm ERROR :uvd_v1_0_start] UVD not responding, trying to reset the VCPU!!! Jan 24 17:35:35 jerusalem kernel: [drm ERROR :uvd_v1_0_start] UVD not responding, giving up!!! Jan 24 17:35:35 jerusalem kernel: drmn0: failed initializing UVD (-1). Jan 24 17:35:35 jerusalem kernel: [drm:r600_irq_set] r600_irq_set: sw int Jan 24 17:35:35 jerusalem kernel: [drm] ib test on ring 0 succeeded in 0 usecs Jan 24 17:35:35 jerusalem kernel: [drm:radeon_atombios_get_tv_info] Unknown TV standard; defaulting to NTSC Jan 24 17:35:35 jerusalem kernel: [drm] Connector VGA-1: get mode from tunables: Jan 24 17:35:35 jerusalem kernel: [drm] - kern.vt.fb.modes.VGA-1 Jan 24 17:35:35 jerusalem kernel: [drm] - kern.vt.fb.default_mode Jan 24 17:35:35 jerusalem kernel: [drm:drm_connector_get_cmdline_mode] cmdline mode for connector VGA-1 800x600@60Hz Jan 24 17:35:35 jerusalem kernel: [drm:drm_sysfs_connector_add] adding "VGA-1" to sysfs Jan 24 17:35:35 jerusalem kernel: [drm:drm_sysfs_hotplug_event] generating hotplug event Jan 24 17:35:35 jerusalem kernel: [drm] Connector DVI-D-1: get mode from tunables: Jan 24 17:35:35 jerusalem kernel: [drm] - kern.vt.fb.modes.DVI-D-1 Jan 24 17:35:35 jerusalem kernel: [drm] - kern.vt.fb.default_mode Jan 24 17:35:35 jerusalem kernel: [drm:drm_connector_get_cmdline_mode] cmdline mode for connector DVI-D-1 800x600@60Hz Jan 24 17:35:35 jerusalem kernel: [drm:drm_sysfs_connector_add] adding "DVI-D-1" to sysfs Jan 24 17:35:35 jerusalem kernel: [drm:drm_sysfs_hotplug_event] generating hotplug event Jan 24 17:35:35 jerusalem kernel: [drm] Radeon Display Connectors Jan 24 17:35:35 jerusalem kernel: [drm] Connector 0: Jan 24 17:35:35 jerusalem kernel: [drm] VGA-1 Jan 24 17:35:35 jerusalem kernel: [drm] DDC: 0x7e40 0x7e40 0x7e44 0x7e44 0x7e48 0x7e48 0x7e4c 0x7e4c Jan 24 17:35:35 jerusalem kernel: [drm] Encoders: Jan 24 17:35:35 jerusalem kernel: [drm] CRT1: INTERNAL_KLDSCP_DAC1 Jan 24 17:35:35 jerusalem kernel: [drm] Connector 1: Jan 24 17:35:35 jerusalem kernel: [drm] DVI-D-1 Jan 24 17:35:35 jerusalem kernel: [drm] HPD3 Jan 24 17:35:35 jerusalem kernel: [drm] DDC: 0x7e50 0x7e50 0x7e54 0x7e54 0x7e58 0x7e58 0x7e5c 0x7e5c Jan 24 17:35:35 jerusalem kernel: [drm] Encoders: Jan 24 17:35:35 jerusalem kernel: [drm] DFP3: INTERNAL_KLDSCP_LVTMA Jan 24 17:35:35 jerusalem kernel: [drm:r600_irq_set] r600_irq_set: hpd 3 Jan 24 17:35:35 jerusalem kernel: [drm:radeon_atom_encoder_dpms] encoder dpms 21 to mode 3, devices 00000001, active_devices 00000000 Jan 24 17:35:35 jerusalem kernel: [drm:radeon_atom_encoder_dpms] encoder dpms 31 to mode 3, devices 00000200, active_devices 00000000 Jan 24 17:35:35 jerusalem kernel: [drm:drm_crtc_vblank_off] crtc 0, vblank enabled 0, inmodeset 0 Jan 24 17:35:35 jerusalem kernel: [drm:drm_crtc_vblank_off] crtc 1, vblank enabled 0, inmodeset 0 Jan 24 17:35:35 jerusalem kernel: [drm:drm_client_modeset_probe] Jan 24 17:35:35 jerusalem kernel: [drm:drm_mode_object_get] OBJ ID: 46 (2) Jan 24 17:35:35 jerusalem kernel: [drm:drm_mode_object_get] OBJ ID: 48 (2) Jan 24 17:35:35 jerusalem kernel: [drm:drm_helper_probe_single_connector_modes] [CONNECTOR:46:VGA-1] Jan 24 17:35:35 jerusalem kernel: [drm] Cannot find any crtc or sizes Jan 24 17:35:35 jerusalem kernel: [drm] Initialized radeon 2.50.0 20080528 for drmn0 on minor 0 Jan 24 17:35:36 jerusalem kernel: [drm] Cannot find any crtc or sizes [insert image of open jaw and glassy-eyed stare] The GPU is a Radeon HD 3300, and at one point this used to work. Help, please? Respectfully, Robert Huff From owner-freebsd-current@freebsd.org Mon Jan 25 00:21:03 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2DE444E095C for ; Mon, 25 Jan 2021 00:21:03 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from p-impout004.msg.pkvw.co.charter.net (p-impout004aa.msg.pkvw.co.charter.net [47.43.26.135]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DP9Wd703cz4nwZ for ; Mon, 25 Jan 2021 00:21:01 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from [192.168.13.11] ([45.47.45.55]) by cmsmtp with ESMTP id 3pcpllZKZT9mm3pcqlmvOn; Mon, 25 Jan 2021 00:21:00 +0000 X-Authority-Analysis: v=2.3 cv=QZ4YQfTv c=1 sm=1 tr=0 a=oJ4f3sEZGTo/oTi6ieWQlw==:117 a=oJ4f3sEZGTo/oTi6ieWQlw==:17 a=IkcTkHD0fZMA:10 a=6I5d2MoRAAAA:8 a=8sGWOcEv3BgnjkXGjtcA:9 a=QEXdDO2ut3YA:10 a=IjZwj45LgO3ly-622nXo:22 Subject: Re: Getting /usr/src to match specific git hash? To: freebsd-current@freebsd.org References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124191445.GA76809@troutmask.apl.washington.edu> <20210124224046.GA77416@troutmask.apl.washington.edu> From: monochrome Message-ID: Date: Sun, 24 Jan 2021 19:20:59 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <20210124224046.GA77416@troutmask.apl.washington.edu> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-CMAE-Envelope: MS4wfOvVcMWcW9I87YVQLJYzQ2rcs+5xybaErHbhwEOJOvDpG7nG2VYOplgrphyBJ1elgs+Md7xstdOfiKroJysiEN4CDGp01eOFG53SjZml/OsuZvPn/ZSy INlGsXQjp9i4HgXSQ7jnHcM3kUXYRLoEwI4xJlWiOBq6vZ6X2es+Ju5k8PH005GaJVMJE7UgLVxumQ== X-Rspamd-Queue-Id: 4DP9Wd703cz4nwZ X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of monochrome@twcny.rr.com designates 47.43.26.135 as permitted sender) smtp.mailfrom=monochrome@twcny.rr.com X-Spamd-Result: default: False [-2.30 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[47.43.26.135:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:47.43.26.0/24]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[rr.com]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[45.47.45.55:received]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[47.43.26.135:from]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:40294, ipnet:47.43.24.0/21, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 00:21:03 -0000 after looking in the git log for the hash I use: git -C /usr/src reset --hard you will lose any local changes On 1/24/21 5:40 PM, Steve Kargl wrote: > On Sun, Jan 24, 2021 at 03:22:18PM -0700, Warner Losh wrote: >> On Sun, Jan 24, 2021, 12:14 PM Steve Kargl >> wrote: >> >>> >>> Any advice on how to jump, say, 4 days ahead of the current >>> date of the src/ tree? That is, I have src/ that should >>> correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? >>> >> >> You could use git bisect, but as you say, the laundry list is extensive. >> >> Git doesn't offer checkout by date, alas. So here's some tools to help you >> out. >> >> First, let's get a count of how many commits behind main you are at the >> moment. Use 'git log --oneline --first-parent HEAD..main | wc' to get a >> count of the number of commits between what you have checked out and the >> tip of current. My count is 994, but I just updated, so your count will >> differ and that's OK.The --first-parent in the git log above is critical, >> since otherwise a number of commits from vendor merges in the vendor >> branches will appear in git log's output, throwing the count off). >> >> Now, this is 1 month worth of -current. 4 days in the month is about 13%. >> However, let's keep things simple and step forward 100 commits at a time >> (which is 10% of 1000). The precise numbers don't matter, but it works out >> well in this case. >> >> So, your commit is: >> % git log -1 3cc0c0d66a0 >> Author: Li-Wen Hsu >> Date: Sun Dec 20 02:59:44 2020 +0000 >> >> Mark the repository as being converted to Git. >> >> which is the last subversion commit. It's also head~994, you can do a 'git >> log -1 main~900' to verify that. So, let's move forward 94 commits. This >> would be: >> >> % git log main~900 >> commit 8d405efd73d3991fe1647f91a2b7c9989dd5f18f >> Author: Ulrich Sprlein >> Date: Wed Dec 23 22:29:34 2020 +0100 >> >> Fix newvers.sh to no longer print an outdated SVN rev >> >> which is 3 days newer and may be a good place to start: >> >> % git checkout main~900 >> >> and that will move you forward 94 commits. Do it again with main~800, etc >> to find a spot that's good for you. Not as convenient as giving dates, but >> once you have a count of the number of commits between where you are and >> head, you can use that number to decide how far forward to go. >> >> You can adjust this as needed. If you don't do a git pull during this >> process (and you likely shouldn't) these numbers will be stable, and a lot >> easier to work with than hashes. I've found I like to move N commits rather >> than N days. >> >> Hope this is helpful. Sadly I found no way to say HEAD+50 commits directly >> in git, but maybe one of the more knowledgeable folks on this list can give >> a better hint there. >> >> Warner > > Thanks for the thorough reply! After David's response > I started to think (yes, I should do that more often) > about the mailing list archive dev-commits-src-main. > Each subject line starts with, for example, > "git: 68dc94c7d314 - main -". I assume that the hash > value is sufficient to grab a src/ up to and including > the commit. Will the following > > % cd /usr/src # This is at 3cc0c0d66a0 > % git checkout 68dc94c7d314 # Update to last commit in 2020. > > bring the src/ update to 68dc94c7d314 or do > I need to use 'git pull 68dc94c7d314'? > From owner-freebsd-current@freebsd.org Mon Jan 25 01:05:11 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 23DA14E2045 for ; Mon, 25 Jan 2021 01:05:11 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qt1-x836.google.com (mail-qt1-x836.google.com [IPv6:2607:f8b0:4864:20::836]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPBVZ0ZQGz4rF8 for ; Mon, 25 Jan 2021 01:05:09 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qt1-x836.google.com with SMTP id e15so8597872qte.9 for ; Sun, 24 Jan 2021 17:05:09 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=lGIK89mPJHof6xJxd/8tB0j7MZQv4PXv+ex4RvkuNp8=; b=sP9Nd05XVmdfpQCFd5DKUW8laNP9qkRxOTMzmSSX5/17Bhk2Lq3nBYQW4ce311DHtL gyKZ99HizDF7x2WTnA6KyU0aFUxZ/+WmvQoY8B+vvGLNXrFb4JyxO8BnxZvbYGAc1/tE YKC4a/8xK0Vngfd1Mc+pvxOgdj39/jwbXz30WNa8BGbCUo+eghOqsIHtBU+a3np0XBrI wTCG+cYsc8e4XCjHcZLvh3or14c3llDjYA4sIkYcvVSFpF40n9PRFe5ODE2wq3x9kMgD WXzTEbEBovUwxWbMItr7ISihBiIQCDVr76nNdtg4PF5ZBCjReVOTAgbPQO/gwsmdzfB+ ABMA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=lGIK89mPJHof6xJxd/8tB0j7MZQv4PXv+ex4RvkuNp8=; b=ICG+EO+xswVo8AiS1kNLjeDOVHAXwjirsrw426GA2TAZ4+h9mvr0Geso1KInt8MFzZ YBN86K2wmzM51ciJ3AU6aEfIfj+vHyo2m9OE7n9ivJ+MvONqF5Ua9aiwzUmhxsqnJDhv yzg1LR6RBHXGzmzQyZt7WbSJlNWGkxrOpB2scNO9Z8ub4+eZ1/qCtXVQjIiqrHB9e2mp N9FlYMviYhhX8Ui6KFeu8dsfEu/gE5X4kfqTGf0F6fSDbkzstXnF5gfIhRMeP5opfb5f 8geIdVTfNYhsLqu71oPcyKXZTMGLKPHa8UxKT5gwmUgqgrZhkRzuKHocnU9pdpYmBfjU 8s9g== X-Gm-Message-State: AOAM530LxkNZR2U3hY8vFEbXDi+tTxiQjRsAKolOxJcN1cBR0XEH07zx XiHkKt7H8C0s8AIufGlTOe5hACRP2hWvWADtw1Sg+Q== X-Google-Smtp-Source: ABdhPJwHPFTZ3KF49t17tOxgy3p2Aw5fV1FivSFqTwwyyGH5mAJ0cpXa+pBk562w96Hgr4obXZPjcazyv+6X2E7d3mw= X-Received: by 2002:aed:2de2:: with SMTP id i89mr2655100qtd.73.1611536708401; Sun, 24 Jan 2021 17:05:08 -0800 (PST) MIME-Version: 1.0 References: <20210124041403.GB73653@troutmask.apl.washington.edu> <20210124191445.GA76809@troutmask.apl.washington.edu> <20210124224046.GA77416@troutmask.apl.washington.edu> In-Reply-To: <20210124224046.GA77416@troutmask.apl.washington.edu> From: Warner Losh Date: Sun, 24 Jan 2021 18:04:57 -0700 Message-ID: Subject: Re: Getting /usr/src to match specific git hash? To: Steve Kargl Cc: Jeffrey Bouquet , Yasuhiro Kimura , freebsd-current X-Rspamd-Queue-Id: 4DPBVZ0ZQGz4rF8 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=sP9Nd05X; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::836) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-2.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::836:from]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::836:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::836:from]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 01:05:11 -0000 On Sun, Jan 24, 2021 at 3:40 PM Steve Kargl < sgk@troutmask.apl.washington.edu> wrote: > On Sun, Jan 24, 2021 at 03:22:18PM -0700, Warner Losh wrote: > > On Sun, Jan 24, 2021, 12:14 PM Steve Kargl < > sgk@troutmask.apl.washington.edu> > > wrote: > > > >> > >> Any advice on how to jump, say, 4 days ahead of the current > >> date of the src/ tree? That is, I have src/ that should > >> correspond to 24 Dec 2020. How do I jump to 28 Dec 2020? > >> > > > > You could use git bisect, but as you say, the laundry list is extensive. > > > > Git doesn't offer checkout by date, alas. So here's some tools to help > you > > out. > > > > First, let's get a count of how many commits behind main you are at the > > moment. Use 'git log --oneline --first-parent HEAD..main | wc' to get a > > count of the number of commits between what you have checked out and the > > tip of current. My count is 994, but I just updated, so your count will > > differ and that's OK.The --first-parent in the git log above is critical, > > since otherwise a number of commits from vendor merges in the vendor > > branches will appear in git log's output, throwing the count off). > > > > Now, this is 1 month worth of -current. 4 days in the month is about 13%. > > However, let's keep things simple and step forward 100 commits at a time > > (which is 10% of 1000). The precise numbers don't matter, but it works > out > > well in this case. > > > > So, your commit is: > > % git log -1 3cc0c0d66a0 > > Author: Li-Wen Hsu > > Date: Sun Dec 20 02:59:44 2020 +0000 > > > > Mark the repository as being converted to Git. > > > > which is the last subversion commit. It's also head~994, you can do a > 'git > > log -1 main~900' to verify that. So, let's move forward 94 commits. This > > would be: > > > > % git log main~900 > > commit 8d405efd73d3991fe1647f91a2b7c9989dd5f18f > > Author: Ulrich Sprlein > > Date: Wed Dec 23 22:29:34 2020 +0100 > > > > Fix newvers.sh to no longer print an outdated SVN rev > > > > which is 3 days newer and may be a good place to start: > > > > % git checkout main~900 > > > > and that will move you forward 94 commits. Do it again with main~800, etc > > to find a spot that's good for you. Not as convenient as giving dates, > but > > once you have a count of the number of commits between where you are and > > head, you can use that number to decide how far forward to go. > > > > You can adjust this as needed. If you don't do a git pull during this > > process (and you likely shouldn't) these numbers will be stable, and a > lot > > easier to work with than hashes. I've found I like to move N commits > rather > > than N days. > > > > Hope this is helpful. Sadly I found no way to say HEAD+50 commits > directly > > in git, but maybe one of the more knowledgeable folks on this list can > give > > a better hint there. > > > > Warner > > Thanks for the thorough reply! After David's response > I started to think (yes, I should do that more often) > about the mailing list archive dev-commits-src-main. > Each subject line starts with, for example, > "git: 68dc94c7d314 - main -". I assume that the hash > value is sufficient to grab a src/ up to and including > the commit. Will the following > > % cd /usr/src # This is at 3cc0c0d66a0 > % git checkout 68dc94c7d314 # Update to last commit in 2020. > > bring the src/ update to 68dc94c7d314 or do > I need to use 'git pull 68dc94c7d314'? > Sure. If you can find hashes, then git checkout does the job. git pull brings in any changes you don't already have, so unless you've not updated at all this year, you don't need any kind of pull. And if you did want to update, might I suggest 'git fetch' which is the first half of 'git pull' which is 'git fetch' followed by 'git merge'. If you just do the fetch, you'll not mess up the current branch by mistake... So for your mental map. The remote has a series of changes (a branch). There is also a local pointer to somewhere in that branch. git fetch will pull down the remote changes, but leave the local pointer unaffected. git merge will update the local repo's pointer to a newer rev. Warner From owner-freebsd-current@freebsd.org Mon Jan 25 02:29:25 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6EFE34E3C7E for ; Mon, 25 Jan 2021 02:29:25 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic315-55.consmr.mail.gq1.yahoo.com (sonic315-55.consmr.mail.gq1.yahoo.com [98.137.65.31]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPDMm3Qfdz4vZh for ; Mon, 25 Jan 2021 02:29:24 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611541762; bh=D5pAwS11jGiPkygEPYw3mx6ak3bsiqALUFDJsX5NSDG=; h=From:Subject:Date:To:From:Subject:Reply-To; b=Lgi8leusDKZ3/+cgLIaJrydyOUcSpC7PJYtw+pfOixO+gzgWaO5s97S5G4NIR9cnYSzdsAf5xU5HEIRX5dE7fJRfq3s2mNny4sTANON9GELzTKDgx9qDOI3CcgJOm5TouBn5SWAT5JiE2qERitqHvXwKfNNN8hfaELKMg4nVoXrpO4hc8FDd7B1dQxgVxgff6Nz67UTLoc7iTKj/f9ewhnaAFRBZXyA9gPCd8oSrppwDIVFuanLrajhAkBiArXhUjKKiS5fdRAlJCVjnkHfzw6pNJE2kheO4g77LqzFMVFcTE5micRSKcFSgULnDqbA/OVRPYKMp9cbigar8ieOBGw== X-YMail-OSG: wMMj6skVM1lCV81Dns247DKcGMAnOQLCg0ryOhxQcLVtS8gpWAdSlHyybRwv6tF .Cr2WG6i3fJrmOFpKoHqIChDDLZJDRuL2Nq9jhBpF_KLMLIGqLmZZPjW4bdyDhZ_erSNoMcgj1MG VbI7eTEE5SrIPks2A50d.KJtRsmbx8kphDwoNSdeQXg7rF_rU2PwD25V1jh07sc1oBZOV0o62ENc Gkwd6sFpcoL2ZzjRfcO1094JfyfIZeMrmOIrtbAlQn2XU.HZnhd6O7chGYuIz7S44KoNBYyJNvST REpJnswSmuIDJm0u79.WXNvNJMFfbFcTYYW1Ndsrh8Fb5vquthhQ1Lk9PdF7O.MPFrnRLmQ6t3Zm xsDkefvwPYfvpFnpT0S_brg6dZzrMNc5q.D9lgXkxzd2UN1x2Qq2J7LPcF443zzNTbzauLAT1IPo BMdkZbhUk1oSw2XjE6hEclrW6oBbv.6rxZrLhIkUejdGnuyjZ2Do2g3zBNSasH4u6WeRWd7fGexv H.wh3DrvJrOVy9kOE.iusWVcj5MnWKYLVSOQIiitVf5mLPbmLa.rFphGOnGgb9sa1sy79pl.shlw Q2iU4uCV6rczhQqscGbyz4LBiQdg9qdYYXOXpNSrD2BDA1ZQ.OnLA_kSmaxNHJWFf5ZAZ7vPnG7W I1uRV5EllML8p.b4jPuZZwoOQ8FZQ7i5JhD1PuIQvJ206f41PIEoMiC20CQMxchU2y320vRfkLAq NeZhQ1hoS.qvHEpqRKEvfJqMQQv6_YOBJyIdtlWXygFX36wvghrwiBWHEz1OkZhXEpgFHPjnlrCL 1olhMDabCdKgZ1uNe3v0CNFwWvBlzFCtlAxODIATyo3GVpI9WXoQpzL5Z6gtxA6BuPmSr_LGG.q1 4e5ABzEiFQZprT7uStMBZyILngx6anvZhimW3WRlmpZONV4rIQ3KVgv1FMXKQhgg3K.SYR1lXWxQ kF1_gI4c1VF59bSO78kYtW0i8J3Pu0m.dqmmfkHBkQo_DUWSEDqwKRbiygw_1yG0wWUDfu5wdHrU kG2YfQ.k2rplU8kT7Kh1VSo7M_rKX2aMeZ_K.U_AzC1OWyNE_TU2wFd2g_KlsIZodga8lDw9Ajmi eg8vYu5sN7kK6zps30GPzWGubaNdBcLKNMTwtiIak3MHC.8R3Ws.6zTb03xYLZDY1QOdoehvLN.a CFG3dntu42xvenZk4upFHwzVSBXnPgl8exXNYWwb9o0sVXp2fdwoYoehGiwZYne8HiwBM5nbncfy c6iwM.XGU1FBGkHQmSEDxQldixkK9vKgjambsab4vA9Vdyv0N7vcb48NcvNUOtxU0zZiXSvhlukB 9CbVZMtB3DAs6VwhfW1MSC8DEOdHcWKupd0OAVKmeYvIto6S1cjZpyeNghSSMnGc7QO73e_j7o3B 5Q63NAHS4m16ysYV4AFjco.8u8u.Sl0p05w.DyqnBC5M5M.yvVy438JmiStgXoMc5HpYGbzZH7PM 8CAq_cYl2esc7_RiwaF3yhc9rreTk.1EITmXUXI5GOjO8GFcJmrUpiUw4DCvmd9zEQ29blnUsp6o ONBjXCCLUUeR2VMXramxUlbxQSZ3wYDJ641mY5OovpCB6xY2SvGcL_tKVeyfXH.ju3726YoTrvOo YxLw11K78.Qzx58hyt9O6yP992JeuuM_Mi_Gl7T2lZ4VpsFfQQASpplThY8Hxh4avn2l_BNskypk ili7VcVdl1_FADcV7aGJnZcbVf3sDPsuc0.NBJNdlSE..MXc8eYo9LNfVobO3ekADiWqnZdkUfg3 hCiWsOWaGapJOIR.oJp2qDc..phhtMZYTtntvQpXLvo3alp8UAnsQVjH1ermDN2O9HWSfeVQJpcs KfoBl0ZGe0eV48SznzqsCujVuOyKpYprmWNQrjpBsfZB3raxGXFpEjWZgYMfz56OXnN1PeihRaOS hJhZNp3daocF2lBc.v1EzL3dsCk6Ef2Nsjo49fbaqZxBkk1RITepaFTNWT6ItRRnGRWvYLeZ3.pl RW4i63FUmqtV3pLSrl2tn7d2tO5XYbTxcI3EbLyOeSCUm.9varJCgCKhK6NiBEtUuA7Uz9M023IG EO6bm1usY.CORau9ytFEhvUWHlBAXlfsSxKDN_Rsms4FTPJT7Orlf4lUYle1WGc6Sz6Wfm0Sn9DW lgvg.uUQS3i5NYQsZ_fmWl5BlY1Pzt3.6EOueOvX_2Xd8fh_GWUHekP39.afdAVQMR1H4u5piED. BD_S16Dxh.eU4eqOot8bQrI3T.GZVvMAmz8Vt.IvqW5ITcT6MlWz1WRlnlen6yWrQczsBXOG9zN_ YjcN5WxvU1oSi9UzSAfg6SEn0gURpobsMq8l7ZHKh7SO5JA9K4gLq3BIpL96.g01CT37ZrlX4g19 p2vjqvbGu0KYRekYpMJJhwVtIWpHd2mUDV2R6hyyedpEZ9U8AuWSMXPCTr1bfTofja0H7fCwPTFR _VEkicH0USFiVkelroyV9MHS_SH.Q_p7.VDEOeLrwGWwmeCnccs7CWlOi0xwYpgRYaMZk0tfdh6k _WIaccbDvOfjG9QxQB6fNPwqiQITi4z.IuJbAIUQU0ElE_UZWVVO3HX9MYIG4FES6xwYX Received: from sonic.gate.mail.ne1.yahoo.com by sonic315.consmr.mail.gq1.yahoo.com with HTTP; Mon, 25 Jan 2021 02:29:22 +0000 Received: by smtp424.mail.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 074dba03011990c0347943fda5acbb89; Mon, 25 Jan 2021 02:29:21 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: Getting /usr/src to match specific git hash? (just about out of swap space messages and tuning) Message-Id: <98C83748-FD6A-47D8-96E8-0EED14D7CA22@yahoo.com> Date: Sun, 24 Jan 2021 18:29:19 -0800 To: Steve Kargl , Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: <98C83748-FD6A-47D8-96E8-0EED14D7CA22.ref@yahoo.com> X-Rspamd-Queue-Id: 4DPDMm3Qfdz4vZh X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; ARC_NA(0.00)[]; SUBJECT_HAS_QUESTION(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.65.31:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.65.31:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.65.31:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.65.31:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 02:29:25 -0000 > (4) processes being killed with out-of-swapspace messages > even though I have 4 GB of untouched swap space. Might > be associated with (3). [This is mostly a FYI in case the material is unfamiliar.] Only believe the detailed wording of messages of the form: "was killed: out of swap space" if you also got messages of the form: "swap_pager_getswapspace(...): failed" The other causes that I know of for the "out of swap space" messages are: Sustained low free RAM [via stays-runnable process(es)]. A sufficiently delayed pageout. The swap blk uma zone was exhausted. The swap pctrie uma zone was exhausted. (This is in part because FreeBSD does not swap out runnable processes.) My personal FreeBSD builds have extra code that reports which of the 4 happened but FreeBSD itself does not report such detail. There are tunables for some of the above that make some of those not trip as soon ( /etc/sys.conf content ): # # Delay when persistent low free RAM leads to # Out Of Memory killing of processes. The # delay is a count of kernel-attempts to gain # free RAM (so not time units). vm.pageout_oom_seq=120 (The default is 12 last I knew. 120 allows a 1 GiByte armv7 to -j4 buildworld buildkernel from scratch, relative to what vm.pageout_oom_seq tunes anyway.) # # For plunty of swap/paging space (will not # run out), avoid pageout delays leading to # Out Of Memory killing of processes: vm.pfault_oom_attempts=-1 That last has the alternative structure (replace ???'s with positive integers): # # For possibly insufficient swap/paging space # (might run out), increase the pageout delay # that leads to Out Of Memory killing of # processes: #vm.pfault_oom_attempts= ??? #vm.pfault_oom_wait= ??? # (The multiplication of the two values is the # total but there are other potential tradoffs # in the factors multiplied for the same total.) For reference: # sysctl -d vm.pageout_oom_seq vm.pageout_oom_seq: back-to-back calls to oom detector to start OOM # sysctl -d vm.pfault_oom_wait vm.pfault_oom_wait: Number of seconds to wait for free pages before retrying the page fault handler # sysctl -d vm.pfault_oom_attempts vm.pfault_oom_attempts: Number of page allocation attempts in page fault handler before it triggers OOM handling I hope that helps. === Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Mon Jan 25 03:10:54 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 285F84E5E2B for ; Mon, 25 Jan 2021 03:10:54 +0000 (UTC) (envelope-from mueller6722@twc.com) Received: from p-impout005.msg.pkvw.co.charter.net (p-impout005aa.msg.pkvw.co.charter.net [47.43.26.136]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPFHd08Tzz4yHW for ; Mon, 25 Jan 2021 03:10:52 +0000 (UTC) (envelope-from mueller6722@twc.com) Received: from localhost ([96.28.177.163]) by cmsmtp with ESMTP id 3s5JlrW6WbGHJ3s5Jl6R1l; Mon, 25 Jan 2021 02:58:33 +0000 X-Authority-Analysis: v=2.3 cv=A5oSwJeG c=1 sm=1 tr=0 a=xqrt2BZAGHte7XHhrxJgbA==:117 a=xqrt2BZAGHte7XHhrxJgbA==:17 a=HpEJnUlJZJkA:10 a=Sk8eDgRnAAAA:20 a=ugsGi6pXqSTn3SvWLIQA:9 a=ypZWByBsWtOg-zd7DACx:22 a=pHzHmUro8NiASowvMSCR:22 a=Ew2E2A-JSTLzCXPT_086:22 Date: Mon, 25 Jan 2021 02:57:19 +0000 From: "Thomas Mueller" To: freebsd-current@freebsd.org Reply-To: freebsd-current@freebsd.org Subject: Re: Getting /usr/src to match specific git hash? References: <20210124041403.GB73653@troutmask.apl.washington.edu> X-CMAE-Envelope: MS4wfAP+87Mx9asZmwghgedzTRqiz6E7OXsYduyy/ZseUSMFaP3lvJJYwQyfiZZwi7C0LorIYZBujveFPVvfLufJipwVkiUJgOro9Td65qacthpUYkrQXY2i ZdoLtzyHb92Oum9IsvHI2tpyScFObQUUPgBwRfcEsUByAE39kS1iQBDZ X-Rspamd-Queue-Id: 4DPFHd08Tzz4yHW X-Spamd-Bar: +++++++++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mueller6722@twc.com designates 47.43.26.136 as permitted sender) smtp.mailfrom=mueller6722@twc.com X-Spamd-Result: default: False [11.20 / 15.00]; HAS_REPLYTO(0.00)[freebsd-current@freebsd.org]; FREEMAIL_FROM(0.00)[twc.com]; R_SPF_ALLOW(-0.20)[+ip4:47.43.26.0/24]; TO_DN_NONE(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[96.28.177.163:received]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[47.43.26.136:from]; FREEMAIL_ENVFROM(0.00)[twc.com]; ASN(0.00)[asn:40294, ipnet:47.43.24.0/21, country:US]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_TO_ADDR(5.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_SPAM_SHORT(1.00)[1.000]; MIME_GOOD(-0.10)[text/plain]; R_DKIM_NA(0.00)[]; DMARC_NA(0.00)[twc.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[47.43.26.136:from:127.0.2.255]; SUBJECT_ENDS_QUESTION(1.00)[]; MISSING_MID(2.50)[]; NEURAL_SPAM_LONG(1.00)[1.000]; RCVD_TLS_LAST(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[47.43.26.136:from]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,body]; MAILMAN_DEST(0.00)[freebsd-current] X-Spam: Yes X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 03:10:54 -0000 > It is in the mini primer I wrote, along with how to bisect and other useful > things. This will migrate into the handbook once the doc tree converts to > asciidoc (happening this weekend). > https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md > Warner I looked at your mini-primer webpage, but can't find the answer to my question? How cat one track multiple branches with git without keeping entirely separate trees? I see there is a git worktree command, which can keep two or more branches in much diskspace than keeping the trees entirely separately (as I did with subversion and cvs). In my case, I would want to be able to choose between main and stable-13 when compiling; have given up on releng-12 because of problems with ethernet and wireless drivers. Tom From owner-freebsd-current@freebsd.org Mon Jan 25 03:41:30 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 47C2C4E6B36 for ; Mon, 25 Jan 2021 03:41:30 +0000 (UTC) (envelope-from linimon@lonesome.com) Received: from mail.soaustin.net (mail.soaustin.net [18.222.6.11]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.soaustin.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPFyx4dLtz512b for ; Mon, 25 Jan 2021 03:41:29 +0000 (UTC) (envelope-from linimon@lonesome.com) Received: from lonesome.com (unknown [18.188.142.31]) by mail.soaustin.net (Postfix) with ESMTPSA id E067C170F5; Mon, 25 Jan 2021 03:41:27 +0000 (UTC) Date: Mon, 25 Jan 2021 03:41:26 +0000 From: Mark Linimon To: Yasuhiro Kimura Cc: freebsd-current@freebsd.org Subject: Re: pkg for 14-current Message-ID: <20210125034126.GA20007@lonesome.com> References: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> <20210124.191829.1703374243123280023.yasu@utahime.org> <20210124.194508.2045909391762657611.yasu@utahime.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20210124.194508.2045909391762657611.yasu@utahime.org> User-Agent: Mutt/1.5.21 (2010-09-15) X-Rspamd-Queue-Id: 4DPFyx4dLtz512b X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of linimon@lonesome.com has no SPF policy when checking 18.222.6.11) smtp.mailfrom=linimon@lonesome.com X-Spamd-Result: default: False [-1.73 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEFALL_USER(0.00)[linimon]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[lonesome.com]; RBL_DBL_DONT_QUERY_IPS(0.00)[18.222.6.11:from]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[18.222.6.11:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-0.53)[-0.528]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:16509, ipnet:18.220.0.0/14, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_IN_DNSWL_LOW(-0.10)[18.222.6.11:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 03:41:30 -0000 On Sun, Jan 24, 2021 at 07:45:08PM +0900, Yasuhiro Kimura wrote: > By the way, when -CURRENT was bumped from 12 to 13, there were some > ports that failed to be built on 13-CURRENT simply because they don't > expect there is version 13.x of FreeBSD. And probably such ports fails > to be built on 14-CURRENT with same reason. So it may takes for a > while until offical packages for 14-CURRENT are provided with same > level as 13-CURRENT. Do you remember which they were, please? mcl From owner-freebsd-current@freebsd.org Mon Jan 25 04:12:56 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DF3774E7770 for ; Mon, 25 Jan 2021 04:12:56 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPGgD5vLNz528b for ; Mon, 25 Jan 2021 04:12:56 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from weatherwax.trouble.is (weatherwax.trouble.is [IPv6:2a00:1098:82:3a::1]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "weatherwax.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id AC9F42A13D for ; Mon, 25 Jan 2021 04:12:56 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from rincewind.trouble.is (rincewind.trouble.is [95.216.22.234]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "rincewind.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) by weatherwax.trouble.is (Postfix) with ESMTPS id 4DPGgC66Z4z1xX2 for ; Mon, 25 Jan 2021 04:12:55 +0000 (UTC) Received: by rincewind.trouble.is (Postfix, authenticated sender philip) id 4DPGgB5j4Xz6Fbx; Mon, 25 Jan 2021 04:12:54 +0000 (UTC) From: "Philip Paeps" To: freebsd-current@freebsd.org Subject: Re: Getting /usr/src to match specific git hash? Date: Mon, 25 Jan 2021 12:12:50 +0800 X-Clacks-Overhead: GNU Terry Pratchett X-Mailer: MailMate (1.14r5757) Message-ID: <69AD9428-79DD-49FF-942C-CE38E328B803@freebsd.org> References: <20210124041403.GB73653@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 04:12:56 -0000 On 2021-01-25 10:57:19 (+0800), Thomas Mueller wrote: >> It is in the mini primer I wrote, along with how to bisect and other >> useful >> things. This will migrate into the handbook once the doc tree >> converts to >> asciidoc (happening this weekend). > >> https://github.com/bsdimp/freebsd-git-docs/blob/main/mini-primer.md > > I looked at your mini-primer webpage, but can't find the answer to my > question? > > How cat one track multiple branches with git without keeping entirely > separate trees? Does something like this do what you want: git worktree add ../13-stable remotes/freebsd/stable/13 > I see there is a git worktree command, which can keep two or more > branches in much diskspace than keeping the trees entirely separately > (as I did with subversion and cvs). > > In my case, I would want to be able to choose between main and > stable-13 when compiling; have given up on releng-12 because of > problems with ethernet and wireless drivers. Worktrees should be able to do what you want in this case. Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From owner-freebsd-current@freebsd.org Mon Jan 25 04:25:29 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9E2474E82FA for ; Mon, 25 Jan 2021 04:25:29 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPGxh1Y2Kz52lH for ; Mon, 25 Jan 2021 04:25:27 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id 5ADD74DB47 for ; Mon, 25 Jan 2021 13:25:23 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611548723; bh=/Lpgd+DYkCxyPPmzpa+8AeUWyxShMzkrd2i6b4QEsAQ=; h=Date:To:Subject:From:In-Reply-To:References; b=gxrbNR5nUvuMWeURAknGNgvepoQ4nOyCJelycs4F2kfiEjeaUfAqxygSrr3SkYAt+ PDZFe0MhwluDoSpfPunxy+B+6EvrdBTZRF626oHg5EkTM9p3cn7A0iCIw0IgUfo9Sc WEeYYouIkYXWDiF5vIpH7fBLWB7BJQ9ds/UFKXO9IS8hP0mUCOCiOpiOmSqzXDiT31 S64dR39+vyvzhfMlZYTgbtqfdwqFsU3qOJyWg/bdT7KkcJfSfZ5U1gJX3EuRHAU2X2 U6FshrZRpO12D3RHqD8Q19c9yxLo9GQ6dz3ejokvs6DCdYqfk2XpI9SSYpvfnyc650 p80j6ppnecZIw== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 82F494DB1B; Mon, 25 Jan 2021 13:25:20 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Mon, 25 Jan 2021 13:24:42 +0900 (JST) Message-Id: <20210125.132442.1861859259424554130.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: pkg for 14-current From: Yasuhiro Kimura In-Reply-To: <20210125034126.GA20007@lonesome.com> References: <20210124.191829.1703374243123280023.yasu@utahime.org> <20210124.194508.2045909391762657611.yasu@utahime.org> <20210125034126.GA20007@lonesome.com> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPGxh1Y2Kz52lH X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=gxrbNR5n; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [-0.69 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-0.99)[-0.991]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[utahime.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 04:25:29 -0000 From: Mark Linimon Subject: Re: pkg for 14-current Date: Mon, 25 Jan 2021 03:41:26 +0000 > On Sun, Jan 24, 2021 at 07:45:08PM +0900, Yasuhiro Kimura wrote: >> By the way, when -CURRENT was bumped from 12 to 13, there were some >> ports that failed to be built on 13-CURRENT simply because they don't >> expect there is version 13.x of FreeBSD. And probably such ports fails >> to be built on 14-CURRENT with same reason. So it may takes for a >> while until offical packages for 14-CURRENT are provided with same >> level as 13-CURRENT. > > Do you remember which they were, please? What I can remember are mail/postfix and sysutils/lsof. I've been using them and when -CURRENT was bumped from 12 to 13 they were broken with -CURRENT for a while. And at that time I also saw some other ports were updated with the commit message such as "Fix build with 13-CURRENT" on FreshPorts but I don't remember what they were. --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Mon Jan 25 05:47:06 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 027CE4E9D43 for ; Mon, 25 Jan 2021 05:47:06 +0000 (UTC) (envelope-from kaduk@mit.edu) Received: from outgoing.mit.edu (outgoing-auth-1.mit.edu [18.9.28.11]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPJls17qhz567J for ; Mon, 25 Jan 2021 05:47:04 +0000 (UTC) (envelope-from kaduk@mit.edu) Received: from kduck.mit.edu ([24.16.140.251]) (authenticated bits=56) (User authenticated as kaduk@ATHENA.MIT.EDU) by outgoing.mit.edu (8.14.7/8.12.4) with ESMTP id 10P5kvuu032106 (version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT); Mon, 25 Jan 2021 00:47:03 -0500 Date: Sun, 24 Jan 2021 21:46:56 -0800 From: Benjamin Kaduk To: Rick Macklem Cc: Ronald Klop , "freebsd-current@freebsd.org" Subject: Re: Can In-Kernel TLS (kTLS) work with any OpenSSL Application? Message-ID: <20210125054656.GR21@kduck.mit.edu> References: MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DPJls17qhz567J X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of kaduk@mit.edu designates 18.9.28.11 as permitted sender) smtp.mailfrom=kaduk@mit.edu X-Spamd-Result: default: False [-2.30 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[18.9.28.11:from]; RECEIVED_SPAMHAUS_PBL(0.00)[24.16.140.251:received]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:18.9.28.0/24]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; DMARC_NA(0.00)[mit.edu]; NEURAL_HAM_LONG(-1.00)[-1.000]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[18.9.28.11:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:3, ipnet:18.9.0.0/16, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 05:47:06 -0000 On Sat, Jan 23, 2021 at 03:25:59PM +0000, Rick Macklem wrote: > Ronald Klop wrote: > >On Wed, 20 Jan 2021 21:21:15 +0100, Neel Chauhan wrote: > >But I think for Tor to support KTLS it needs to implement some things > >itself. More information about that could be asked at the maintainer of > >the port (https://www.freshports.org/security/tor/) or upstream at the Tor > >project. > To just make it work, I don't think changes are needed beyond linking to > the correct OpenSSL libraries (assuming it uses OpenSSL, of course). > (There are new library calls an application can use to check to see if > KTLS is enabled for the connection, but if it doesn't care, I don't think > those calls are needed?) > > You do need to run a kernel with "options KERN_TLS" and set > kern.ipc.tls.enable=1 > kern.ipc.mb_use_ext_pgs=1 Note that upstream openssl is expecting to change in what ways ktls is (en/dis)abled by default; see https://github.com/openssl/openssl/issues/13794 -Ben From owner-freebsd-current@freebsd.org Mon Jan 25 07:11:11 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E88F64EC21B; Mon, 25 Jan 2021 07:11:11 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPLcv6Fwfz3CBp; Mon, 25 Jan 2021 07:11:11 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from weatherwax.trouble.is (weatherwax.trouble.is [IPv6:2a00:1098:82:3a::1]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "weatherwax.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id B90D32BF31; Mon, 25 Jan 2021 07:11:11 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from rincewind.trouble.is (rincewind.trouble.is [IPv6:2a01:4f9:2a:1715::1:1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "rincewind.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) by weatherwax.trouble.is (Postfix) with ESMTPS id 4DPLct0D5nz1xcV; Mon, 25 Jan 2021 07:11:10 +0000 (UTC) Received: by rincewind.trouble.is (Postfix, authenticated sender philip) id 4DPLcq6M6Bz6FlV; Mon, 25 Jan 2021 07:11:07 +0000 (UTC) From: "Philip Paeps" To: mj-mailinglist@gmx.de Cc: freebsd-current@freebsd.org, freebsd-questions@freebsd.org Subject: Re: Files in /usr/share/misc Date: Mon, 25 Jan 2021 15:11:03 +0800 X-Clacks-Overhead: GNU Terry Pratchett X-Mailer: MailMate (1.14r5757) Message-ID: <62438B8D-08D3-40D4-829D-B8B23064B0F0@freebsd.org> In-Reply-To: References: MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 07:11:12 -0000 On 2021-01-24 21:35:40 (+0800), mj-mailinglist@gmx.de wrote: > - some FreeBSD project related files, like: > bsd-family-tree.dot, committers-*.dot, organization.dot > These would better be part of the documentation. > BTW, on 12.x they are out of date: > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=251701 I think we've never bothered merging those to older stable branches because there's not really any point. It might be worth doing so just before a release or something but there's very little benefit. > - development(?) related files, like: > pci_vendors, scsi_modes, usb_hid_usages, usbdevs, windrv_stub.c > I don't know if these files are used during build-/runtime E.g. pci_vendors is used by pciconf(8) and windrv_stub.c is used by ndiscvt(8). I'm sure the others are used by similar utilities that escape my memory. > - some files which are used during (build-?/)runtime: > magic, magic.mgc, termcap, termcap.db Shouldn't these be in a more > specific place? They are pretty static, so the "var" part in /var/db > does not fit, > but services.db is located there, too. The magic* files are used by file(1). See termcap(5) for the others. > - is the fonts folder in base, or did some port create it? I'm not > sure. Hah. I like the comment in hier(7) about this directory. :-) Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From owner-freebsd-current@freebsd.org Mon Jan 25 07:37:40 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id CD2B54ED02A for ; Mon, 25 Jan 2021 07:37:40 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic303-23.consmr.mail.gq1.yahoo.com (sonic303-23.consmr.mail.gq1.yahoo.com [98.137.64.204]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPMCR6Gcgz3FjV for ; Mon, 25 Jan 2021 07:37:39 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611560257; bh=E12tTiG3kA8ytYhEqPJwHGFEWMzUUfpcpYZHmDGmlAX=; h=From:Subject:Date:To:From:Subject:Reply-To; b=Sr5eMr4CNoxKYqmS9midE7Ktu3Gdw56J9APz7dnkEQzjjO2X3yCMMDkatJnJTuWHioDuwmJXIXLEwjCCTrJrVKC6ZsDbp4M4Wnz8761C1dLm2gM0X02XCgSPXsge6gOB2Y6Cc/IxsjrE6US+KjcNMGjx4ue2itBRd446/XVMazhP6DGNY5cXYo8ooUzRjN20/oH906mjQ5bE7TChaBgwX3PlZWJOxhKs5cC/8s8APzVO3KgJnWD2ph1qkilgGOAS7d1HZrTZXZ+h4ApCS6UHZiuR/Nrmk8G+7X6iR3r7pWqyseDXZL5QRNU3zkpO08vGj4DoP0NOt7JUoXY+c6SkQg== X-YMail-OSG: GTxzPCgVM1lJb4KK4B7RAAhXaupByyV7zTyPHVvD0gW.hTobPi5xdK7HnrunnvO tzX4V4UFextyZ6ilIdmUYf8QBuxsbOsXM7cShkYCAl1edjYme.YbMeRLjr9ODQdbCksIBSMK3Jyo 9PlFEJ25efIlkXavA79ej.a5izzdbKxoyLzv6kLS1HLLWsho0NMlfQHcED.XmyOBGvsYmgKuKRe1 ..Yv6iNQGiYvnpspE0mEGiK7cwYbBV9DAqEqxvYWRrkXAip2lzUxjArec5xvaJdmsIzx8wxhMA_z pxya865x8SrziYHdVOxbDAl6mNldERlt20eGSkPWiYmChdn_Bnij5c9mpF5thBL4O3qeCY_TxZU1 MoqsYfEmTngpbDV6GHYcOdeN9qhjjHGAmzuRhpY6xF.b_MgzPvURKgjxRuwmNs4w6QFwb1hAYg.J OwCA5pb1axvCCpofM8.Dc2pe7WUA3LI3FwyZMCvsSZK9mCgp8HI9PJWEgG7.lToPUzMaap2CMQ6i t1CBzKe50T_W_rulbw2lSJ0OpfZIlbovDzJ1aKdYUV1_rY7bMx.aS6X6FdX52zwZukviE3Gdczad rLF03RCK0A130nNYl1pSOQAnu4p66veiuAm5prwsJga4.3298wJawx54XGEmaF3_3JArAFYB8mrr m8EaTW23UhHkUd3wWfRAnvPGMIOnJ.gUCUD_F3XLXzYLZFViqnuB8SFFqQMZrXYRSeLird01NujI nXsFkp5L9J_jC2pHBFWmIzmezz.gsa0YOdn1.cxYsPPLeByNin2vo.Hi8uT4141sOQw63Skseay6 8qEgns9_5Nh2rS.q_p3c8.PE3OsERmK4im8tY2bl8QAiujFv6Kj2k.Fa58VcvdCBZGdxOkT5XeX_ jyQJJTotEhP1ALcLi55kcF2Nrdig1XiYcWcU8eMtbyH5d_x6MB4bU8JwQSRoySb8tLuL52wu8iwA dwCKozKaQCboDIHo0wnNr_D1bMTD7rUmFi1x5v6sEgS44e1PEv5cUpdDzTfbchiyq5swJgcfqQKY uoPTj6QiHJR5FrjgZoamgjPkMhdzq5vje0CBhjiLbPMjVW7ksfYbmlVtkwP6vVO0bYN7dhhCHzJY LF1OtWdPlIpgiLwA6dEkcH9xsYAxq6.npQSjfrmrmx0YtjRMYcWhu3IdjCJVfrEA86pSEZljbwBh snTSnla6KnBKvvcsP76TskannbMxwB4LT7LwPalsfY.igIYQc2AsHQJXke_z20pWlZhEcv.XKZi. ApyXPQiI9UOo6kMmb57mfSCuqlRqEEUVx8KAOD3YPb2eIJiXaJExs5kuf3DM3l7Qd7c9mryFNam0 I1RhOnwmLN.EpZf4ZA7YUGn7qabwII7CBSq0CNFkEpH.MwxoVv6cEy5kpRzidBaHRaV4G8KpcoP1 zbNg4aFNOhJ0f2Qi4jJ6dymvgz.Ygpy.1WXCG45CXCcmzKzCYTJsZxFvZnQZy4lrw3M.TXjC2ewr 1WFbLP7cblOgAIyATlTozVr3HMwxeHG27RssszVY_tXn0Zs1_Y.K3a9hZqGU6ogFrJMEagNecnaE ElyVkCfdObo.Fzr7bspRryt8qRW37.wT0eMQYjDABm5j0NefEUDjdUqeeLUF0Ps2CydRs.9ALYZg tGWplvP6RuhlhG4UE3jrKM1m4a_A_GxwU4ocoyOHvkQukTYUwKLd21yvYnfhsLvLKAhK3x1Xe5vl MG.qs61IjLypuA2Wx75heLdYwj3VqnBOtPBEPxArP5y4YN0zcp9EpTMb7KXqlxTBa8RRdQc81QKq E9kfYJ0JTXZe7aqJXV94LDJ1Nn8ol.w.UKvW1.JFSp6xQEDkJHYWQbLNbP08M6pYEkl3If05XLL5 XpqZM87TtmzaOe5lf_uTPyyr5of7HjkUuf2s1c099aJ6Ho971lXqBrUhrRdTeBLugbGbFt0eC4Kz lK00Vr3RUoO_cuh0f.iS8yd.94EHyoWoy8wyrWLeeTZOV8YBJUUI0MQgvU1BWbgqGwRzbcnxqfRT .LBOUnIA7Slh5AhDVs09x13BN2Omz_yL.XfAHJu3o6X4z52hu6PNP7W.Xa_uO_I.MhtHaL4nofm_ 40EbOQJ2p953X397SkNP5vzDz.xU6XvMCl8sN.ed4g9m0PcHnsac7_.aZBXu_pamTbf.DMAGHOmm VF7NCWk6CAG39fAEWHlRY7nJ66fJklhlvyHOVuK3FWOxXU_UmzJYNKJ4gTX2kkWbM7l4ieOnaPx0 AdC8ndun.m9wuszTIvkquEoFjQIqKwhCoNyovKPlj8p01ojpMajThYfrOO_TmfK2bKFfwNKCy.df brcn8WO459evic.NwH.BQktLI5LFFknnJMZl6dtl9sFfgi6zA9N2YA.DAljWRkDA2Sf3ptSvqN1z luouThAWtzycIJEBsQx5IpRqoyyVfQ29R.pdM5DtAJTTYD4.P55q3Ts31UaVqHt21Fd00_hse7Wa S.ez9oIwCvwItCR6VVglPfsh3YzZUMH4Em4Xv2YUTAYnrtLDV0w5AvSNPKWa3 Received: from sonic.gate.mail.ne1.yahoo.com by sonic303.consmr.mail.gq1.yahoo.com with HTTP; Mon, 25 Jan 2021 07:37:37 +0000 Received: by smtp410.mail.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 5ee7b817180d0dbb5d0df5f7a28cb693; Mon, 25 Jan 2021 07:37:36 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: Getting /usr/src to match specific git hash? Message-Id: <14BEA6ED-564D-46AD-857D-F9117D60F76E@yahoo.com> Date: Sun, 24 Jan 2021 23:37:35 -0800 To: mueller6722@twc.com, Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: <14BEA6ED-564D-46AD-857D-F9117D60F76E.ref@yahoo.com> X-Rspamd-Queue-Id: 4DPMCR6Gcgz3FjV X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.28 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; FREEMAIL_FROM(0.00)[yahoo.com]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-0.78)[-0.775]; FREEMAIL_TO(0.00)[twc.com,freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.204:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.64.204:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.204:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.204:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 07:37:40 -0000 > How cat one track multiple branches with git without keeping entirely=20= > separate trees? There are multiple possibilities here and it is not clear which you are hoping for. A) You could be trying to avoid having two separate .git copies around, each also with checked-out material. (2 separate deep clones.) B) You could be trying to avoid having 1 .git with two directories trees for checkouts. (One deep clone with an added worktree, for example.) C) You could be trying to have one .git copy and only one directory tree with only one checkout at a time. (In some contexts, this sort of thing might involve considerable time and I/O for switching the content of the directory tree to be the checkout of a different branch. main vs. stable/13 now vs. 3 years from now might be different.) (One deep clone and no additional worktrees.) D) Sort of like (A) but using 2 Shallow Clones, one per branch. (This uses somewhat more space than (C), but not a lot more.) (2 separate shallow clones in separate directories, one for each branch.) My guess from your wording is that you are after (C). I presume no local modifications/patches and do not cover how to handle having such. The command sequences shown would destroy local changes. It is not clear if such matches what you are after or not. I presume below /usr/src/ use for where the clone was put. It also presumes the fetch status is recent enough to contain the commit that you want to use. For building main : # cd /usr/src # git switch --discard-changes main # git fetch freebsd # if advancing # git merge --ff-only freebsd/main # if advancing # . . . vs. for building stable/13 : # cd /usr/src # git switch --discard-changes stable/13 # git fetch freebsd # if advancing # git merge --ff-only freebsd/stable/13 # if advancing # . . . In the above the commit is implicit as the HEAD for the branch named. There is also being more explicit about the commit that you want (branch implicit): # cd /usr/src # git fetch freebsd # if advancing # git reset --hard 08b8197a74 # use appropriate hashid # . . . This "reset --hard" command produces a "detached HEAD" notice that you can either ignore --or you can then create a local branch that uses that HEAD: # git checkout -b NEW_BRANCH_NAME For reference, from my context: # du -sAm /usr/fbsd/main-src/ /usr/fbsd/main-src/.git 2487 /usr/fbsd/main-src/ 1379 /usr/fbsd/main-src/.git So 2487 would estimate (C) as things are now for main or stable/13 . 2487-1379=3D=3D1108 for the implicit, primary worktree that goes with the clone. A additional worktree tied to the above: # du -sAm /usr/fbsd/mm-src/ 1108 /usr/fbsd/mm-src/ So 2487+1108 =3D=3D 3595 total using the additional worktree, i.e., (B). Just for reference for how much space (D) takes: # git clone -o freebsd --depth 1 -b main https://git.freebsd.org/src.git = /usr/fbsd/main-shallow Cloning into '/usr/fbsd/main-shallow'... remote: Enumerating objects: 88695, done. remote: Counting objects: 100% (88695/88695), done. remote: Compressing objects: 100% (76042/76042), done. remote: Total 88695 (delta 18867), reused 51008 (delta 9483), = pack-reused 0 Receiving objects: 100% (88695/88695), 258.57 MiB | 9.14 MiB/s, done. Resolving deltas: 100% (18867/18867), done. Updating files: 100% (85161/85161), done. # du -sAm /usr/fbsd/main-shallow/ /usr/fbsd/main-shallow/.git 1378 /usr/fbsd/main-shallow/ 271 /usr/fbsd/main-shallow/.git (The .git is branch specific only.) So about 2*1378 =3D=3D 2756 total to also have a separate one for stable/13 in, say, /usr/fbsd/stable-13-shallow/ . =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Mon Jan 25 07:46:44 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3692D4ED617 for ; Mon, 25 Jan 2021 07:46:44 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic310-20.consmr.mail.gq1.yahoo.com (sonic310-20.consmr.mail.gq1.yahoo.com [98.137.69.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPMPv2JBpz3G4v for ; Mon, 25 Jan 2021 07:46:42 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611560801; bh=h1QUC/wzR1lA4Jt59F+HnD5OLKIKkVKvOS+WQhqNLyq=; h=From:Subject:Date:To:From:Subject:Reply-To; b=YGa+d0SCldspV/ywaXfVilHyWpybey6w85czi/7YWN5eParoFjpwuuNCaENouLdzTPyaEGzd3HlJI8AGe+rlkIImk/kaIk2MPyb2wtdP9NuifF8LFX4gO49TS2bpC+uSIrIAScZ2iwtGzsALkCbDx6/GiFv2v4ZFn7mm5+YAebxpQdnd6B5mWo9ERsjt9tHoiEIgBbq7cDfd0LTsAS9RLsl09ymBAmvcztjOWAT7qMsAh5q2e2bGlHFdEyrYxhYTdXv+VnR+dMeSX1A0C0Fwuf4YzHyCZRGCi7GSUumlUei4eYnYnE4q+tHj1EOwJK5ZGmu04dIWjUxus/A45l3azw== X-YMail-OSG: wiEwi9MVM1lGZbsqFdV1VvqOUQ201cMCsyeig1TJjkdNKakN8.P0Rb04uGhmr.y efLSOBRqCfcSstBarXl6PXJDCdpJh7o5cX3uMSooUFv9jMi_Djud.So6I4S4.vgwHTHPjmDP_JgH Kyf7IcAw5WZakUnnI_gE.AQYNlW56vxJn_fwOH_Po7Jn14shsBq1drx45fsAIUUzTDolcWAqX.jS K.UyykFTQvk2pTk1P9svCMZRj6Lqxk8zOQAmh_j145gFxb7Q.Jv5LfJkNl3EZjUrZHhODrH2tdZs _t_njLr79vk7I3wb_YDCYA_A29P036.ldrAw_R2kTnBVX_V7AJh7BnY3ULNhll8aCMnxRTbr46lD 1LOWfTUCF1Ek1AAJ8lOFPyJGgw6z00KbuudQd9t4i9E0V9bZCVMAoIhh8xTZNah9Ww9Y_x.3iaaa Fdb_V9MRCz9Mcvtag9EzFMG9SOXlgXfl0g117WbCvMrYdkB9lwwagR2nP04_qE4EPuOkMrdGwJEP ReHi1yyBXkBZ9vW17YdnKrrdlrZeEwSPS.Lxr6roj7AEHqu61IEu9nE8e9qesyqHmr.Y1qe29nfn zfYEdB6uLtogekuwB6qu1S3NbiTN.vaCieTqOIRY56rrtOcMCkNk2FAr_ZuZccMuhzZ.cui333f. zeE_WLv.CpbnIPRBEjMzpGAS1ez8BoZ2qQTjr9ahIEQ8xUGW.R8Gie8jS2a8FXjFlN7h7U4fZ0ck P2AOUPWtmBEmVT0afyq_CJJC.WjZf26CmqyIMNq_sbJ6PF.khN98Mz8kob_87lXU76oVBfvmsVva 0WqnmMFmtu5immcaFt6EJ11GYdLKvCoZrTYNVjUPjSS4.tgXAzyn8jmOdH6XlDYAibRs.Z63uSUU pDyNw.Kh1fxTfh7RltgG7c1EVJPdWTsEE7wGSiH.KPA5lszw67UiRrL87Y7kQ6Kel8Kjnn4C456R 6xbdIQMZShprCI8UbeQE3oVEeTWjyPAT7IJ7_Mg0Z8zLl3fFm7eXv9qjlHGVS1lFIx.KwcLeZ4lG bZERej7D7UxLanKp4OtYADOs60ElCYfbul7zd04DhmGeVD3jJ4VNcU2KPVZrXp.RqoY82zCU7sxd EbxsNVVRltLLbIaWj6nR2dtBvYhcx10qcrtJ9Lb7ppKGgZArFSnSIAcB2PeCjpMO.Gw5Ikwr8CA_ VGcxplNQPecR6rz_VNeXC0qOX6IQAs1MfeLngyVUZmV8YUDmcMuoZD5dWri0mq9wFmjkyrKZmAig T62aC7.2T.KxPr8IokT_eGbAdx5ryQYIPXVDEmpqjgqIidB7NBZ.phDlHrB14S7MmqsVr830ahss EskOEQHhqg_dXbGChRTU4a5ogdOmQOso4QmngulbcQOwtOLlClx6VALNrLCHK_bRVhCOSwfz2qS6 o2_is2g7xaqYa9fONOkLneRaQzRpkCVv42C9K52fs0j4hG2f_CmZL0nCemkBLpULD9wFN7iWMHui NikGLyBKly.E_iU9D5Z.pYxPa4ygV0xStmyf5xgQO3DUU0Bj0UNvjL48OShShA_yWwfkWttvoKuq yeojTsKYOTot4xap8OBS0roz3b5mj9IejO2nuoMUnCnROQriOTlEkNx_Rl2Ejpmw0mbsQIkCFW0H LYeXDdwoGh0323dHv5uXBXIHqY0CxOz7ZM4IIyXtdb8XdG73C2TrDEJMJPCzvJJH_X1.uM1rIPgZ 7i2lFy6nnBnRujm1VKXzaL1WyomzkojoVRNoytPt4R1eUCwKlMTWhf1l5FC79uv6fso11.KNoUab HChHp8PX9yqDHZSSkRwTcU2RhJtw0bwdYur28dBPq05RO8mSZMuZuAVsEOJEiJOP5hrX4PMoTdn4 7Ay2pc0zOss4uQ2bTb1NpwGjQRIrItp.A9cH8co1yIh5OUv7WmMJ4NJJpnsE.j22aQ7xIlrERdk8 pq.NU6ocZ4aKgcM9.tz1Iioxg5rvMKxcXeXjTq0sjJIFTzY5WKIbTfqVv8x.kr7bh0eosvIrsuY. 5vxjdbroOrkaxY0EwxLiQAt5rypJ9bJr1jREG3tm4UtDAt2fneIfg6du3gNP7oGG4QgTM3uZx_IB vrM9qgcxOOjX5oppq.rc__G1KJdmwDYLprhUoDzpYDWuEq_MTftZ.A2zyNJdTWTDeNJ3FRFRU417 L3EF.HWEEkK6afgyLVQS4i7ZGJUJTBQx1qli7V3Vls29AOQbuA63LPdpkecyY_Mf8hNXm7KcAnB4 4OY6UVb7RqdIn.vbHBSveY55b9UsAgiCXHWGFR8SShQiBAdPFyboOSoDo1qOHF2GzWIseQxr6hQ1 Sso1ZedGx56MA6FKYMdLGKfVnT8IBPmOtHo.4V.54Jlkis9G0o_RTjwGmHQrJnBJHo79oXNLajNR tnwrdan9qldGMuItJOWD_r4o.fHbjGtW9lU2C3d9La30m3QvTREi36H52GE_GsmIo_SvylBV.KcX 6LVX54GjOZo_UyHSw_arUzDFOTpBgqmqCe8QdwVJYTw0gyeq4i3rXu_gGig-- Received: from sonic.gate.mail.ne1.yahoo.com by sonic310.consmr.mail.gq1.yahoo.com with HTTP; Mon, 25 Jan 2021 07:46:41 +0000 Received: by smtp411.mail.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 48db3be930bc5880ebe83f3c50981942; Mon, 25 Jan 2021 07:46:40 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: Getting /usr/src to match specific git hash? Date: Sun, 24 Jan 2021 23:46:38 -0800 References: <14BEA6ED-564D-46AD-857D-F9117D60F76E.ref@yahoo.com> <14BEA6ED-564D-46AD-857D-F9117D60F76E@yahoo.com> To: mueller6722@twc.com, Current FreeBSD In-Reply-To: <14BEA6ED-564D-46AD-857D-F9117D60F76E@yahoo.com> Message-Id: X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Rspamd-Queue-Id: 4DPMPv2JBpz3G4v X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.28 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-0.78)[-0.778]; FREEMAIL_TO(0.00)[twc.com,freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.69.146:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.69.146:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.69.146:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.69.146:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 07:46:44 -0000 On 2021-Jan-24, at 23:37, Mark Millard wrote: >=20 >> How cat one track multiple branches with git without keeping entirely=20= >> separate trees? >=20 > There are multiple possibilities here and it is not > clear which you are hoping for. >=20 > A) You could be trying to avoid having two separate .git > copies around, each also with checked-out material. >=20 > (2 separate deep clones.) >=20 > B) You could be trying to avoid having 1 .git with > two directories trees for checkouts. >=20 > (One deep clone with an added worktree, for example.) >=20 > C) You could be trying to have one .git copy and only > one directory tree with only one checkout at a time. > (In some contexts, this sort of thing might involve > considerable time and I/O for switching the content > of the directory tree to be the checkout of a > different branch. main vs. stable/13 now vs. > 3 years from now might be different.) >=20 > (One deep clone and no additional worktrees.) >=20 > D) Sort of like (A) but using 2 Shallow Clones, one per > branch. (This uses somewhat more space than (C), > but not a lot more.) >=20 > (2 separate shallow clones in separate directories, > one for each branch.) >=20 > My guess from your wording is that you are after (C). >=20 > I presume no local modifications/patches and do not > cover how to handle having such. The command sequences > shown would destroy local changes. It is not clear if > such matches what you are after or not. >=20 > I presume below /usr/src/ use for where the clone was > put. It also presumes the fetch status is recent enough > to contain the commit that you want to use. >=20 > For building main : >=20 > # cd /usr/src > # git switch --discard-changes main > # git fetch freebsd # if advancing > # git merge --ff-only freebsd/main # if advancing > # . . . >=20 > vs. for building stable/13 : >=20 > # cd /usr/src > # git switch --discard-changes stable/13 > # git fetch freebsd # if advancing > # git merge --ff-only freebsd/stable/13 # if advancing > # . . . >=20 > In the above the commit is implicit as the > HEAD for the branch named. >=20 > There is also being more explicit about the > commit that you want (branch implicit): >=20 > # cd /usr/src > # git fetch freebsd # if advancing > # git reset --hard 08b8197a74 # use appropriate hashid > # . . . On review, I forgot that git reset --hard can create untracked files and such. So I add a git clean -f -d to the sequence: # cd /usr/src # git fetch freebsd # if advancing # git reset --hard 08b8197a74 # use appropriate hashid # git clean -f -d # . . . > This "reset --hard" command produces a "detached HEAD" > notice that you can either ignore --or you can then > create a local branch that uses that HEAD: >=20 > # git checkout -b NEW_BRANCH_NAME >=20 >=20 > For reference, from my context: >=20 > # du -sAm /usr/fbsd/main-src/ /usr/fbsd/main-src/.git > 2487 /usr/fbsd/main-src/ > 1379 /usr/fbsd/main-src/.git >=20 > So 2487 would estimate (C) as things > are now for main or stable/13 . >=20 > 2487-1379=3D=3D1108 for the implicit, primary > worktree that goes with the clone. >=20 > A additional worktree tied to the above: >=20 > # du -sAm /usr/fbsd/mm-src/ > 1108 /usr/fbsd/mm-src/ >=20 > So 2487+1108 =3D=3D 3595 total using the additional > worktree, i.e., (B). >=20 > Just for reference for how much space (D) takes: >=20 > # git clone -o freebsd --depth 1 -b main = https://git.freebsd.org/src.git /usr/fbsd/main-shallow > Cloning into '/usr/fbsd/main-shallow'... > remote: Enumerating objects: 88695, done. > remote: Counting objects: 100% (88695/88695), done. > remote: Compressing objects: 100% (76042/76042), done. > remote: Total 88695 (delta 18867), reused 51008 (delta 9483), = pack-reused 0 > Receiving objects: 100% (88695/88695), 258.57 MiB | 9.14 MiB/s, done. > Resolving deltas: 100% (18867/18867), done. > Updating files: 100% (85161/85161), done. >=20 > # du -sAm /usr/fbsd/main-shallow/ /usr/fbsd/main-shallow/.git > 1378 /usr/fbsd/main-shallow/ > 271 /usr/fbsd/main-shallow/.git >=20 > (The .git is branch specific only.) >=20 > So about 2*1378 =3D=3D 2756 total to also have a separate one for > stable/13 in, say, /usr/fbsd/stable-13-shallow/ . =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Mon Jan 25 09:16:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2C19B4EFFB8 for ; Mon, 25 Jan 2021 09:16:23 +0000 (UTC) (envelope-from sergey.dyatko@gmail.com) Received: from mail-ed1-x533.google.com (mail-ed1-x533.google.com [IPv6:2a00:1450:4864:20::533]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPPPL22knz3MXl for ; Mon, 25 Jan 2021 09:16:22 +0000 (UTC) (envelope-from sergey.dyatko@gmail.com) Received: by mail-ed1-x533.google.com with SMTP id c2so14031995edr.11 for ; Mon, 25 Jan 2021 01:16:22 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=JnY4YPHuZkVtYB0VutPyec1EVh23dWAMctOBNdm37wA=; b=eFjZVxnuxh0yMgVftgNXpccfZWgbr+81cxCeIHFtV9u+MQSErXkIF6sOZlk/tSM0NA 84ap0okcoKdwCqBq9i7XjiNHeY6a4FEhfEF8zosZwA5UQgf31f9ylYhSAF1jT/PguVVB qR+NNAMxUJEqS6FU7O5pq+oZfN6iwaYPz/vmKyRlEAhs1r3rKaxw3M+nDWqMLhWg5FU+ DHAlzdFqZAG6l6VDxE+WACnwyrIDiUtDfK0/GwXBdxWVUnqRUt32Z+VYFl7N736q00Fo pG4vy/8EFXhMYmXE7xseCU0IRu25awpno3jjew9Q3kzp3enrSW29BOZCSwy82/qMw/xD bxxg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=JnY4YPHuZkVtYB0VutPyec1EVh23dWAMctOBNdm37wA=; b=L0be1QuHHQ8o/VoEkPF3SngfkgengTHMpcGctlGlI44yXJYRIRs8lIxQxD0bS9EzZ5 TqICugYPYdgbtBRdeR7Q4gWCr/hAzSEU7dDg882bZEelB2D38tP/fizuZstKfT6HEZPi cjSupVmyNFhdlNe/hSosolflYOMHnfagtx/xU92AiOsBIxmRlu++58Xhelcn3e4QsFXX jut803+I9nbMpftXaUHSJK1DXKVVmmCsyyy6JDvO4hSmPxxFa/6BhTODjoJ9Lq4i1A8L SojO1WvIaMXCxfzIrCtfnZAlRDD+RqyyOyncqPAIbrKn5VDhb1cHZCBLWbBDN6n1MvOq KkSg== X-Gm-Message-State: AOAM532MNYJczKtBXwkH4QenVUn0BOEfZ+AL80orAO/G3I5HGj8Q5pT2 gOrygvTnm+ihBGoGyiLvE/5QDqbHX0g= X-Google-Smtp-Source: ABdhPJyYreS//jRwr3p4NnZhBS74hOMRT9g0GqO4dlonpJoJCys1WUnvWoNpG5+EhUAK3Strj6gRtw== X-Received: by 2002:aa7:c4c9:: with SMTP id p9mr2659088edr.234.1611566180094; Mon, 25 Jan 2021 01:16:20 -0800 (PST) Received: from laptop.domain ([86.57.155.118]) by smtp.gmail.com with ESMTPSA id y9sm2228824edi.74.2021.01.25.01.16.19 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Mon, 25 Jan 2021 01:16:19 -0800 (PST) Date: Mon, 25 Jan 2021 12:16:47 +0300 From: "Sergey V. Dyatko" To: Subject: 13.0-CURRENT r368448 panic Message-ID: <20210125121647.44857e81@laptop.domain> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPPPL22knz3MXl X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=eFjZVxnu; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sergeydyatko@gmail.com designates 2a00:1450:4864:20::533 as permitted sender) smtp.mailfrom=sergeydyatko@gmail.com X-Spamd-Result: default: False [-3.97 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.97)[-0.973]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::533:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::533:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::533:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 09:16:23 -0000 Hi, Some time ago I was writting about this kernel panic. But due to the fact that there was very little information I haven't receive any reply (I hope that is was a reason). Luckily I have a host with a single interface (w/o lagg) and I was able to set up netdump. I observe this panic on all servers running this revision. More information: GNU gdb (GDB) 9.2 [GDB v9.2 for FreeBSD] Copyright (C) 2020 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Type "show copying" and "show warranty" for details. This GDB was configured as "x86_64-portbld-freebsd13.0". Type "show configuration" for configuration details. For bug reporting instructions, please see: . Find the GDB manual and other documentation resources online at: . For help, type "help". Type "apropos word" to search for commands related to "word"... Reading symbols from ./kernel.debug... Unread portion of the kernel message buffer: Fatal trap 12: page fault while in kernel mode cpuid = 2; apic id = 04 fault virtual address = 0x18 fault code = supervisor read data, page not present instruction pointer = 0x20:0xffffffff80c8b3c8 stack pointer = 0x28:0xfffffe019b3302e0 frame pointer = 0x28:0xfffffe019b330350 code segment = base 0x0, limit 0xfffff, type 0x1b = DPL 0, pres 1, long 1, def32 0, gran 1 processor eflags = interrupt enabled, resume, IOPL = 0 current process = 0 (if_io_tqg_2) trap number = 12 panic: page fault cpuid = 2 time = 1611366676 KDB: stack backtrace: db_trace_self_wrapper() at db_trace_self_wrapper+0x2b/frame 0xfffffe019b32ff90 vpanic() at vpanic+0x181/frame 0xfffffe019b32ffe0 panic() at panic+0x43/frame 0xfffffe019b330040 trap_fatal() at trap_fatal+0x387/frame 0xfffffe019b3300a0 trap_pfault() at trap_pfault+0x4f/frame 0xfffffe019b330100 trap() at trap+0x27d/frame 0xfffffe019b330210 calltrap() at calltrap+0x8/frame 0xfffffe019b330210 --- trap 0xc, rip = 0xffffffff80c8b3c8, rsp = 0xfffffe019b3302e0, rbp = 0xfffffe019b330350 --- m_copydata() at m_copydata+0x58/frame 0xfffffe019b330350 tcp_output() at tcp_output+0x100b/frame 0xfffffe019b3304f0 tcp_do_segment() at tcp_do_segment+0x2867/frame 0xfffffe019b3305e0 tcp_input() at tcp_input+0xabe/frame 0xfffffe019b330710 ip_input() at ip_input+0x125/frame 0xfffffe019b3307a0 netisr_dispatch_src() at netisr_dispatch_src+0xca/frame 0xfffffe019b3307f0 ether_demux() at ether_demux+0x138/frame 0xfffffe019b330820 ether_nh_input() at ether_nh_input+0x351/frame 0xfffffe019b330880 netisr_dispatch_src() at netisr_dispatch_src+0xca/frame 0xfffffe019b3308d0 ether_input() at ether_input+0x69/frame 0xfffffe019b330930 tcp_flush_out_le() at tcp_flush_out_le+0x221/frame 0xfffffe019b330950 tcp_lro_flush() at tcp_lro_flush+0x2b2/frame 0xfffffe019b330980 tcp_lro_flush_all() at tcp_lro_flush_all+0x13b/frame 0xfffffe019b3309c0 iflib_rxeof() at iflib_rxeof+0xc7a/frame 0xfffffe019b330ac0 _task_fn_rx() at _task_fn_rx+0x72/frame 0xfffffe019b330b00 gtaskqueue_run_locked() at gtaskqueue_run_locked+0x15d/frame 0xfffffe019b330b80 gtaskqueue_thread_loop() at gtaskqueue_thread_loop+0xac/frame 0xfffffe019b330bb0 fork_exit() at fork_exit+0x7e/frame 0xfffffe019b330bf0 fork_trampoline() at fork_trampoline+0xe/frame 0xfffffe019b330bf0 --- trap 0, rip = 0, rsp = 0, rbp = 0 --- Uptime: 2d11h32m6s debugnet: overwriting mbuf zone pointers debugnet_connect: searching for gateway MAC... netdumping to 212.8.xx.yy (48:5b:39:09:5b:8e) Dumping 9708 out of 130919 MB:..1%..11%..21%..31%..41%..51%..61%..71%..81%..91% __curthread () at /usr/src/sys/amd64/include/pcpu_aux.h:55 55 __asm("movq %%gs:%P1,%0" : "=r" (td) : "n" (offsetof(struct pcpu, (kgdb) bt #0 __curthread () at /usr/src/sys/amd64/include/pcpu_aux.h:55 #1 doadump (textdump=1) at /usr/src/sys/kern/kern_shutdown.c:399 #2 0xffffffff80bf87bb in kern_reboot (howto=260) at /usr/src/sys/kern/kern_shutdown.c:486 #3 0xffffffff80bf8c40 in vpanic (fmt=, ap=) at /usr/src/sys/kern/kern_shutdown.c:919 #4 0xffffffff80bf8a43 in panic (fmt=) at /usr/src/sys/kern/kern_shutdown.c:843 #5 0xffffffff8102cf17 in trap_fatal (frame=0xfffffe019b330220, eva=24) at /usr/src/sys/amd64/amd64/trap.c:915 #6 0xffffffff8102cf6f in trap_pfault (frame=0xfffffe019b330220, usermode=, signo=, ucode=) at /usr/src/sys/amd64/amd64/trap.c:732 #7 0xffffffff8102c5cd in trap (frame=0xfffffe019b330220) at /usr/src/sys/amd64/amd64/trap.c:398 #8 #9 m_copydata (m=0x0, off=0, len=1, cp=) at /usr/src/sys/kern/uipc_mbuf.c:656 #10 0xffffffff80db9fab in tcp_output (tp=0xfffffe05449d48f0) at /usr/src/sys/netinet/tcp_output.c:1065 #11 0xffffffff80db1fd7 in tcp_do_segment (m=0xfffff802150f8100, th=, so=, tp=0xfffffe05449d48f0, drop_hdrlen=64, tlen=, iptos=0 '\000') at /usr/src/sys/netinet/tcp_input.c:2786 #12 0xffffffff80dae9ae in tcp_input (mp=, offp=, proto=) at /usr/src/sys/netinet/tcp_input.c:1381 #13 0xffffffff80da1555 in ip_input (m=0x0) at /usr/src/sys/netinet/ip_input.c:833 #14 0xffffffff80d2f12a in netisr_dispatch_src (proto=1, source=, m=0xfffff8023060499c) at /usr/src/sys/net/netisr.c:1143 #15 0xffffffff80d138e8 in ether_demux (ifp=0xfffff8010247f800, m=0x0) at /usr/src/sys/net/if_ethersubr.c:923 #16 0xffffffff80d14c81 in ether_input_internal (ifp=0xfffff8010247f800, m=0x0) at /usr/src/sys/net/if_ethersubr.c:709 #17 ether_nh_input (m=) at /usr/src/sys/net/if_ethersubr.c:739 #18 0xffffffff80d2f12a in netisr_dispatch_src (proto=5, source=, m=0xfffff8023060499c) at /usr/src/sys/net/netisr.c:1143 #19 0xffffffff80d13d39 in ether_input (ifp=, m=0xfffff802150f8100) at /usr/src/sys/net/if_ethersubr.c:830 #20 0xffffffff80db8081 in tcp_flush_out_le (tp=0x0, lc=0xfffffe00e3f90630, le=0xfffffe00e40d9498, locked=0) at /usr/src/sys/netinet/tcp_lro.c:569 #21 0xffffffff80db7e22 in tcp_lro_flush (lc=0xfffffe00e3f90630, le=0xfffffe00e40d9498) at /usr/src/sys/netinet/tcp_lro.c:978 #22 0xffffffff80db81cb in tcp_lro_rx_done (lc=0xfffffe00e3f90630) at /usr/src/sys/netinet/tcp_lro.c:356 #23 tcp_lro_flush_all (lc=0xfffffe00e3f90630) at /usr/src/sys/netinet/tcp_lro.c:1123 #24 0xffffffff80d2b8da in iflib_rxeof (rxq=, budget=) at /usr/src/sys/net/iflib.c:2946 #25 0xffffffff80d25e62 in _task_fn_rx (context=0xfffffe00e3f90600) at /usr/src/sys/net/iflib.c:3855 #26 0xffffffff80c45f6d in gtaskqueue_run_locked (queue=0xfffff80101f6f000) at /usr/src/sys/kern/subr_gtaskqueue.c:371 #27 0xffffffff80c45c0c in gtaskqueue_thread_loop (arg=) at /usr/src/sys/kern/subr_gtaskqueue.c:547 #28 0xffffffff80bb5e5e in fork_exit (callout=0xffffffff80c45b60 , arg=0xfffffe00e3ee0038, frame=0xfffffe019b330c00) at /usr/src/sys/kern/kern_fork.c:1069 #29 (kgdb) #0 __curthread () at /usr/src/sys/amd64/include/pcpu_aux.h:55 #1 doadump (textdump=1) at /usr/src/sys/kern/kern_shutdown.c:399 #2 0xffffffff80bf87bb in kern_reboot (howto=260) at /usr/src/sys/kern/kern_shutdown.c:486 #3 0xffffffff80bf8c40 in vpanic (fmt=, ap=) at /usr/src/sys/kern/kern_shutdown.c:919 #4 0xffffffff80bf8a43 in panic (fmt=) at /usr/src/sys/kern/kern_shutdown.c:843 #5 0xffffffff8102cf17 in trap_fatal (frame=0xfffffe019b330220, eva=24) at /usr/src/sys/amd64/amd64/trap.c:915 #6 0xffffffff8102cf6f in trap_pfault (frame=0xfffffe019b330220, usermode=, signo=, ucode=) at /usr/src/sys/amd64/amd64/trap.c:732 #7 0xffffffff8102c5cd in trap (frame=0xfffffe019b330220) at /usr/src/sys/amd64/amd64/trap.c:398 #8 #9 m_copydata (m=0x0, off=0, len=1, cp=) at /usr/src/sys/kern/uipc_mbuf.c:656 #10 0xffffffff80db9fab in tcp_output (tp=0xfffffe05449d48f0) at /usr/src/sys/netinet/tcp_output.c:1065 #11 0xffffffff80db1fd7 in tcp_do_segment (m=0xfffff802150f8100, th=, so=, tp=0xfffffe05449d48f0, drop_hdrlen=64, tlen=, iptos=0 '\000') at /usr/src/sys/netinet/tcp_input.c:2786 #12 0xffffffff80dae9ae in tcp_input (mp=, offp=, proto=) at /usr/src/sys/netinet/tcp_input.c:1381 #13 0xffffffff80da1555 in ip_input (m=0x0) at /usr/src/sys/netinet/ip_input.c:833 #14 0xffffffff80d2f12a in netisr_dispatch_src (proto=1, source=, m=0xfffff8023060499c) at /usr/src/sys/net/netisr.c:1143 #15 0xffffffff80d138e8 in ether_demux (ifp=0xfffff8010247f800, m=0x0) at /usr/src/sys/net/if_ethersubr.c:923 #16 0xffffffff80d14c81 in ether_input_internal (ifp=0xfffff8010247f800, m=0x0) at /usr/src/sys/net/if_ethersubr.c:709 #17 ether_nh_input (m=) at /usr/src/sys/net/if_ethersubr.c:739 #18 0xffffffff80d2f12a in netisr_dispatch_src (proto=5, source=, m=0xfffff8023060499c) at /usr/src/sys/net/netisr.c:1143 #19 0xffffffff80d13d39 in ether_input (ifp=, m=0xfffff802150f8100) at /usr/src/sys/net/if_ethersubr.c:830 #20 0xffffffff80db8081 in tcp_flush_out_le (tp=0x0, lc=0xfffffe00e3f90630, le=0xfffffe00e40d9498, locked=0) at /usr/src/sys/netinet/tcp_lro.c:569 #21 0xffffffff80db7e22 in tcp_lro_flush (lc=0xfffffe00e3f90630, le=0xfffffe00e40d9498) at /usr/src/sys/netinet/tcp_lro.c:978 #22 0xffffffff80db81cb in tcp_lro_rx_done (lc=0xfffffe00e3f90630) at /usr/src/sys/netinet/tcp_lro.c:356 #23 tcp_lro_flush_all (lc=0xfffffe00e3f90630) at /usr/src/sys/netinet/tcp_lro.c:1123 #24 0xffffffff80d2b8da in iflib_rxeof (rxq=, budget=) at /usr/src/sys/net/iflib.c:2946 #25 0xffffffff80d25e62 in _task_fn_rx (context=0xfffffe00e3f90600) at /usr/src/sys/net/iflib.c:3855 #26 0xffffffff80c45f6d in gtaskqueue_run_locked (queue=0xfffff80101f6f000) at /usr/src/sys/kern/subr_gtaskqueue.c:371 #27 0xffffffff80c45c0c in gtaskqueue_thread_loop (arg=) at /usr/src/sys/kern/subr_gtaskqueue.c:547 #28 0xffffffff80bb5e5e in fork_exit (callout=0xffffffff80c45b60 , arg=0xfffffe00e3ee0038, frame=0xfffffe019b330c00) at /usr/src/sys/kern/kern_fork.c:1069 #29 (kgdb) f 10 #10 0xffffffff80db9fab in tcp_output (tp=0xfffffe05449d48f0) at /usr/src/sys/netinet/tcp_output.c:1065 1065 m_copydata(mb, moff, len, (kgdb) p *so (kgdb) p *tp $1 = {t_inpcb = 0xfffff802837661e8, t_fb = 0xffffffff8193a570 , t_fb_ptr = 0x0, t_maxseg = 1452, t_logstate = 0, t_port = 0, t_state = 6, t_idle_reduce = 0, t_delayed_ack = 0, t_fin_is_rst = 0, t_log_state_set = 0, bits_spare = 0, t_flags = 1630536692, snd_una = 3782461019, snd_max = 3782466169, snd_nxt = 3782466169, snd_up = 3782461019, snd_wnd = 187648, snd_cwnd = 4344, t_peakrate_thr = 0, ts_offset = 2615689744, rfbuf_ts = 214228849, rcv_numsacks = 0, t_tsomax = 65535, t_tsomaxsegcount = 29, t_tsomaxsegsize = 4096, rcv_nxt = 591592702, rcv_adv = 592643326, rcv_wnd = 1050624, t_flags2 = 1026, t_srtt = 2068, t_rttvar = 87, ts_recent = 4251664859, snd_scale = 8 '\b', rcv_scale = 11 '\v', snd_limited = 0 '\000', request_r_scale = 11 '\v', last_ack_sent = 591592702, t_rcvtime = 2361209147, rcv_up = 591592702, t_segqlen = 0, t_segqmbuflen = 0, t_segq = {tqh_first = 0x0, tqh_last = 0xfffffe05449d4980}, t_in_pkt = 0x0, t_tail_pkt = 0x0, t_timers = 0xfffffe05449d4b78, t_vnet = 0xfffff80101413b00, snd_ssthresh = 5760, snd_wl1 = 591592702, snd_wl2 = 3782461019, irs = 591591471, iss = 3773678399, t_acktime = 0, t_sndtime = 2361206776, ts_recent_age = 214326492, snd_recover = 3782466168, cl4_spare = 0, t_oobflags = 0 '\000', t_iobc = 0 '\000', t_rxtcur = 286, t_rxtshift = 0, t_rtttime = 0, t_rtseq = 3782466167, t_starttime = 2361111436, t_fbyte_in = 2361111439, t_fbyte_out = 2361111440, t_pmtud_saved_maxseg = 0, t_blackhole_enter = 0, t_blackhole_exit = 0, t_rttmin = 30, t_rttbest = 1940, t_softerror = 0, max_sndwnd = 1132032, snd_cwnd_prev = 4429, snd_ssthresh_prev = 5760, snd_recover_prev = 3782466168, t_sndzerowin = 0, t_rttupdated = 4404, snd_numholes = 1, t_badrxtwin = 214326378, snd_holes = {tqh_first = 0xfffff8017a6c23c0, tqh_last = 0xfffff8017a6c23d0}, snd_fack = 3782466169, sackblks = {{start = 0, end = 0}, {start = 0, end = 0}, {start = 0, end = 0}, {start = 0, end = 0}, {start = 0, end = 0}, { start = 0, end = 0}}, sackhint = {nexthole = 0xfffff8017a6c23c0, sack_bytes_rexmit = 3708, last_sack_ack = 3782466169, delivered_data = 1440, sacked_bytes = 1, recover_fs = 545702, prr_delivered = 1080008, _pad = {0}}, t_rttlow = 59, rfbuf_cnt = 620, tod = 0x0, t_sndrexmitpack = 4299, t_rcvoopack = 0, t_toe = 0x0, cc_algo = 0xffffffff81937730 , ccv = 0xfffffe05449d4cc0, osd = 0xfffffe05449d4ce8, t_bytes_acked = 0, t_maxunacktime = 0, t_keepinit = 0, t_keepidle = 0, t_keepintvl = 0, t_keepcnt = 0, t_dupacks = 1, t_lognum = 0, t_loglimit = 5000, t_pacing_rate = -1, t_logs = {stqh_first = 0x0, stqh_last = 0xfffffe05449d4b08}, t_lin = 0x0, t_lib = 0x0, t_output_caller = 0x0, t_stats = 0x0, t_logsn = 0, gput_ts = 0, gput_seq = 0, gput_ack = 0, t_stats_gput_prev = 0, t_tfo_client_cookie_len = 0 '\000', t_end_info_status = 0, t_tfo_pending = 0x0, t_tfo_cookie = { client = '\000' , server = 0}, {t_end_info_bytes = "\000\000\000\000\000\000\000", t_end_info = 0}} (kgdb) p *tp->t_inpcb->inp_socket $2 = {so_lock = {lock_object = {lo_name = 0xffffffff8112c3ac "socket", lo_flags = 21168128, lo_data = 0, lo_witness = 0x0}, mtx_lock = 0}, so_count = 0, so_rdsel = {si_tdlist = { tqh_first = 0x0, tqh_last = 0x0}, si_note = {kl_list = {slh_first = 0x0}, kl_lock = 0xffffffff80c95b90 , kl_unlock = 0xffffffff80c95c00 , kl_assert_lock = 0xffffffff80c95c60 , kl_lockarg = 0xfffff802943a63b0, kl_autodestroy = 0}, si_mtx = 0x0}, so_wrsel = {si_tdlist = {tqh_first = 0x0, tqh_last = 0x0}, si_note = {kl_list = {slh_first = 0x0}, kl_lock = 0xffffffff80c95c70 , kl_unlock = 0xffffffff80c95ce0 , kl_assert_lock = 0xffffffff80c95d40 , kl_lockarg = 0xfffff802943a63b0, kl_autodestroy = 0}, si_mtx = 0x0}, so_type = 1, so_options = 4, so_linger = 0, so_state = 16651, so_pcb = 0xfffff802837661e8, so_vnet = 0xfffff80101413b00, so_proto = 0xffffffff819354c0 , so_timeo = 0, so_error = 0, so_sigio = 0x0, so_cred = 0xfffff810fe946e00, so_label = 0x0, so_gencnt = 5379175, so_emuldata = 0x0, so_dtor = 0x0, osd = {osd_nslots = 0, osd_slots = 0x0, osd_next = {le_next = 0x0, le_prev = 0x0}}, so_fibnum = 0, so_user_cookie = 0, so_ts_clock = 0, so_max_pacing_rate = 0, {{so_rcv = {sb_mtx = {lock_object = {lo_name = 0xffffffff8118fa7d "so_rcv", lo_flags = 16973824, lo_data = 0, lo_witness = 0x0}, mtx_lock = 0}, sb_sx = {lock_object = {lo_name = 0xffffffff811dbf46 "so_rcv_sx", lo_flags = 36896768, lo_data = 0, lo_witness = 0x0}, sx_lock = 1}, sb_sel = 0xfffff802943a63d8, sb_state = 32, sb_mb = 0x0, sb_mbtail = 0x0, sb_lastrecord = 0x0, sb_sndptr = 0x0, sb_fnrdy = 0x0, sb_sndptroff = 0, sb_acc = 0, sb_ccc = 0, sb_hiwat = 1049796, sb_mbcnt = 0, sb_mcnt = 0, sb_ccnt = 0, sb_mbmax = 8398368, sb_ctl = 0, sb_tlscc = 0, sb_tlsdcc = 0, sb_lowat = 1, sb_timeo = 0, sb_tls_seqno = 0, sb_tls_info = 0x0, sb_mtls = 0x0, sb_mtlstail = 0x0, sb_flags = 2048, sb_upcall = 0x0, sb_upcallarg = 0x0, sb_aiojobq = {tqh_first = 0x0, tqh_last = 0xfffff802943a65e0}, sb_aiotask = {ta_link = {stqe_next = 0x0}, ta_pending = 0, ta_priority = 0 '\000', ta_flags = 0 '\000', ta_func = 0xffffffff80c713a0 , ta_context = 0xfffff802943a63b0}}, so_snd = {sb_mtx = {lock_object = {lo_name = 0xffffffff811a1e6b "so_snd", lo_flags = 16973824, lo_data = 0, lo_witness = 0x0}, mtx_lock = 18446741878510340608}, sb_sx = { lock_object = {lo_name = 0xffffffff8120199a "so_snd_sx", lo_flags = 36896768, lo_data = 0, lo_witness = 0x0}, sx_lock = 1}, sb_sel = 0xfffff802943a6420, sb_state = 16, sb_mb = 0xfffff812c76cee00, sb_mbtail = 0xfffff81c5d2bf900, sb_lastrecord = 0xfffff812c76cee00, sb_sndptr = 0xfffff81c5d2bf900, sb_fnrdy = 0x0, sb_sndptroff = 4514, sb_acc = 5148, sb_ccc = 5148, sb_hiwat = 1426628, sb_mbcnt = 11264, sb_mcnt = 4, sb_ccnt = 4, sb_mbmax = 11413024, sb_ctl = 0, sb_tlscc = 0, sb_tlsdcc = 0, sb_lowat = 2048, sb_timeo = 0, sb_tls_seqno = 0, sb_tls_info = 0x0, sb_mtls = 0x0, sb_mtlstail = 0x0, sb_flags = 2048, sb_upcall = 0x0, sb_upcallarg = 0x0, sb_aiojobq = {tqh_first = 0x0, tqh_last = 0xfffff802943a66f8}, sb_aiotask = {ta_link = {stqe_next = 0x0}, ta_pending = 0, ta_priority = 0 '\000', ta_flags = 0 '\000', ta_func = 0xffffffff80c71bc0 , ta_context = 0xfffff802943a63b0}}, so_list = {tqe_next = 0x0, tqe_prev = 0xfffff811008ccc68}, so_listen = 0x0, so_qstate = SQ_NONE, so_peerlabel = 0x0, so_oobmark = 0, so_ktls_rx_list = {stqe_next = 0x0}}, {sol_incomp = {tqh_first = 0xffffffff8118fa7d, tqh_last = 0x1030000}, sol_comp = {tqh_first = 0x0, tqh_last = 0x0}, sol_qlen = 2166210374, sol_incqlen = 4294967295, sol_qlimit = 36896768, sol_accept_filter = 0x0, sol_accept_filter_arg = 0x1, sol_accept_filter_str = 0xfffff802943a63d8 "", sol_upcall = 0x20, sol_upcallarg = 0x0, sol_sbrcv_lowat = 0, sol_sbsnd_lowat = 0, sol_sbrcv_hiwat = 0, sol_sbsnd_hiwat = 0, sol_sbrcv_flags = 0, sol_sbsnd_flags = 0, sol_sbrcv_timeo = 0, sol_sbsnd_timeo = 0, sol_lastover = {tv_sec = 4508839487471616, tv_usec = 0}, sol_overcount = 0}}} (kgdb) quit -- wbr, Sergey From owner-freebsd-current@freebsd.org Mon Jan 25 04:46:56 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D4CD64E89DA; Mon, 25 Jan 2021 04:46:56 +0000 (UTC) (envelope-from tjlegg@gmail.com) Received: from mail-qt1-x830.google.com (mail-qt1-x830.google.com [IPv6:2607:f8b0:4864:20::830]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPHQS0xzyz53yR; Mon, 25 Jan 2021 04:46:55 +0000 (UTC) (envelope-from tjlegg@gmail.com) Received: by mail-qt1-x830.google.com with SMTP id z22so8854696qto.7; Sun, 24 Jan 2021 20:46:55 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=804wQnTi1Z3EuL2szdNIwlXvhwFTZvTvFxgUG+DDsW4=; b=ixwCPAaGMcfJ0vPIJThJ0pxKombUDbIH/56fTtRbX7Cjry7U4GX/nok7IpaOyAdX6E NwWhVHqbIDKymhrN9DjmUGmtZ8Y3zqz9hUqK79iVtUnXncd85/LC75ICjxgEg/USYFsF HlUVt3byt0a8WN0HAVocI9YCVCBvZwZN95XBp4D2OiFy9+65XDW6/yhlHC4KEALzD6z7 qjCCbUfqSnSUWET+HS8iRG6i7WZUhd7n5DGvh8ZpH9clAhU+04L+L6GsoZbfUh9i6+yI N6zW0/eXlJ7sm9n5clXiAfB49GgdTxbX95yDEPsOTB0P2kzXtlUEGnVVRg3foEEnliOe iOwg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=804wQnTi1Z3EuL2szdNIwlXvhwFTZvTvFxgUG+DDsW4=; b=ezrM2gBbRgwSlZrttfdZDp9veO0vWNhZt54VX9uyGICtNiMoTC5LVoCSCVx5y2A9/m P6XQxqg94zehjZule/SNuYS92zYi0FCbfDNHplcpQm7/aXCq35/l9hPXzedRVe6UQePu mrAlUQozt+Pfj89JrA3er3N0dc6Z1Qn2ZEDD+g8RImf9kxQeWlqxeZEGxE5hpgtVh1oF WZXh8P/2Opd6IdWrjRuki3YcyIg7q5FzL39kCvGh9P9TDNmxc6noJRhhvOU8ceZp18Qz QTK5hvIOJ8QhCuViNtYzYVaDxL/AiAPrAJpfT4zw/tj1qv2JOMMSfmIa9yQYCZFYiApO e5hA== X-Gm-Message-State: AOAM530kIWhq9zmwFN4ewCmK0zqBm666KKgsAbPqd2vnfUHAUVO7aCnY VXNVIMH429BMQSrdCd5+Apvzza8BS5yVXg9IAeoZoQ5m5q02CA== X-Google-Smtp-Source: ABdhPJzhQNzAEG3FA5jtKM70Tsj0tkaTdf2OndfnaTZXXVPv/0HIf1rweIMqbGMIKGVmKc80h9LCzAGHpP3soJb07gM= X-Received: by 2002:ac8:4d93:: with SMTP id a19mr155914qtw.356.1611550014965; Sun, 24 Jan 2021 20:46:54 -0800 (PST) MIME-Version: 1.0 From: Thomas Legg Date: Mon, 25 Jan 2021 12:46:43 +0800 Message-ID: Subject: Poudriere failed to build pkg in 13-stable jail under 12-stable To: freebsd-stable@freebsd.org, freebsd-current@freebsd.org X-Rspamd-Queue-Id: 4DPHQS0xzyz53yR X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=ixwCPAaG; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of tjlegg@gmail.com designates 2607:f8b0:4864:20::830 as permitted sender) smtp.mailfrom=tjlegg@gmail.com X-Spamd-Result: default: False [-3.19 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::830:from]; FREEMAIL_FROM(0.00)[gmail.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::830:from:127.0.2.255]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::830:from]; NEURAL_HAM_SHORT(-0.19)[-0.193]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-stable,freebsd-current]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim] X-Mailman-Approved-At: Mon, 25 Jan 2021 10:31:33 +0000 Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 04:46:56 -0000 The build of a 13-stable source and kernel were a success under 12-stable (though with some issues on freeze-ups and hard reboots that I suspect might be related to the bufdaemon issue and my 0x15 gen AMD cpu). Created a 13-stable poudriere jail with the knowledge that there may be issues with builds under a 12-stable r369076 kernel. I didn't expect this failure on packaging pkg. ====> Compressing man pages (compress-man) ===> Installing ldconfig configuration file =========================================================================== =================================================== ===> Building package for pkg-1.16.2 cp: /wrkdirs/usr/ports/ports-mgmt/pkg/work/pkg/pkg-1.16.2.txz: Function not implemented *** Error code 1 Stop. make[1]: stopped in /usr/ports/ports-mgmt/pkg *** Error code 1 Stop. make: stopped in /usr/ports/ports-mgmt/pkg =>> Cleaning up wrkdir ===> Cleaning for pkg-1.16.2 build of ports-mgmt/pkg | pkg-1.16.2 ended at Mon Jan 25 12:16:12 HKT 2021 build time: 00:02:01 !!! build failure encountered !!! From owner-freebsd-current@freebsd.org Mon Jan 25 10:54:50 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 45F6D4DC142; Mon, 25 Jan 2021 10:54:50 +0000 (UTC) (envelope-from bapt@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPRZy0RNDz3lT8; Mon, 25 Jan 2021 10:54:50 +0000 (UTC) (envelope-from bapt@FreeBSD.org) Received: from ivaldir.etoilebsd.net (etoilebsd.net [IPv6:2001:41d0:8:db4c::1]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) (Authenticated sender: bapt) by smtp.freebsd.org (Postfix) with ESMTPSA id DCC342D5EC; Mon, 25 Jan 2021 10:54:49 +0000 (UTC) (envelope-from bapt@FreeBSD.org) Received: by ivaldir.etoilebsd.net (Postfix, from userid 1001) id 87AF2E6784; Mon, 25 Jan 2021 11:54:44 +0100 (CET) Date: Mon, 25 Jan 2021 11:54:44 +0100 From: Baptiste Daroussin To: Thomas Legg Cc: freebsd-stable@freebsd.org, freebsd-current@freebsd.org Subject: Re: Poudriere failed to build pkg in 13-stable jail under 12-stable Message-ID: <20210125105444.qha5gscud7vzmpm2@ivaldir.net> References: MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="sqt7uthmkjo3q2wq" Content-Disposition: inline In-Reply-To: X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 10:54:50 -0000 --sqt7uthmkjo3q2wq Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Mon, Jan 25, 2021 at 12:46:43PM +0800, Thomas Legg wrote: > The build of a 13-stable source and kernel were a success under 12-stable > (though with some issues on freeze-ups and hard reboots that I suspect > might be related to the bufdaemon issue and my 0x15 gen AMD cpu). >=20 > Created a 13-stable poudriere jail with the knowledge that there may be > issues with builds under a 12-stable r369076 kernel. I didn't expect this > failure on packaging pkg. >=20 > =3D=3D=3D=3D> Compressing man pages (compress-man) > =3D=3D=3D> Installing ldconfig configuration file > =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D > =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D > =3D=3D=3D> Building package for pkg-1.16.2 > cp: /wrkdirs/usr/ports/ports-mgmt/pkg/work/pkg/pkg-1.16.2.txz: Function n= ot > implemented > *** Error code 1 >=20 cp on head and 13 is using copy_file_range(2), introduced in 13-CURRENT recentish, this is what is failing here. Best regards, Bapt --sqt7uthmkjo3q2wq Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEEgOTj3suS2urGXVU3Y4mL3PG3PloFAmAOo3IACgkQY4mL3PG3 PloRoxAAuLDuby7JFCKdPeR8Q1hMRkoqaP0qwcXP0vozhYumGV2bfT6lA9SvWFh1 m/AvOanVTqjQokRQ1lJ4R6okRvmMlpc0UvV7sg+ar9zT78e38z/73Iie8u6qVzRj dyVUSSix+lHW2ofpttV0InnOvQ9wl2r7z7QD2YcCoGuJD3zmZ9rf/UOawHxi2Bg5 nDcAK9kwrOtNRewfTPg2dqv3zKH3iIt1pdYeCWB8SZqMfBgcIgOYRLC1d1RyDH9l dQnppKgya6TESWgZ25PqMuOHWF+Elr9ee8fSEmsQv5wx12JkScCSMkkgRHoAZsGR KGO3v6QmhwGLMAYxCZZ3Yjnnom9Bwv/c9R5uonfsNmPZTWFoxZrd8Z6aKFfQE8KX kEOFp4PW7nkVL+qOX9O/t+zN+UuuUDu5zBS9ukISr0pIGYIah2iamnGMWjehKe2O 1H+VDtIUhhu3UnpppX5Oqa1h8DA8Ouvzq2NZM0F7hp7vVbIZIclcKHQiwB475m8H 6sUwK9UAzxpqi+D9ZDCWdmD+hm1DvDzeixb7ieZok+m3kKuZUY4bPAtq4xC0aS42 mTz8GYHZJOfnQJ2Za3sFMfw39bOAr4KOcl1zrDt8CHSuBm+PR6oBVJdFmCGvA9MA JZHgws5PP+YBK4pId1ZR2OE6JjMVQHsDJifBBB7Ph6z7y4Ps31s= =3eHd -----END PGP SIGNATURE----- --sqt7uthmkjo3q2wq-- From owner-freebsd-current@freebsd.org Mon Jan 25 14:45:37 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id ED0374E502D for ; Mon, 25 Jan 2021 14:45:37 +0000 (UTC) (envelope-from rmacklem@uoguelph.ca) Received: from CAN01-TO1-obe.outbound.protection.outlook.com (mail-eopbgr670052.outbound.protection.outlook.com [40.107.67.52]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "GlobalSign Organization Validation CA - SHA256 - G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPXjD14htz4WwK for ; Mon, 25 Jan 2021 14:45:35 +0000 (UTC) (envelope-from rmacklem@uoguelph.ca) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=goCyOwGytUBaN4sBPHDvaGV5isFAJAm07kB278/bCTp4MewClk0LZe2U2uAD5OD2z7/iF0d/l+WQSF38ivqpGkVRX+Iul2sA9s/2FcgwueQBYtd8heZabsD7Cq6USlZZo91s7vUOTUGjyNdebvNFm5Li86mNU3gfx+o8+UiMj+bzhXHRUBiZuBh7b2jq5xELSmNlx0/LlPX68f0qhcrFgAwHhxsS6X6XjL/7ZW9C1iwnHpeBLkf77uJ9zweyY2zn1CZ6ZZnKNDY5fOKKhiH/4atSyRM2xhBHOQ5bj2oeSR9Q6frafokfLL5HhgYp3ZCytDcBAVz1+Q4iGAPwsHoizA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=unz/0ZCJKL79dynLtD9g6nsSvq0WEhAwlO4U65VBCmk=; b=QC6L0Ba9rsc2g/TC3iwMNor8Ke8OzCdSc/IxvbJmBu4gC7FjC4qSBymktkaUtaaPfMHRj4pxX5gOPCLEMA6ywnUgp7y4uDStoczPYLJbGzKZx9/ukn0ICK7aT2H96Zpa8qqmCVi7BkxlmikoRVvVqZhOFLGayW5egjIMrS8DzoeNMn4d2Lu4gFwmMRqEw7Q7F0HV6ZbG3Vd5XZH1eMip+R1BR2abfKdmJV/k6VOW+vIlycejeJ1uKb48vofqxy2v1kkaxD0j68KvC4KzoZWCeBOaVWDGkqrK7Of9m4A4gTbf+Q6ZlD24IbXrge3h2x02fLbD2f97I/vCezxVjH1FyQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=uoguelph.ca; dmarc=pass action=none header.from=uoguelph.ca; dkim=pass header.d=uoguelph.ca; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=uoguelph.ca; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=unz/0ZCJKL79dynLtD9g6nsSvq0WEhAwlO4U65VBCmk=; b=JfCQTiJbZok45ypo7UhF4inQZIJ6E+wC2QKy15Y7Qa4xoUAa62VDi84VjYB+Y179dGwGcLcxtCHG/Xf+Ey4fgaFOuLFqoW+554Hqn6TAE9MEGRzgl9cbZnkJDviV4sXpSOUgC8x95rgbf9jNmH27VRXu7e+n0He1DTQ1jpRJoewD+IS/CMLEzLe0QAwL6dqqTcW0i5DfUBqZCVYFTI8LStzSVxjl32PRrHwHtQbLaGliePY4c0/sVbH5dYLEhrwLr/EKmzMS9BO7EBrL9PxPLOaGyQfWXDqH2CxrCjlkbD9jrbWph/zCxJIZpmcP+Gf+C+cjJAUEu1z1LVBo2pSUcQ== Received: from YQXPR0101MB0968.CANPRD01.PROD.OUTLOOK.COM (2603:10b6:c00:19::29) by YQXPR01MB2664.CANPRD01.PROD.OUTLOOK.COM (2603:10b6:c00:44::19) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3784.11; Mon, 25 Jan 2021 14:45:34 +0000 Received: from YQXPR0101MB0968.CANPRD01.PROD.OUTLOOK.COM ([fe80::6073:6fc0:5ddf:dc8a]) by YQXPR0101MB0968.CANPRD01.PROD.OUTLOOK.COM ([fe80::6073:6fc0:5ddf:dc8a%7]) with mapi id 15.20.3784.019; Mon, 25 Jan 2021 14:45:34 +0000 From: Rick Macklem To: Benjamin Kaduk CC: Ronald Klop , "freebsd-current@freebsd.org" Subject: Re: Can In-Kernel TLS (kTLS) work with any OpenSSL Application? Thread-Topic: Can In-Kernel TLS (kTLS) work with any OpenSSL Application? Thread-Index: AQHW72nXjq3dxqCEc0+vdfHyry1d96o1K3uAgAAlSjWAAotiAIAAlKAq Date: Mon, 25 Jan 2021 14:45:34 +0000 Message-ID: References: , <20210125054656.GR21@kduck.mit.edu> In-Reply-To: <20210125054656.GR21@kduck.mit.edu> Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 205b4e80-832e-4154-580f-08d8c13fdf45 x-ms-traffictypediagnostic: YQXPR01MB2664: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:9508; x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: x+8BngPuEduozgq1yRVUrH1oQ9mxLNujm+OZdg8f3EKCr2c5i8/GrsUXyJs6HFAF2zv8lAUNC6APA8CIe7fGQX6VtEEXCQMy1AKfQESw2KZz65cUHHITwADl5sgf2a53XVxy7ovWFaM+g+YRrrJE6po1oEf33zdTKVnNucObTd1DO60qK/wtDR/JF/+x6HrJ5Y4EzvlYkDwD0aGlmRhDHe+tbA5/9tPuw4bf/sqOQZNjP0yA9edU2ZkM/MWeF8HzH4IPUK7RvN1OlfFOu2jFjwqfgs+SEtgTg3EgfZ5xi4OkQeyJPuc3Rp/zwAJNbUGy6K0ZdLAasvefEc3NDEdfj+UCGyvaQhfEFaHh76RV0oeu6DYQ6C2DetLDMnaCQxDlN5r9b5FzBwvu+Aw+4EOp/KWZlUZYyWAkZkjlz9B7rRy5Bd3G02YWBRPYIFHMe/wgN/Dwx7nyuGhviUjYQzkOSA== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:YQXPR0101MB0968.CANPRD01.PROD.OUTLOOK.COM; PTR:; CAT:NONE; SFS:(396003)(39860400002)(136003)(376002)(346002)(366004)(2906002)(91956017)(76116006)(66946007)(66446008)(66556008)(66476007)(64756008)(86362001)(478600001)(6916009)(71200400001)(786003)(54906003)(316002)(5660300002)(83380400001)(8676002)(4326008)(52536014)(9686003)(33656002)(966005)(186003)(6506007)(8936002)(55016002)(7696005); DIR:OUT; SFP:1101; x-ms-exchange-antispam-messagedata: =?iso-8859-1?Q?xKZXLrzsH6otlNchNfQLocgitMg+KKzO/kuyXifqozuWwKL+dq4MF11cvK?= =?iso-8859-1?Q?Goa/AgmPLZ5Wp2Yk30LolAyO54Er65zG5bz1WwO5gZCafiyi7BEWaWiahn?= =?iso-8859-1?Q?kVngmSr6NvhK/gZawC9+A8rLc9UqvfMQzf1jgRVDHMLTFz5a/vJalwLELP?= =?iso-8859-1?Q?Vz+WXNYpUhk8GCV8bfdLtAgGWkG+wofjgnvE7NxShTsmqo5XqRgmS5D5X4?= =?iso-8859-1?Q?gheHE9n8QtFZsEx1dtWNHN+wDM4uN8RALLef5oyf4+LZL92ruA84+bzYKY?= =?iso-8859-1?Q?c9xWG5MhBb4p8ggh6WTugofA/j+xgaTc1RPnsmJy8ZWn8rlJQ/W8bMh4OP?= =?iso-8859-1?Q?vJkBC4ChJCl3WnOSQL/f7AJuYKU+xR7MXeDqYqJ4fjtEL0BqM2gMUU6gDf?= =?iso-8859-1?Q?YiPQwj5VdtSLwq7sqDMOsg37CNN9BdwRQvzbF1uKGllwihEvf/yF6YPKD7?= =?iso-8859-1?Q?7TyreUJYBqqspM0K+2bpQooozD7vQn7QH+qRZ++KukTJmc0V5gidbUQpmQ?= =?iso-8859-1?Q?/4cAabeg1Vp5lqxW5X5fSnlPX3QGewbm0pZBdV48vl43T4K1aSWDBqGor/?= =?iso-8859-1?Q?Dk3PWagP+5Q5R48f1g5d0JeUzGdrhIhYhKXs2evavJEbyy86xqfYmKVCG3?= =?iso-8859-1?Q?1KO4MUq0kxXCnCCjmL0A+xKQuWrgauyopp7XvaUCTH4sAkoEe/Vt8z/JY4?= =?iso-8859-1?Q?QGqm386gZV0Opdmaep4EYBcTVKRoNU/P/Ir/romOhvWKJS3puODz0Mbp9r?= =?iso-8859-1?Q?HbefDoWKWGfiAeW6drtV9hC8t7xV2wBYttu0H+jHNeOX7MhheP9nyRZS/X?= =?iso-8859-1?Q?0/e73SmdPstbXrL4HbGPBb9gvdqNN22NsC62f6cXA62AZG2M2bUv//rAn1?= =?iso-8859-1?Q?EYZ82gNBpQEbuMbnA92p7W54Bi8fdy5Y8YEOZtxabkfxhiXy9W5z3YblG5?= =?iso-8859-1?Q?cOWq9G+y29DCgJhWPWYsh5dn6Ou1AjuciFNX9cH1Dtl8dBRSFBR71yDrxw?= =?iso-8859-1?Q?IXpY/Mk4l6OjnjXX7m+3VQFwWim02MOs973NpogVkQIJ8ei6H92SFW7FRN?= =?iso-8859-1?Q?TJMcxp/4nNq+nLPR3mEVkoEs5+uTkU7PR7yuE2sZMEzmwrirTyQWDgqG89?= =?iso-8859-1?Q?ODy2lX1TKbwnys75zbj6AIkXHIwGuN9jzDHi97E0tfi1jLL21y?= x-ms-exchange-transport-forked: True Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-OriginatorOrg: uoguelph.ca X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: YQXPR0101MB0968.CANPRD01.PROD.OUTLOOK.COM X-MS-Exchange-CrossTenant-Network-Message-Id: 205b4e80-832e-4154-580f-08d8c13fdf45 X-MS-Exchange-CrossTenant-originalarrivaltime: 25 Jan 2021 14:45:34.5169 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: be62a12b-2cad-49a1-a5fa-85f4f3156a7d X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: iNNXvR4rz3OSxVNfWTQtnwTTdkJasqRcJ7Ya91VH7nSuboUGPViW1yelsxo7MBCMXLsd97Yc6gti5AyGgv2xOw== X-MS-Exchange-Transport-CrossTenantHeadersStamped: YQXPR01MB2664 X-Rspamd-Queue-Id: 4DPXjD14htz4WwK X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=uoguelph.ca header.s=selector1 header.b=JfCQTiJb; arc=pass (microsoft.com:s=arcselector9901:i=1); dmarc=pass (policy=none) header.from=uoguelph.ca; spf=pass (mx1.freebsd.org: domain of rmacklem@uoguelph.ca designates 40.107.67.52 as permitted sender) smtp.mailfrom=rmacklem@uoguelph.ca X-Spamd-Result: default: False [-5.00 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:40.107.0.0/16]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[uoguelph.ca:+]; DMARC_POLICY_ALLOW(-0.50)[uoguelph.ca,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[40.107.67.52:from]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:8075, ipnet:40.104.0.0/14, country:US]; RCVD_TLS_LAST(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[uoguelph.ca:s=selector1]; FREEFALL_USER(0.00)[rmacklem]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DWL_DNSWL_LOW(-1.00)[uoguelph.ca:dkim]; SPAMHAUS_ZRD(0.00)[40.107.67.52:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[40.107.67.52:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[40.107.67.52:from]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 14:45:38 -0000 Benjamin Kaduk wrote:=0A= >On Sat, Jan 23, 2021 at 03:25:59PM +0000, Rick Macklem wrote:=0A= >> Ronald Klop wrote:=0A= >> >On Wed, 20 Jan 2021 21:21:15 +0100, Neel Chauhan wrote= :=0A= >> >But I think for Tor to support KTLS it needs to implement some things= =0A= >> >itself. More information about that could be asked at the maintainer of= =0A= >> >the port (https://www.freshports.org/security/tor/) or upstream at the = Tor=0A= >> >project.=0A= >> To just make it work, I don't think changes are needed beyond linking to= =0A= >> the correct OpenSSL libraries (assuming it uses OpenSSL, of course).=0A= >> (There are new library calls an application can use to check to see if= =0A= >> KTLS is enabled for the connection, but if it doesn't care, I don't thin= k=0A= >> those calls are needed?)=0A= >>=0A= >> You do need to run a kernel with "options KERN_TLS" and set=0A= >> kern.ipc.tls.enable=3D1=0A= >> kern.ipc.mb_use_ext_pgs=3D1=0A= >=0A= >Note that upstream openssl is expecting to change in what ways ktls is=0A= >(en/dis)abled by default; see=0A= >https://github.com/openssl/openssl/issues/13794=0A= Thanks for the pointer Ben.=0A= It appears that=0A= SSL_CTX_clear_mode(ctx, SSL_MODE_NO_KTLS_TX | SSL_MODE_NO_KTLS_RX)=0A= or similar will soon be needed to enable it.=0A= I'll add this call to the nfs-over-tls daemons, since it should be harmless= to do.=0A= =0A= Thanks for mentioning this, rick=0A= =0A= -Ben=0A= _______________________________________________=0A= freebsd-current@freebsd.org mailing list=0A= https://lists.freebsd.org/mailman/listinfo/freebsd-current=0A= To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org"= =0A= =0A= From owner-freebsd-current@freebsd.org Mon Jan 25 16:19:53 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C89B44E7F2F for ; Mon, 25 Jan 2021 16:19:53 +0000 (UTC) (envelope-from zeising+freebsd@daemonic.se) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id 4DPZp14d4rz4dkc for ; Mon, 25 Jan 2021 16:19:53 +0000 (UTC) (envelope-from zeising+freebsd@daemonic.se) Received: by mailman.nyi.freebsd.org (Postfix) id 9EBAB4E7F2E; Mon, 25 Jan 2021 16:19:53 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9E6B44E7EC6; Mon, 25 Jan 2021 16:19:53 +0000 (UTC) (envelope-from zeising+freebsd@daemonic.se) Received: from mail.daemonic.se (mail.daemonic.se [IPv6:2607:f740:d:20::25]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPZp13XVDz4dmx; Mon, 25 Jan 2021 16:19:53 +0000 (UTC) (envelope-from zeising+freebsd@daemonic.se) Received: from cid.daemonic.se (localhost [IPv6:::1]) by mail.daemonic.se (Postfix) with ESMTP id 4DPZns5Sgwz3nlt; Mon, 25 Jan 2021 16:19:45 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=daemonic.se; h= content-transfer-encoding:content-language:content-type :content-type:in-reply-to:mime-version:user-agent:date:date :message-id:from:from:references:subject:subject:received :received; s=20151023; t=1611591585; bh=vpKPX9QTOG1Wz9JZxsxPw9rB tAkS6TOGKRiymjIurjg=; b=Z0V1yq59EhIHDBgJLcNb94M6fJ0rY3ffH48HqtMB 2UxTEJuVT7YY0aJexbOhoczEZqlDlcg4+PsdcnXQ5u3ygOTCgNwI0PJBEJwo2xVZ o58+ehlKXXxRkc46teTNvKQK+bPiNkWG9iQMPGedhxDukuGlu5292H3vTedam8J5 eDo= X-Virus-Scanned: amavisd-new at daemonic.se Received: from mail.daemonic.se ([127.0.0.1]) (using TLS with cipher ECDHE-RSA-AES128-GCM-SHA256) by cid.daemonic.se (mailscanner.daemonic.se [127.0.0.1]) (amavisd-new, port 10587) with ESMTPS id UINm75XY6rd2; Mon, 25 Jan 2021 16:19:45 +0000 (UTC) Received: from garnet.daemonic.se (unknown [IPv6:2001:470:dca9:1201:71d7:2ad3:65d3:e5c6]) by mail.daemonic.se (Postfix) with ESMTPSA id 4DPZns0Pm5z3nJp; Mon, 25 Jan 2021 16:19:45 +0000 (UTC) Subject: Re: loading drm crashes system To: Robert Huff , current@freebsd.org, x11@freebsd.org References: <24590.137.690675.515036@jerusalem.litteratus.org> From: Niclas Zeising Message-ID: <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> Date: Mon, 25 Jan 2021 17:19:44 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:68.0) Gecko/20100101 Thunderbird/68.11.0 MIME-Version: 1.0 In-Reply-To: <24590.137.690675.515036@jerusalem.litteratus.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPZp13XVDz4dmx X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; TAGGED_FROM(0.00)[freebsd] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 16:19:53 -0000 On 2021-01-25 00:19, Robert Huff wrote: > > Hello: > On a system now running: > > 14.0-CURRENT FreeBSD 14.0-CURRENT #0 main-d6327ae8c1: Sun Jan 24 > 14:16:54 EST 2021 amd64 > > (src+ports updated at midnight US EST) > with PORTS_MODULES="drm-current-kmod gpu-firmware-kmod", starting > the system _without_ loading drm results in a usable system. > Loading drm - whether via kldlist in rc.conf or by kldload at the > console immediately after start-up - instantly crashes the system; the > screen goes blank and the lights on the monitor report no signal > from the system. [snip error log] > > [insert image of open jaw and glassy-eyed stare] > The GPU is a Radeon HD 3300, and at one point this used to work. > Help, please? > When did it stop working? Which version of drm-current-kmod? Can you try to remove it and build it directly from an updated ports tree, without using PORTS_MODULES=, and see if that helps? Regards -- Niclas From owner-freebsd-current@freebsd.org Mon Jan 25 16:31:17 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 491304E84F4 for ; Mon, 25 Jan 2021 16:31:17 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out2-smtp.messagingengine.com (out2-smtp.messagingengine.com [66.111.4.26]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPb385HGgz4fVb for ; Mon, 25 Jan 2021 16:31:16 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by mailout.nyi.internal (Postfix) with ESMTP id 3A1345C007E for ; Mon, 25 Jan 2021 11:31:16 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute1.internal (MEProxy); Mon, 25 Jan 2021 11:31:16 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:mime-version:content-type; s= fm1; bh=0reuu9cGbYKap/qy8T3kIoQazPcDHHSS1Or1qrJExQA=; b=BQQPTtOo 0jUZ8x/Y9zw4Xg6ItF4MCAK7JKNha2c5HxLXzDh651KMiDEoapgw7k2YCs7Yi5sI nzQ5Ppb1OAcUqzFepdVYglWH8gqNIfxJMBjvptbc+UhKUuZngo+e1Xua6KzahlwU AzbL3BiRygJHvvlpa4jRvg6c397FA4AzGW7PUy76V6t3CmHkDmwS26VjByWMCB9B qiFQFTPJi10LkyJVFm7WNM11KEO0bnsbau59wWSWYOS4WUltAaeuVIONVID6Ev1H d5CoKaNY6MXH233uB/Zeo31DXdOH9FUhLXVghd5nylUz1KEGD9BS+NvP/DL22l8U 0+kF5CjB2UV1iw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-proxy:x-me-proxy:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=0reuu9cGbYKap/qy8T3kIoQazPcDH HSS1Or1qrJExQA=; b=gKUBuUHra/dZytpBh+nRu75i0u5j6ar3zbUDkhnj3a45Z tRUlT5C1BRrIDmA9BacpCjs5HZSZthPNGAtSPKJz7bkHbjmXS2L/lRT5BT0ULaEu Bba1ZeEMI2hspr2snyy7hEBtjIond3/chGOlrAvOtl96uq6vs7Ovl5QYnh/GLK/q G6TyHHebj+Wop3L6wm7yB5ZxWeEp4asAUCzeJWfKMnI1cZg/FOp5UksnG12z/896 UytHszPLEi9vYqlNuqXg19LgJkTGUy9KPr69Sl+Q741ZHRr9l9GRaJOKsxmsr8Mk IQYCfPyiU9cuUKi+siF/qIFSRtkyk/4DB6S6YMq7Q== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefgdekjecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfggtggusehgtderredttd dvnecuhfhrohhmpehtvggthhdqlhhishhtshcuoehtvggthhdqlhhishhtshesiiihgihs thdrnhgvtheqnecuggftrfgrthhtvghrnhepvefghffftdefkeelleehtdejledvhfdvge eijeevfffguddvhfetgeejueejueeinecukfhppeekvddrjedtrdeluddruddtudenucev lhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehtvggthhdqlh hishhtshesiiihgihsthdrnhgvth X-ME-Proxy: Received: from desktop (fws.zyxst.net [82.70.91.101]) by mail.messagingengine.com (Postfix) with ESMTPA id 9A7C7240066 for ; Mon, 25 Jan 2021 11:31:15 -0500 (EST) Date: Mon, 25 Jan 2021 16:31:13 +0000 From: tech-lists To: freebsd-current@freebsd.org Subject: using git to get a particular version of src Message-ID: Mail-Followup-To: freebsd-current@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="2u0UgO2VvRJuTJz9" Content-Disposition: inline X-Rspamd-Queue-Id: 4DPb385HGgz4fVb X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm1 header.b=BQQPTtOo; dkim=pass header.d=messagingengine.com header.s=fm1 header.b=gKUBuUHr; dmarc=none; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.26 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-5.20 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[66.111.4.26:from]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.26]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[66.111.4.26:from]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_IN_DNSWL_LOW(-0.10)[66.111.4.26:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm1,messagingengine.com:s=fm1]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[zyxst.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[66.111.4.26:from:127.0.2.255]; MID_RHS_NOT_FQDN(0.50)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 16:31:17 -0000 --2u0UgO2VvRJuTJz9 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hi, I have this version installed: 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC 2020 I'd like to get the sources for this (want to make a no-debug kernel) as I = know=20 this version works on this hardware.=20 But -current has gone to 14 and what was -current is now 13-stable. What gi= t=20 incantation is required to get 2ed50808d2b-c254384 sources, given an empty= =20 /usr/src and git method of ssh://anongit@git.freebsd.org ? thanks, --=20 J. --2u0UgO2VvRJuTJz9 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAmAO8kUACgkQs8o7QhFz NAVQVxAAg2kCoVH1VNca28ON4frW8N9pG3LlZdEa2qVldxgWJsbdxcpQm4WW9tQY Vw/TDdOqv+hpwXcivInTT1c7Lq1nNHnlAk4Pn8yFujd7BEIgNeQzsyAbRCdDuKma GqKBr8goJtoH7/MROOf4jm6CYxRUl4w+wSypPjo4yPBXcVePCJ2eI+vkmfRZkrxY eghRyqEZSzU6rRpEq9Ny+YPBX1vXNNxvtc6xlYdohrb3at1XCL2c1qyCJzEYJL05 89ENLTHAVwWj3YcRL2GXCsskoz2d2dWUOKCXi1gk22yeYuuOVSMxiSe2k1ycaJTi btDg55mu8HSbEUPC6ENPuhlTCsYoRtvUsh0VGINCCCfUMyhDwELMtWej+dccGE9+ CphT+bOioe8yCSLL05rpmw1PSF6vTs+a9I9J4O+GUEL+wug7WutzL7YxpPARdr0D zQn749kTY2BsFjQMWGoou7KJ90glZIXK+QZ/oGtBXljmRLRAtwKi8Trq9vR4Fog4 CNB/4rCiPXyR8QKLKftF7t9+ruOYSrA2NOlVa7Bm4Mkr4f/YwYPjOPPRe+JVZtPk U03KIZGhCMA+kqUrNjXOIgXBdH69EI5j+JpflAfaTmpYRPbE1R4Vbd6KqdUVkWEf 1Clmr1KkQcP+jzsmR9nLr3bxTvPafwpMhb/9m0vQdIcAhcSk524= =7xVZ -----END PGP SIGNATURE----- --2u0UgO2VvRJuTJz9-- From owner-freebsd-current@freebsd.org Mon Jan 25 16:34:37 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8CC8A4E87E6 for ; Mon, 25 Jan 2021 16:34:37 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out2-smtp.messagingengine.com (out2-smtp.messagingengine.com [66.111.4.26]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPb70635tz4fxP for ; Mon, 25 Jan 2021 16:34:36 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 8F0D75C0184 for ; Mon, 25 Jan 2021 11:34:36 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Mon, 25 Jan 2021 11:34:36 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:references:mime-version :content-type:in-reply-to; s=fm1; bh=cqsp4YsuMs8UEgaeDkKaQpuTv9d aHmRPDcNoFaH2Gg0=; b=uAIyj+0e+A2EaCd6suyWP7lipt+AVFaUAeTNiZDDI4f WaN74G4JV1fnFg/d6i6Ht5sxmWPv8FdhUublen/ScOrmAaRCqQ+uqgiY6kOst12N IFRMgbWeivBe/BOJSeoVE7TNrV+eJ/RcD/3rCcjUnF24oYGsfL5ZMBDTZVumihh5 Ajmkg2jZWclrtn1U8jJRoQX0kFkFhzwYmvHKF1ZmJ2A+JVdFO1TNlaEK+HU9EjAu 8Obg14SM1kQpyvpujgBcvgZwUSx3gt8kQQ0ZMsNmxEqjtPbPoadURxzQSvCygAa8 eGgb+Z0t+sAxFd2vpQfwz4p3OtGPJCHWZp6xk6ha0nQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=cqsp4Y suMs8UEgaeDkKaQpuTv9daHmRPDcNoFaH2Gg0=; b=lukWYs0Ot3IV/Q5HAPchSv V2IwLKN6Fu+sjiamThXha6rdHKesaHADCKfmizpPrH/Cho0Q3qXQW9qL/T5daEZe Xq4EtdVDc2BRN89YPlPplzBlavOakwxkyD5oIB1LJoLkCisbPpTSboaB4TaGM/dY FI7M259LWnQOdEU0pkhOxUIqtWqXzxmU4iYhbcviB5ZlSx54B95ObvH23r0KKpG4 4jU1WEm1GKRQ0mRuKN4nQhHub6Vi3k9Y0EAHw5GQmajMNxLvvtwu8q8MdkJ5yUke 2lY35oEQ+rqsSjHj0C+Qs1W+KhmDAmTIpNSL+iKgR5MHoMl5hDGVQiWcuc2oErGw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefgdekjecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfhfgggtuggjsehgtderre dttddvnecuhfhrohhmpehtvggthhdqlhhishhtshcuoehtvggthhdqlhhishhtshesiiih gihsthdrnhgvtheqnecuggftrfgrthhtvghrnheptdehiefgvddufeekkedvtdefvdettd dtkeduvdegveelffdtkeffudejvdfhudetnecukfhppeekvddrjedtrdeluddruddtuden ucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehtvggthh dqlhhishhtshesiiihgihsthdrnhgvth X-ME-Proxy: Received: from desktop (fws.zyxst.net [82.70.91.101]) by mail.messagingengine.com (Postfix) with ESMTPA id 300CC1080064 for ; Mon, 25 Jan 2021 11:34:36 -0500 (EST) Date: Mon, 25 Jan 2021 16:34:34 +0000 From: tech-lists To: freebsd-current@freebsd.org Subject: Re: using git to get a particular version of src Message-ID: Mail-Followup-To: freebsd-current@freebsd.org References: MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="ar1D/xDrnUegqaVg" Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DPb70635tz4fxP X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm1 header.b=uAIyj+0e; dkim=pass header.d=messagingengine.com header.s=fm1 header.b=lukWYs0O; dmarc=none; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.26 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-5.20 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[66.111.4.26:from]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.26:c]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[66.111.4.26:from]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_IN_DNSWL_LOW(-0.10)[66.111.4.26:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm1,messagingengine.com:s=fm1]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[zyxst.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[66.111.4.26:from:127.0.2.255]; MID_RHS_NOT_FQDN(0.50)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 16:34:37 -0000 --ar1D/xDrnUegqaVg Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Mon, Jan 25, 2021 at 04:31:13PM +0000, tech-lists wrote: >Hi, > >I have this version installed: > >13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC 2020 > >I'd like to get the sources for this (want to make a no-debug kernel) as I= know >this version works on this hardware. > >But -current has gone to 14 and what was -current is now 13-stable. What g= it >incantation is required to get 2ed50808d2b-c254384 sources, given an empty >/usr/src and git method of ssh://anongit@git.freebsd.org ? OOPS sorry seems this exact same q was asked/answered earlier, pls ignore thanks --=20 J. --ar1D/xDrnUegqaVg Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAmAO8xoACgkQs8o7QhFz NAWlXQ/9HQ3VRbpXEp4J9f/ErZaDSFQkXVhJHrkGMC3dqIBSpHqGaH8MFV5nuHj0 dw046RYyLOfhm0EFqkVxUinusGJwA8QGFHH2QOtkBa4YptrjFb3oW3/Q+gMqrYyv iE3dVtzE5F6a5OQ0nQMKSBSJefANiUqB2kM8c5H4VF6Lew8QEqXFHGejqDHaCc0n M9/Va9XA0Cutmn+phbOFX0FsU7ImGx3QBNlLstLtYKB01xv3tNfTDzKb3O+mvkOw vinJk6LHN32j14WPyHWvylXAmkOd4jvlLNUrZfakf0u7KULa5xOefOgLnkj3Z2Ro cqMMFlsKYx6Ggdz+uF69ymY0cdIT9euh07ipPB2KNenGTn29oySNQLYagij3qKlg /LCWhpdwNHsTr9x2gfIcnN+QAxvTYYynuxyUX2Vgd08oJA8OP8xccEximxfnHE1p pcadSrt+kNFARQP400L4Pvx69s2UNMt7FtBGcanFzz5G9cPpz6ohzWIO8kYe39yd i1DIFmLph7ORK1BSHf0zeIfhZVMV4j/VivuwCOFk/QBpsSI92NRJjOkSHS0+a7S0 azd9W2bEuEsF5zfy188L43GWGApoZkkrShEybDSWWUJhS7pSY0yt6wu8ah02IrhQ YYGwdi9Q1NCmRva5LXjUk0eddiY6uZkMD0J2azMEExowCX+HUQo= =C4hV -----END PGP SIGNATURE----- --ar1D/xDrnUegqaVg-- From owner-freebsd-current@freebsd.org Mon Jan 25 17:21:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9E56E4E9BC6 for ; Mon, 25 Jan 2021 17:21:23 +0000 (UTC) (envelope-from bsd-lists@bsdforge.com) Received: from udns.ultimatedns.net (static-24-113-41-81.wavecable.com [24.113.41.81]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "ultimatedns.net", Issuer "Let's Encrypt Authority X3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPc8z14Nyz4jrC for ; Mon, 25 Jan 2021 17:21:22 +0000 (UTC) (envelope-from bsd-lists@bsdforge.com) Received: from ultimatedns.net (localhost [127.0.0.1]) by udns.ultimatedns.net (8.16.1/8.16.1) with ESMTP id 10PHLjwZ011201 for ; Mon, 25 Jan 2021 09:21:51 -0800 (PST) (envelope-from bsd-lists@bsdforge.com) MIME-Version: 1.0 Date: Mon, 25 Jan 2021 09:21:44 -0800 From: Chris To: freebsd-current@freebsd.org Subject: Re: using git to get a particular version of src In-Reply-To: References: User-Agent: UDNSMS/17.0 Message-ID: <77a956396fd05d21ccd23d865fca9c6f@bsdforge.com> X-Sender: bsd-lists@bsdforge.com Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPc8z14Nyz4jrC X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; ASN(0.00)[asn:11404, ipnet:24.113.0.0/16, country:US]; local_wl_ip(0.00)[24.113.41.81] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 17:21:23 -0000 On 2021-01-25 08:31, tech-lists wrote: > Hi, > > I have this version installed: > > 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC 2020 > > I'd like to get the sources for this (want to make a no-debug kernel) as I > know > this version works on this hardware. > > But -current has gone to 14 and what was -current is now 13-stable. What git > incantation is required to get 2ed50808d2b-c254384 sources, given an empty > /usr/src and git method of ssh://anongit@git.freebsd.org ? I am by *no* means a GIT expert but will cd /usr/src git up 2ed50808d2b accomplish your intended task? HTH > > thanks, From owner-freebsd-current@freebsd.org Mon Jan 25 18:11:43 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 87F8C4EB329 for ; Mon, 25 Jan 2021 18:11:43 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPdH24VW9z4nP4 for ; Mon, 25 Jan 2021 18:11:42 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id 272184DCBA for ; Tue, 26 Jan 2021 03:11:38 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611598298; bh=nSv3GxdYnii0Y9K7lLYLjw90gMZboKMMzdgF0F83yPw=; h=Date:To:Subject:From:In-Reply-To:References; b=HA/1P9fIXLnBU1TYFIRPEsM7/vy7gJ3hmTKft2H6HGycZvA82xPz2yjkFASsgbUqU 5HM6fntTQgMZ9t6CaYIpa2Mw5nqv2y6h7YiwfXqCkYQYXHM1NsE75jJ6kqvRCynZ4k VnBZDhFtT7zKT7qTXFV+yR+3lHjMZ7rqg77x8zhKI8F1cUDbkO3h/0x9xdtHBXP8wH vTPfj0qoeSS3I6M7ba9ZfYpkIRAaCekwVTDkyeQNwszl7rBYfJrv2aUKZWhPpNuCx6 8Jxb7wHJeKI/Xu8u/+L8O2SEIN+RKxAkjYoLqeAA4JsL/t/UBen0wMnhnO3G4bbgbm mdQzof5uaWsMw== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 135384E0D3; Tue, 26 Jan 2021 03:11:37 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Tue, 26 Jan 2021 03:11:27 +0900 (JST) Message-Id: <20210126.031127.811432923528445023.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: using git to get a particular version of src From: Yasuhiro Kimura In-Reply-To: <77a956396fd05d21ccd23d865fca9c6f@bsdforge.com> References: <77a956396fd05d21ccd23d865fca9c6f@bsdforge.com> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPdH24VW9z4nP4 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=HA/1P9fI; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [-0.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[utahime.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 18:11:43 -0000 From: Chris Subject: Re: using git to get a particular version of src Date: Mon, 25 Jan 2021 09:21:44 -0800 >> Hi, >> I have this version installed: >> 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC >> 2020 >> I'd like to get the sources for this (want to make a no-debug kernel) >> as I know >> this version works on this hardware. >> But -current has gone to 14 and what was -current is now >> 13-stable. What git >> incantation is required to get 2ed50808d2b-c254384 sources, given an >> empty >> /usr/src and git method of ssh://anongit@git.freebsd.org ? > I am by *no* means a GIT expert > but will > cd /usr/src > git up 2ed50808d2b > accomplish your intended task? Unfortunately it doesn't work as is expected in this case because hashes of src repostory changed on Dec 6 when it was still beta. HEADS UP: src hashes will respin/change this Sunday https://lists.freebsd.org/pipermail/freebsd-git/2020-December/000548.html In original case it was after this change so hash value can be used to checkout it. But this case is befere hash change. So there isn't hash 2ed50808d2b in current src repository any more. I also faced this problem when I tried to checkout source tree that corresponds to 20201119 snapshot of 13-CURRENT. Fortunately I still kept ISO image of it. So I did following steps to get the source tree. 1. Mount the ISO image 2. Extract src.txz in the ISO image to somewhere (e.g. /tmp/usr/src) 3. cd /usr 4. git clone https://git.freebsd.org/src.git 5. cd src 6. Checkout 65c207758a9 that was committed at Thu Nov 19 21:10:36 2020 +0000 (the last one committed on Nov 19, 2020) 7. diff -ru /tmp/usr/src /usr/src 8. If there are any differences, checkout f9fe7b28bc2 that is just previous commit of 65c207758a9 9. Repeat step 7 and 8 until there is no difference between /tmp/usr/src and /usr/src. --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Mon Jan 25 18:55:34 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7B7404EC94A for ; Mon, 25 Jan 2021 18:55:34 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qt1-x82d.google.com (mail-qt1-x82d.google.com [IPv6:2607:f8b0:4864:20::82d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPfFd5Nr1z4rDW for ; Mon, 25 Jan 2021 18:55:33 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qt1-x82d.google.com with SMTP id r9so10436541qtp.11 for ; Mon, 25 Jan 2021 10:55:33 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=E1/LIzk/FMTtNO3VVyCnppti2O59ZyXvetqs52UCV8Q=; b=ELMPibNltGphGOqHwxYtrMsWHzaUioyKo4faEXOySSEEfRNIhagJD6gu5xFMZ4TlHn uhEeYaKLcAo+MyUsbao6z3w/R3ZYSXidy3xnPrd77g5u5MjtVfrZwdnt91gCvS3ZlRq7 k/QOe8lLu3UuVMpLQ0HsSKQ8jxyPm6R4i2mwvDAPl3Qz5SoM7zwN/8v8QErb8jjLkN+L uhnZvvERSMV00BWGEvOBzQgl0l7QVwUAU08xwLpfhutXJY2019D7+ySH1F9xeVYC9XoE g+uwRnEnwltrUPPSk9lJ6e8lhP/ezMdFESwlDH37qjlv845k+gBpybvx+B/txbs1VInG fySw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=E1/LIzk/FMTtNO3VVyCnppti2O59ZyXvetqs52UCV8Q=; b=ktW4IXTTm9YB0wl7KtEGnAwJ2va7PA7rcV/Ezn/VULBn9i9mD/i8ukbcObw7zIFQlo 6fBmj48EBqq+8C7ELwHufvLDvH6/sx0ZuJmT0GNXULfc2QgVJeHRbu0eRCX2mDUuuh4Y 56j/G/YWJsrsBTfULJxoWMq53w2xj9GoS4n5UxKmU/vlEVcoJxn6zSxFTabXi2c5sD+u ySntC6l55SO7eJ7g17oslJWT2ldHaTio6Zp02Xud4cAEB0nCQk/N+qSpPJZ+RkrJdjjr l7kXV6Yb9azLCpc1viYJwFn3SXmpxZg3GcM3QmaVzGjiFe6yl9/heQmcsgTDfbq6tVrA x/hw== X-Gm-Message-State: AOAM531kBZm+aPZsUkGO3HJv1j40D/JlGevunFEjIvl17t9ke+lPBxux FUCWOkDXrv6qK/JcjZNZlEMMrpjYi40clAEChdIIXCzHfMqpC0yt X-Google-Smtp-Source: ABdhPJyAuLW48qMSQPmzxd94maZ8Z1+OTsU7Ax3roorszMuxM2vNzBwVJw3gN8DGPBECDxXCDZt++GMeH5+qYDbk61c= X-Received: by 2002:a05:622a:303:: with SMTP id q3mr1805163qtw.235.1611600932957; Mon, 25 Jan 2021 10:55:32 -0800 (PST) MIME-Version: 1.0 References: <77a956396fd05d21ccd23d865fca9c6f@bsdforge.com> <20210126.031127.811432923528445023.yasu@utahime.org> In-Reply-To: <20210126.031127.811432923528445023.yasu@utahime.org> From: Warner Losh Date: Mon, 25 Jan 2021 11:55:22 -0700 Message-ID: Subject: Re: using git to get a particular version of src To: Yasuhiro Kimura Cc: FreeBSD Current X-Rspamd-Queue-Id: 4DPfFd5Nr1z4rDW X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=ELMPibNl; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::82d) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-3.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::82d:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::82d:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::82d:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 18:55:34 -0000 On Mon, Jan 25, 2021 at 11:11 AM Yasuhiro Kimura wrote: > From: Chris > Subject: Re: using git to get a particular version of src > Date: Mon, 25 Jan 2021 09:21:44 -0800 > > >> Hi, > >> I have this version installed: > >> 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC > >> 2020 > >> I'd like to get the sources for this (want to make a no-debug kernel) > >> as I know > >> this version works on this hardware. > >> But -current has gone to 14 and what was -current is now > >> 13-stable. What git > >> incantation is required to get 2ed50808d2b-c254384 sources, given an > >> empty > >> /usr/src and git method of ssh://anongit@git.freebsd.org ? > > I am by *no* means a GIT expert > > but will > > cd /usr/src > > git up 2ed50808d2b > > accomplish your intended task? > > Unfortunately it doesn't work as is expected in this case because hashes > of src repostory changed on Dec 6 when it was still beta. > > HEADS UP: src hashes will respin/change this Sunday > https://lists.freebsd.org/pipermail/freebsd-git/2020-December/000548.html > > In original case it was after this change so hash value can be used to > checkout it. But this case is befere hash change. So there isn't hash > 2ed50808d2b in current src repository any more. > > I also faced this problem when I tried to checkout source tree that > corresponds to 20201119 snapshot of 13-CURRENT. Fortunately I still > kept ISO image of it. So I did following steps to get the source tree. > > 1. Mount the ISO image > 2. Extract src.txz in the ISO image to somewhere (e.g. /tmp/usr/src) > 3. cd /usr > 4. git clone https://git.freebsd.org/src.git > 5. cd src > 6. Checkout 65c207758a9 that was committed at Thu Nov 19 21:10:36 > 2020 +0000 (the last one committed on Nov 19, 2020) > 7. diff -ru /tmp/usr/src /usr/src > 8. If there are any differences, checkout f9fe7b28bc2 that is just > previous commit of 65c207758a9 > 9. Repeat step 7 and 8 until there is no difference between > /tmp/usr/src and /usr/src. > We should see how hard it would be to convert c254384 into a git hash... So, for me: % git describe vendor/tzdata/tzdata2020f-255971-gfa6662b3689e (so my tip of main is 255971 vs 254384 or +1587) % git log -1 main~1587 commit dda1987fe5dbf418b55195990896b0ef0a5b8e4a Author: Mateusz Piotrowski <0mp@FreeBSD.org> Date: Tue Nov 17 12:04:29 2020 +0000 Add an example for the -s flag which is a little late. If you checked out the source and built it ASAP, then I'd suggest: commit f14436adc61a52b29d035791c0b90c0b221bea9a Author: Hans Petter Selasky Date: Thu Nov 12 09:26:01 2020 +0000 Add a tunable sysctl, hw.usb.uaudio.handle_hid, to allow disabling the the HID volume keys support in the USB audio driver. which is the version just before that. Or if you installed from a snapshot and rebuilt, The 20201112 snapshot was likely built from commit 38033780a3f4ed616d638fc0e9ef9a4d309f1fb3 Author: Kyle Evans Date: Wed Nov 11 22:35:23 2020 +0000 umtx: drop incorrect timespec32 definition Warner From owner-freebsd-current@freebsd.org Mon Jan 25 19:16:58 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EBF964ECC20; Mon, 25 Jan 2021 19:16:58 +0000 (UTC) (envelope-from mj-mailinglist@gmx.de) Received: from mout.gmx.net (mout.gmx.net [212.227.17.20]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPfkL46kqz4sH4; Mon, 25 Jan 2021 19:16:58 +0000 (UTC) (envelope-from mj-mailinglist@gmx.de) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1611602216; bh=BWgfC5n6zl8TiXZdQXoSwdPk0Cl/bR+ESTFpY4OnH+o=; h=X-UI-Sender-Class:From:To:Cc:Subject:Date:In-Reply-To:References; b=kpOGwEh8Mp75RsjkMIeIm/K5Yp8BrcUDm88hpXN/9/PQIKXoUZBRElnEvBeXudT7E I2pATc7cNPqwMvq05UZ2EkjJE66lfcJlM7tCoi8fZdRkFc+47rrfajpEhZBHcZIS5h rpFrRj7Kz0HP2gbWTi59WPzKthXGU7DqFQv3StjE= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from [88.130.78.58] ([88.130.78.58]) by web-mail.gmx.net (3c-app-gmx-bap78.server.lan [172.19.172.136]) (via HTTP); Mon, 25 Jan 2021 20:16:56 +0100 MIME-Version: 1.0 Message-ID: From: mj-mailinglist@gmx.de To: Philip Paeps Cc: freebsd-current@freebsd.org, freebsd-questions@freebsd.org Subject: Re: Re: Files in /usr/share/misc Content-Type: text/plain; charset=UTF-8 Date: Mon, 25 Jan 2021 20:16:56 +0100 Importance: normal Sensitivity: Normal In-Reply-To: <62438B8D-08D3-40D4-829D-B8B23064B0F0@freebsd.org> References: <62438B8D-08D3-40D4-829D-B8B23064B0F0@freebsd.org> X-UI-Message-Type: mail X-Priority: 3 X-Provags-ID: V03:K1:OseJtacxGGr+dMsUKwsBRuCIHZptIB6SqbGP4NiGm0WSHrSfnnVqZ+LwCKGAohi2g+54+ aw5fQTsgpkYjWKFGRCLLipsDGp87WfpWOQM8GZPdeMkfsYpJkU9GX+tj0g2hlToGlqaLKTiMAkp4 mRjZqXsXBdwmh0/bndDdbpESfWi4kHI2XsHxhm8o6LHiu/Ye2Or68kWynSgUcmFTgFekgPUSYkfV oFnb0E/8gX3gtkss06QFQLIA94QzbNL1hJ6Hvz7I3t76tgdt7o6jEIEwgTNtOl00Nd4g3c7s1GnG Pg= X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:Vxs0TMQxjnM=:jpBuCvZHWsYrUaGeeYrOrc 4o8PGg2RWpPA86OPYGfhqtl7HhPLIPWdOGIcliGcJ1RqylzIc2YtMpVgLXtZOWU1ZLlEEWli6 sWTPhGsFN2Bn8o+tA+avPnsW30rKlug0endLKx7usCNtK4s5lkRgyxppJMYoSuUxv2xjWPqra pN696WZC2wGr6Jah8gGAT5mwBB/yPpxZ15Ihm6O3BTKVFNnRizM9GBjkmzUsYG6UcgXF/T7bn 0JYjNd+Eypge3MPLGF7DNv5wkvWvBQqzyjyUVrf5bkveWXgW2XLoydnCmoS3ZGksFAa0ChGpL h0t8jwfJTjE1DkHHCTa31RsTQvL7rcwt1D2LGIXCvz797T/Wrf0ZGX6TjqUhqV8mFf8AKOoJ1 9yjNKCSGP/wsZFifzjr3x1II3DTdaETXrlYGnDWShiVsKQI/TtrCtD9xB0fjoPg68i/BZDYL7 HIRgsi2xIww9LGYo+sV0pwEMyIPjhu6kMgqh/pK9REN1O00DQIohm8JtRPPR8UGq09q4S+ulr n/6L8onb8REhD2E6Id6gw13R+reGgHLkaxL+R3+gE6i0WHJzeoFpeXuwInnKCJtXVQ3cX3ioI gjlNLSanccjRI= X-Rspamd-Queue-Id: 4DPfkL46kqz4sH4 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:16:59 -0000 Thank you all for the input. So, this directory is a little bit like the bottom drawer on my desk, where i put things, i don't know where to put else :) the hier man page states: misc/ miscellaneous system-wide ASCII text files About half of the files are ASCII text, according to the file command. The others are UTF-8, ISO-8859 or even binary. There seems a little bit of divergence from the "text" :) -- Martin From owner-freebsd-current@freebsd.org Mon Jan 25 19:31:22 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4B1B04ED9E3 for ; Mon, 25 Jan 2021 19:31:22 +0000 (UTC) (envelope-from imb@protected-networks.net) Received: from mail.protected-networks.net (mail.protected-networks.net [IPv6:2001:470:8d59:1::8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mail.protected-networks.net", Issuer "R3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPg2x2Wl9z4tmk for ; Mon, 25 Jan 2021 19:31:20 +0000 (UTC) (envelope-from imb@protected-networks.net) Received: from toshi.auburn.protected-networks.net (toshi.auburn.protected-networks.net [192.168.1.10]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: imb@mail.protected-networks.net) by mail.protected-networks.net (Postfix) with ESMTPSA id A50DE458EA for ; Mon, 25 Jan 2021 14:31:12 -0500 (EST) To: freebsd-current From: Michael Butler Subject: ZFS feature compatibility? Message-ID: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> Date: Mon, 25 Jan 2021 14:31:12 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 Content-Type: text/plain; charset=windows-1252; format=flowed Content-Language: en-NZ Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPg2x2Wl9z4tmk X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[protected-networks.net:s=201508]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:470:8d59:1::8:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2001:470:8d59:1::8:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[protected-networks.net:+]; DMARC_POLICY_ALLOW(-0.50)[protected-networks.net,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:6939, ipnet:2001:470::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:31:22 -0000 I have a few machines on which I've been hesitant to run 'zpool upgrade' as I'm not sure of the (boot?) implications. They report like this .. imb@toshi:/home/imb> uname -a FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/TOSHI amd64 imb@toshi:/home/imb> zpool status pool: zroot state: ONLINE status: Some supported features are not enabled on the pool. The pool can still be used, but some features are unavailable. action: Enable all features using 'zpool upgrade'. Once this is done, the pool may no longer be accessible by software that does not support the features. See zpool-features(5) for details. Is it safe to upgrade the root pool? imb From owner-freebsd-current@freebsd.org Mon Jan 25 19:35:13 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A9E784EDEC1 for ; Mon, 25 Jan 2021 19:35:13 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qv1-xf36.google.com (mail-qv1-xf36.google.com [IPv6:2607:f8b0:4864:20::f36]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPg7N5Rmzz4vCy for ; Mon, 25 Jan 2021 19:35:12 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qv1-xf36.google.com with SMTP id dj6so6757423qvb.1 for ; Mon, 25 Jan 2021 11:35:12 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=1XU2u8snvX66Kkrdw4JwURUq4We/L+KZZwb1GsmYj3k=; b=XwJvKwkaLRf1ZAEPqo10OOY5aiQwP8pH//25yBVfU6G6QkvTFwNEtVYDstofLohtYk fbbOUvrb8GFp5XAQsDLYiQFSX+owjwdaaLsVWQxKF8sM1wE0ffIMYPEY2Xou9c3/V1UW 0ilwDIe/AyRDUz1tjouPRqV4LmrtjKejuokydQmfuAcehhJ+wkn7faue2YBBQxO9uRcB 9pVKFDK/+YZ/WcJz3CJq3We3zg0t0gflczueAUDLXK0rdq3DLFYdGZk4QTAUYTEmoPTE +qpEJLuB9URS+FVWiV+5ZLX3VFmNU9lpPRHY47EUTBEiH4tK5IbKUxbQ1bCmCuotAk2N fc0A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=1XU2u8snvX66Kkrdw4JwURUq4We/L+KZZwb1GsmYj3k=; b=pQTa2MKj7TraJoPYp2h4/LWRiEbQLX8MNllOZyGcbwzjgN+vMVD6QcHNwklzHnSXRu V4ieey75ffN9yWBju2NDR5wH3orGwjQQKm3sRvtfyRkVjWDIYgnB4M5VXCuDHzXbgLZV l1294wn9/TKZTTHjBCXyHTamuEEEwemXnevtw7BnqJ30pNNcedZJPXQv5lAx399xSKYY ItC5gjb1nYj5dm6O5KVME9HtkYWqeZ/5uhz4+ENffVqfolQxemeU32P+8OXojiiMzQm8 0F+agU77chbyBd3DHqp3ELeSfjlkx4grXCajzxjN56oEYU2aXZRLoypI44ZUYuNNeN9t S4aQ== X-Gm-Message-State: AOAM530WDyHij4YDb6Pjv+PiCHq2EYVhvAWxN9c4iG7jiJoF8AGBw0o5 gIpjwyujMFe6AKI3nNX5jD0XiB6whexWWkZkNUcxuQ== X-Google-Smtp-Source: ABdhPJwTNHBezUm7+xLN7S3HotTRSk57jZ1TlGcH0EctzXTiSDEfhYTgHeXzqsDW9mVIwt6uKB6AndUbLCXGoEn0Vho= X-Received: by 2002:a0c:80ca:: with SMTP id 68mr2303573qvb.28.1611603311982; Mon, 25 Jan 2021 11:35:11 -0800 (PST) MIME-Version: 1.0 References: <77a956396fd05d21ccd23d865fca9c6f@bsdforge.com> <20210126.031127.811432923528445023.yasu@utahime.org> In-Reply-To: From: Warner Losh Date: Mon, 25 Jan 2021 12:35:00 -0700 Message-ID: Subject: Re: using git to get a particular version of src To: Yasuhiro Kimura Cc: FreeBSD Current X-Rspamd-Queue-Id: 4DPg7N5Rmzz4vCy X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=XwJvKwka; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::f36) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-3.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f36:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f36:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f36:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:35:13 -0000 On Mon, Jan 25, 2021 at 11:55 AM Warner Losh wrote: > > > On Mon, Jan 25, 2021 at 11:11 AM Yasuhiro Kimura wrote: > >> From: Chris >> Subject: Re: using git to get a particular version of src >> Date: Mon, 25 Jan 2021 09:21:44 -0800 >> >> >> Hi, >> >> I have this version installed: >> >> 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC >> >> 2020 >> >> I'd like to get the sources for this (want to make a no-debug kernel) >> >> as I know >> >> this version works on this hardware. >> >> But -current has gone to 14 and what was -current is now >> >> 13-stable. What git >> >> incantation is required to get 2ed50808d2b-c254384 sources, given an >> >> empty >> >> /usr/src and git method of ssh://anongit@git.freebsd.org ? >> > I am by *no* means a GIT expert >> > but will >> > cd /usr/src >> > git up 2ed50808d2b >> > accomplish your intended task? >> >> Unfortunately it doesn't work as is expected in this case because hashes >> of src repostory changed on Dec 6 when it was still beta. >> >> HEADS UP: src hashes will respin/change this Sunday >> https://lists.freebsd.org/pipermail/freebsd-git/2020-December/000548.html >> >> In original case it was after this change so hash value can be used to >> checkout it. But this case is befere hash change. So there isn't hash >> 2ed50808d2b in current src repository any more. >> >> I also faced this problem when I tried to checkout source tree that >> corresponds to 20201119 snapshot of 13-CURRENT. Fortunately I still >> kept ISO image of it. So I did following steps to get the source tree. >> >> 1. Mount the ISO image >> 2. Extract src.txz in the ISO image to somewhere (e.g. /tmp/usr/src) >> 3. cd /usr >> 4. git clone https://git.freebsd.org/src.git >> 5. cd src >> 6. Checkout 65c207758a9 that was committed at Thu Nov 19 21:10:36 >> 2020 +0000 (the last one committed on Nov 19, 2020) >> 7. diff -ru /tmp/usr/src /usr/src >> 8. If there are any differences, checkout f9fe7b28bc2 that is just >> previous commit of 65c207758a9 >> 9. Repeat step 7 and 8 until there is no difference between >> /tmp/usr/src and /usr/src. >> > > We should see how hard it would be to convert c254384 into a git hash... > > So, for me: > > % git describe > vendor/tzdata/tzdata2020f-255971-gfa6662b3689e (so my tip of main is > 255971 vs 254384 or +1587) > % git log -1 main~1587 > commit dda1987fe5dbf418b55195990896b0ef0a5b8e4a > Author: Mateusz Piotrowski <0mp@FreeBSD.org> > Date: Tue Nov 17 12:04:29 2020 +0000 > > Add an example for the -s flag > > which is a little late. If you checked out the source and built it ASAP, > then I'd suggest: > > commit f14436adc61a52b29d035791c0b90c0b221bea9a > Author: Hans Petter Selasky > Date: Thu Nov 12 09:26:01 2020 +0000 > > Add a tunable sysctl, hw.usb.uaudio.handle_hid, to allow disabling the > the HID volume keys support in the USB audio driver. > > which is the version just before that. Or if you installed from a snapshot > and rebuilt, The 20201112 snapshot was likely built from > > commit 38033780a3f4ed616d638fc0e9ef9a4d309f1fb3 > Author: Kyle Evans > Date: Wed Nov 11 22:35:23 2020 +0000 > > umtx: drop incorrect timespec32 definition > Oh! git describe is the wrong thing. We're using git rev-list --count, so: % git rev-list --count main 256115 % echo $((256115-254384) 1731 % git log -1 main~1731 git log -1 main~1731 commit 94275e3e698b223ccc42e3a637b6667216ca6360 Author: Mateusz Guzik Date: Tue Nov 10 01:31:06 2020 +0000 threads: remove the unused TID_BUFFER_SIZE macro But, there's a problem, or a disconnect. git rev-list counts both the commits on main, and the number of commits for merge commits that are on the second parent back to the last common ancestor. this is surprising behavior, and we'll likely change it, but for systems before the change you need to do some searching: % git rev-list --count main~1731 254360 % git rev-list --count main~1707 254384 So this is the one you really want: commit 26007fe37c06fe0b61634083befb7f9eb87c08c0 Author: Mateusz Guzik Date: Wed Nov 11 08:51:04 2020 +0000 thread: add more fine-grained tidhash locking (that's assuming the commit counts from before the re-hashing were identical, which I have no way of knowing or testing). The truth is, though, any of these will likely be 'good enough' to have a working system. Warner From owner-freebsd-current@freebsd.org Mon Jan 25 19:37:06 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3E5934EE283 for ; Mon, 25 Jan 2021 19:37:06 +0000 (UTC) (envelope-from jhb@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPg9Z1Lvcz4vQ7; Mon, 25 Jan 2021 19:37:06 +0000 (UTC) (envelope-from jhb@FreeBSD.org) Received: from John-Baldwins-MacBook-Pro.local (unknown [IPv6:2601:648:8681:1cb0:5c12:2e91:6a1e:30bf]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) (Authenticated sender: jhb) by smtp.freebsd.org (Postfix) with ESMTPSA id BA3A617AC; Mon, 25 Jan 2021 19:37:05 +0000 (UTC) (envelope-from jhb@FreeBSD.org) Subject: Re: service -e doesn't really sort does it? the cool tip is slightly off To: Dennis Clarke References: Cc: Current FreeBSD , lme@FreeBSD.org From: John Baldwin Message-ID: Date: Mon, 25 Jan 2021 11:37:04 -0800 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.14; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:37:06 -0000 On 1/16/21 3:28 PM, Dennis Clarke wrote: > root@rhea:/usr/src/freebsd-src # diff -u > usr.bin/fortune/datfiles/freebsd-tips.orig > usr.bin/fortune/datfiles/freebsd-tips > --- usr.bin/fortune/datfiles/freebsd-tips.orig 2021-01-15 > 00:37:37.863506000 +0000 > +++ usr.bin/fortune/datfiles/freebsd-tips 2021-01-16 > 07:46:57.335803000 +0000 > @@ -517,7 +517,7 @@ > > -- Lars Engels > % > -If you want to get a sorted list of all services that are started when > FreeBSD boots, > +If you want to get a list of all services that are started when FreeBSD > boots, > enter "service -e". > > -- Lars Engels > root@rhea:/usr/src/freebsd-src # > > Sorry for being all OCD here. Perhaps it should say sorted in the order > in which they were started. Something like that. I think the "sorted" detail is relevant, but describing the key (how it is sorted) is certainly a missing detail, maybe: If you want to get a list of all services started when FreeBSD boots in the order they are started, enter "service-e". ? -- John Baldwin From owner-freebsd-current@freebsd.org Mon Jan 25 19:37:22 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 46D244EE28C for ; Mon, 25 Jan 2021 19:37:22 +0000 (UTC) (envelope-from tsoome@me.com) Received: from st43p00im-ztfb10061701.me.com (st43p00im-ztfb10061701.me.com [17.58.63.172]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPg9s3QxSz4vN7 for ; Mon, 25 Jan 2021 19:37:21 +0000 (UTC) (envelope-from tsoome@me.com) Received: from nazgul.lan (148-52-235-80.sta.estpak.ee [80.235.52.148]) by st43p00im-ztfb10061701.me.com (Postfix) with ESMTPSA id C3A91AC0573; Mon, 25 Jan 2021 19:37:18 +0000 (UTC) Content-Type: text/plain; charset=us-ascii Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: ZFS feature compatibility? From: Toomas Soome In-Reply-To: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> Date: Mon, 25 Jan 2021 21:37:16 +0200 Cc: freebsd-current Content-Transfer-Encoding: quoted-printable Message-Id: References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> To: Michael Butler X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-25_08:2021-01-25, 2021-01-25 signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 malwarescore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1011 mlxscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-2006250000 definitions=main-2101250101 X-Rspamd-Queue-Id: 4DPg9s3QxSz4vN7 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[17.58.63.172:from]; FREEMAIL_FROM(0.00)[me.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:17.58.0.0/16]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[me.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[me.com,quarantine]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[me.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[17.58.63.172:from]; DWL_DNSWL_NONE(0.00)[me.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[me.com:s=1a1hai]; FREEFALL_USER(0.00)[tsoome]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:714, ipnet:17.58.63.0/24, country:US]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[17.58.63.172:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[80.235.52.148:received]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[17.58.63.172:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:37:22 -0000 > On 25. Jan 2021, at 21:31, Michael Butler via freebsd-current = wrote: >=20 > I have a few machines on which I've been hesitant to run 'zpool = upgrade' as I'm not sure of the (boot?) implications. They report like = this .. >=20 > imb@toshi:/home/imb> uname -a > FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD = 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 = root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/= TOSHI amd64 >=20 > imb@toshi:/home/imb> zpool status > pool: zroot > state: ONLINE > status: Some supported features are not enabled on the pool. The pool = can > still be used, but some features are unavailable. > action: Enable all features using 'zpool upgrade'. Once this is done, > the pool may no longer be accessible by software that does not = support > the features. See zpool-features(5) for details. >=20 > Is it safe to upgrade the root pool? >=20 > imb We can not boot from encrypted pool and draid. Rest is all ok. Please = note, you may need to update the bootblocks. rgds, toomas From owner-freebsd-current@freebsd.org Mon Jan 25 19:38:10 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B165C4EE373 for ; Mon, 25 Jan 2021 19:38:10 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qt1-x834.google.com (mail-qt1-x834.google.com [IPv6:2607:f8b0:4864:20::834]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPgBn75Fpz4vd0 for ; Mon, 25 Jan 2021 19:38:09 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qt1-x834.google.com with SMTP id e17so10572841qto.3 for ; Mon, 25 Jan 2021 11:38:09 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=KPuCNxTPaewHimkzYqXT5A00iLcjglCDlxjc4w5jGWY=; b=vktH0m7YI3Ty5hbEz4rkv4G0ikhcT2SBExnkUsILZxmq1xpS8IIrLm3Ik3WiC10HQW jiku8OTgMZGtSM4zq59Swg1M9UO2UfCaHhCrZgIC15vU7qVFNIWmxlerlBvP29avuJ8J 9z6dfK6M55sPRYc4J95u7iKSVu++8tVpaBg0wM4Qj0rC4nIGWvlS/6sj7bBI8wo0sBKV TTaBXC3LOpv9Q8fVRidlT2KF2/n7Lr+Jn5SGccDnOzgkEKgNWJF0dR8t7+jfx1hJuZGj FmnAC3oFZfIHwXfpvVE1YOp7BVBHegyPrIPUjaELj2kOmyMcIufNbLjDMIn1U+4pevam T7jw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=KPuCNxTPaewHimkzYqXT5A00iLcjglCDlxjc4w5jGWY=; b=O4HdbwEUaw0Ia4anlaO9IB5cocotNDePWKcskF3q2Lqu6mgwIXduak52fEXbTAZefu WeVUBHtHan+LJRRZOqhJrssq+HUewVdM3MGeZrp6KKNMCNDzojnNt+IKxUfHFrK5h5lS IrK3wLohHQsjARPJgNfqkee0D6ABwT48CAIirL7Nx47Bf8ZK966SyTPa+bqMN4PcWZpK L4IJTegPQFNBaXmgrFVBLwJ2kCHLhfYgYsGce7dFrtwL6asNSKBFuRyDiUr+niblLAWS 2yj9E5nE02YBsRQb1IDuoj6LZKMkFK66CjdoYZeNxjVQ6QNuOySz2+rU4OtTdO8Sjeda lUxw== X-Gm-Message-State: AOAM530cv3BWe9rsIiEhvcvP1YffRk3Ex0IQ7QF6qeuikxQ4N/gcSLF3 1WTwMxlS8AU2oCcboHBj7igLhPFQz7SrS7lJS1VaOTL4NOl2uw== X-Google-Smtp-Source: ABdhPJzRaqmRLMCjqxF+lRbWwbXi+uN28o38eABKQP00S/WEmGGtycvzvOFyuyH4ekX6gI+NqBPBg8SQ5nhWDn5lxpQ= X-Received: by 2002:a05:622a:1c9:: with SMTP id t9mr2046791qtw.244.1611603489195; Mon, 25 Jan 2021 11:38:09 -0800 (PST) MIME-Version: 1.0 References: <77a956396fd05d21ccd23d865fca9c6f@bsdforge.com> <20210126.031127.811432923528445023.yasu@utahime.org> In-Reply-To: From: Warner Losh Date: Mon, 25 Jan 2021 12:37:58 -0700 Message-ID: Subject: Re: using git to get a particular version of src To: Yasuhiro Kimura Cc: FreeBSD Current X-Rspamd-Queue-Id: 4DPgBn75Fpz4vd0 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=vktH0m7Y; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::834) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [-3.00 / 15.00]; ARC_NA(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::834:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::834:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::834:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:38:10 -0000 On Mon, Jan 25, 2021 at 12:35 PM Warner Losh wrote: > > > On Mon, Jan 25, 2021 at 11:55 AM Warner Losh wrote: > >> >> >> On Mon, Jan 25, 2021 at 11:11 AM Yasuhiro Kimura >> wrote: >> >>> From: Chris >>> Subject: Re: using git to get a particular version of src >>> Date: Mon, 25 Jan 2021 09:21:44 -0800 >>> >>> >> Hi, >>> >> I have this version installed: >>> >> 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC >>> >> 2020 >>> >> I'd like to get the sources for this (want to make a no-debug kernel) >>> >> as I know >>> >> this version works on this hardware. >>> >> But -current has gone to 14 and what was -current is now >>> >> 13-stable. What git >>> >> incantation is required to get 2ed50808d2b-c254384 sources, given an >>> >> empty >>> >> /usr/src and git method of ssh://anongit@git.freebsd.org ? >>> > I am by *no* means a GIT expert >>> > but will >>> > cd /usr/src >>> > git up 2ed50808d2b >>> > accomplish your intended task? >>> >>> Unfortunately it doesn't work as is expected in this case because hashes >>> of src repostory changed on Dec 6 when it was still beta. >>> >>> HEADS UP: src hashes will respin/change this Sunday >>> https://lists.freebsd.org/pipermail/freebsd-git/2020-December/000548.html >>> >>> In original case it was after this change so hash value can be used to >>> checkout it. But this case is befere hash change. So there isn't hash >>> 2ed50808d2b in current src repository any more. >>> >>> I also faced this problem when I tried to checkout source tree that >>> corresponds to 20201119 snapshot of 13-CURRENT. Fortunately I still >>> kept ISO image of it. So I did following steps to get the source tree. >>> >>> 1. Mount the ISO image >>> 2. Extract src.txz in the ISO image to somewhere (e.g. /tmp/usr/src) >>> 3. cd /usr >>> 4. git clone https://git.freebsd.org/src.git >>> 5. cd src >>> 6. Checkout 65c207758a9 that was committed at Thu Nov 19 21:10:36 >>> 2020 +0000 (the last one committed on Nov 19, 2020) >>> 7. diff -ru /tmp/usr/src /usr/src >>> 8. If there are any differences, checkout f9fe7b28bc2 that is just >>> previous commit of 65c207758a9 >>> 9. Repeat step 7 and 8 until there is no difference between >>> /tmp/usr/src and /usr/src. >>> >> >> We should see how hard it would be to convert c254384 into a git hash... >> >> So, for me: >> >> % git describe >> vendor/tzdata/tzdata2020f-255971-gfa6662b3689e (so my tip of main is >> 255971 vs 254384 or +1587) >> % git log -1 main~1587 >> commit dda1987fe5dbf418b55195990896b0ef0a5b8e4a >> Author: Mateusz Piotrowski <0mp@FreeBSD.org> >> Date: Tue Nov 17 12:04:29 2020 +0000 >> >> Add an example for the -s flag >> >> which is a little late. If you checked out the source and built it ASAP, >> then I'd suggest: >> >> commit f14436adc61a52b29d035791c0b90c0b221bea9a >> Author: Hans Petter Selasky >> Date: Thu Nov 12 09:26:01 2020 +0000 >> >> Add a tunable sysctl, hw.usb.uaudio.handle_hid, to allow disabling the >> the HID volume keys support in the USB audio driver. >> >> which is the version just before that. Or if you installed from a >> snapshot and rebuilt, The 20201112 snapshot was likely built from >> >> commit 38033780a3f4ed616d638fc0e9ef9a4d309f1fb3 >> Author: Kyle Evans >> Date: Wed Nov 11 22:35:23 2020 +0000 >> >> umtx: drop incorrect timespec32 definition >> > > Oh! git describe is the wrong thing. We're using git rev-list --count, so: > > % git rev-list --count main > 256115 > % echo $((256115-254384) > 1731 > % git log -1 main~1731 > git log -1 main~1731 > commit 94275e3e698b223ccc42e3a637b6667216ca6360 > Author: Mateusz Guzik > Date: Tue Nov 10 01:31:06 2020 +0000 > > threads: remove the unused TID_BUFFER_SIZE macro > > But, there's a problem, or a disconnect. git rev-list counts both the > commits on main, and the number of commits for merge commits that are on > the second parent back to the last common ancestor. this is surprising > behavior, and we'll likely change it, but for systems before the change you > need to do some searching: > > % git rev-list --count main~1731 > 254360 > % git rev-list --count main~1707 > 254384 > > So this is the one you really want: > > commit 26007fe37c06fe0b61634083befb7f9eb87c08c0 > Author: Mateusz Guzik > Date: Wed Nov 11 08:51:04 2020 +0000 > > thread: add more fine-grained tidhash locking > > (that's assuming the commit counts from before the re-hashing were > identical, which I have no way of knowing or testing). > > The truth is, though, any of these will likely be 'good enough' to have a > working system. > P.S. Due to this mismatch, I'm going to propose we move to git rev-list --first-parent --count Warner From owner-freebsd-current@freebsd.org Mon Jan 25 19:47:02 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 026CF4EF0E1 for ; Mon, 25 Jan 2021 19:47:02 +0000 (UTC) (envelope-from bergerkos@yahoo.co.uk) Received: from sonic309-25.consmr.mail.ir2.yahoo.com (sonic309-25.consmr.mail.ir2.yahoo.com [77.238.179.83]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPgP01ZfFz3DKy for ; Mon, 25 Jan 2021 19:46:59 +0000 (UTC) (envelope-from bergerkos@yahoo.co.uk) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611604017; bh=iOG34wuoS8ZvA7vVrvpMXqqG+BIGF5fQIw4Gr0p89s0=; h=Date:From:To:Subject:From:Subject:Reply-To; b=JcUnNgq7vXv4cBb0n1coOEmVhsRu/v1oC1I0lidXs6REd+PZMaohjF+plArVL6QtEtMUaALXGxmFGQx8yrpcPYuM55ea/CGjW2tJpKxT9hEqLHVYWEt4cdR8NtqEwkEfsjnY+6Qnn05DPNTsqzfsTvGiDKOFYiLDujqduvCO757Gz8D477xsgfTLxcZnp7rnVGmlN3elehCvq1NosSMzwNlqT7pSbROosRpvKEku5uK+jsBIV8q++QBJdn5sTrzTG0vSHhZdduV2k4xxFX0pRjVIeAFr1Xt7PX3FTelkePNDqyB0IrTy0bPrlCCtxFo4uBd2OCD1NbfbTyD0KXa0+A== X-YMail-OSG: gIKhbeEVM1l49IQqGTUa59qG742N48MzEaqqc4X1F2xv68pcyRTbeNdndDhEyNR vD20tuXOeZOGgiqGo6dvVJs6Be5c6yHKc.4KQdaCTwBpzD1jKubzWIlHUQEBkScqAaPxupSzP6PX nTlE2iWB6x_IQ7Nq68WSZKInV6PjaYCY9I7aoAlKD24aczsDU2UoECiBhRyLL6d4bY0dJ3ndKo2T ucqKTn8rAjp3OTtKtknXq5wxV.SfsxE8oUF9PJLQcwsR9wpzu9R6YHEIioIwZTMzWlNoXRqC2IhK n0q53fSJJqqBdeiNuD2.E7ZrsNLI2t1gJ.8ZwinOregS36O75OBEgz2PfqTFR6AEBFIS.2ZhBvKE VZKsQEpLvNtENfvULcrmr84I2YrQfO1kDyrgyTbzpAALdzhxojIzifB6X7GLFuKk9IEhAFAX6Unv u7ICJsvIkhSl0_i4jTuYR6g6rvE4YoCoxc6GAGKOiEXvktV9wCN0tB7HQVTzJs9IcpX9V.zb94hY DEgOeXNMgQNKSRgWNCWAVr4ZJrS4V.BlmyH94F6pjQNErqf.pBjvdFL5IlSlAq4B.kG1q_fcZDOl Saz2ojtFbsokfwlMOFKcPHSLCLyMvYUWc82au94DkZxc8VGm7rajqsP4tAPDZ368cdFyWwsR8JNB QKczJGIkxwfD7CMyfOFfKyxsYpbAuB9EI9BN5T0lkqaPDRstbn8Zp1mktpOPPf02yP2oCLBbOlxj Z751J.gt8h9mOqnZQXAwQibwikNOyjkJ4KxNC9ckDJgXxwig1toGkPxSN67VjDIcocZUIMCNGUtS 5jV2ILrUoVWmN4JYO_qc1XtwNgGZAkrNRpx7Oz0.H2lm.HNPAd1WnJvgJLgjYV6jm73hszPeg__f bEHph9WHLcv7h0jNpPtIKJuKed9ULmX9.4DyziAPo1H0GrqNphz9WCvV.2PDWMQJvwedQpE4bgTY 21Pq5jXQRO6yGk7FPsJiORPW_HNo3dEC0yBL058Jgybaaufquz9dFTYT89dTXF.ttdvC7RcJ9MGn pVEsElB1ln1DXTVBfu4nvayeGFW0pMP_2aNR0esZJgIuXUGnWbbFdJSPsGv4poe29OC1XIYVgkHj bohW4wGRyZdSlL4p.g9IBAU89H0kO5R5UE2N.LgkluUizfwNEQVLF94B5fCtP3nK0d35vEMMR8kh rxavkRGQdr1M5ZAFSkl.Hgj3FJa6quvnQNJIWZWSpHAkUrlWtwU5wmo9ZOB.R9rwcwXPHRKvvkZN GTBZNYc3vuOSB8bd8RWR1TLIcOescnsdvqTgzHBtFtP2AhVGI602P_zed6BBBRmlqZDfrlezCxWi H0BTek.OtLatVERHalkBaNp48VnAgMe1zFxbkPrmA.ReJNWItjHakdlW1e8okkCBl0dEJmSM92dt fLoSJhzcY4NtolMoqRLrCXO37RuHqUqACBeb.2VViEmZFJq7MKkEZ6vnxjf9.a2LqlhLDYiWdJFQ 1qUepWkxI.LMi6tVjcf9FES1UHPYw7eO4GUmnNRm3X_ximOwGtpONc40OulGUszvQ5tz4zGTRy9P 9JvfeoKtHo1YMx79kFQkZSx3UMgj92zux67tjpMWfR1zCUddrEqwvEB9lOH_AixgB8JXcJFt284p 8neC9598eKB2pfOPtwK.OSucW3rejr9sgwNKlFg7kr5k8fKNVqnXxFSzMLHw_HyAlQM86ZEeR0Do hYT5Sg1QtB3Af5jKtuv4BtShe04QrBKEQV2DPpFNQsQiQU..0dm5AkV1ZRzYuA30lMKLfqQu3x4c KpcfWjavB.NXTwMRyFo2Y9qkV6kZ.6Ju8fgrN.CwxKPjP1BOmMPF6m6Ke3HxdmtyDTWhHFla4OH1 0b4.0t66jAcbL7h7_HDMmbkjw9wD4Z13D5x1nr1aZwCO8pD9xfq3FGvBHLWfUypEr5rAz5I4dbtF xOjI2hcJ4LOzhOwh2RIsHXPyKvmqUYjbF_A96.m4kaxiwN2OHF31Flp3GSwG5bZrM__JrxDBiT3r lRLrXjSDUFQT0NKfLr81R84v9VkID.lz.OM8xNeAXGd0POwtQkbVb7EDLYpeG_dVouyeDPXjVW2q QJAMEOTcm6BQmQSzC7I3pKvxy5aKjqaoyoJpXxOoTpfHi.dKMuWEoggUMHLDxBnfb8NdmP49Dpiv qhfAJow8QesO58MHXcypWMWoLBe4vtE6.XSKDcOvySzupkttLvhzfcYYCo_kQ2k07OvPiM7kiBwn jYJJa0uZ83pskKNHBnL9apzL0AJXe_8YkmL9gCqd0FbAyyjnx0vYmlRofUh6fomwcadp5AgkM1Jw .h4sI4858Gp6O5JYwWk.hWV2Mfq5OyRAAidGFs.IHuWSSa5.dATfwLGxjbQhaYTiiJVztW09I5wj 2wSeB7E71upLcIqVTVp8hnFEXI_C8d_NC7er7vULe5prsG.FcxRjZQFraWF6nxEjv4.vjllTCMQ- - Received: from sonic.gate.mail.ne1.yahoo.com by sonic309.consmr.mail.ir2.yahoo.com with HTTP; Mon, 25 Jan 2021 19:46:57 +0000 Date: Mon, 25 Jan 2021 19:46:54 +0000 (UTC) From: Kostya Berger To: FreeBSD Current Message-ID: <985070144.9595325.1611604014395@mail.yahoo.com> In-Reply-To: <1384574721.390368.1611500021710@mail.yahoo.com> References: <992972141.8836030.1611441657314.ref@mail.yahoo.com> <992972141.8836030.1611441657314@mail.yahoo.com> <1384574721.390368.1611500021710@mail.yahoo.com> Subject: Re: 13-alpha2 libncurses removal breaks ports build MIME-Version: 1.0 X-Mailer: WebService/1.1.17501 YMailNorrin Mozilla/5.0 (X11; FreeBSD amd64; rv:85.0) Gecko/20100101 Firefox/85.0 X-Rspamd-Queue-Id: 4DPgP01ZfFz3DKy X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[77.238.179.83:from]; R_DKIM_ALLOW(-0.20)[yahoo.co.uk:s=s2048]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; FREEMAIL_FROM(0.00)[yahoo.co.uk]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[77.238.179.83:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.co.uk:+]; DMARC_POLICY_ALLOW(-0.50)[yahoo.co.uk,reject]; RCVD_IN_DNSWL_NONE(0.00)[77.238.179.83:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[yahoo.co.uk]; ASN(0.00)[asn:34010, ipnet:77.238.176.0/22, country:GB]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current]; RWL_MAILSPIKE_POSSIBLE(0.00)[77.238.179.83:from] Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:47:02 -0000 Builds OK from inside clean install. Which is all I needed this far. Thank = you. With kindest regards, Kostya Berger =20 =20 On Sunday, 24 January 2021, 17:53:41 GMT+3, Kostya Berger wrote: =20 =20 OK, building ports against a clean installation of 13.0-ALPHA2 has no prob= lem with ncurses.=20 But devel/glib20 fails for no obvious reason closer to the end of building = process... I just wonder: do I need to report this to port maintainers or w= ait till it settles up=C2=A0 somehow? A good deal of ports depend=C2=A0 on = it. With kindest regards, Kostya Berger =20 =20 On Sunday, 24 January 2021, 01:40:57 GMT+3, Kostya Berger wrote: =20 =20 Hi everyone,I don't seem to find any mentioning in the /usr/ports/UPDATING= about how one should handle the removal of libncurses.so.9 from base.=20 Source UPDATING only says:ncurses installation has been modified to only ke= ep the widechar =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 enabled version.=C2=A0 Increment= al build is broken for that change, so it =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 requires a clean build. If that means to just build all ports anew, then it doesn't work as ports d= on't seem to incorporate any change related to this one. It would seem defa= ult configuration should take into account this, but it doesn't. The ports just use --with-libncurses-prefix=3D/usr, and there is no ncurses= libs found there. This make it skip MOST of the ports I'm using. Working Copy Root Path: /usr/ports URL: https://svn.freebsd.org/ports/head Relative URL: ^/head Repository Root: https://svn.freebsd.org/ports Repository UUID: 35697150-7ecd-e111-bb59-0022644237b5 Revision: 562417 Node Kind: directory Schedule: normal Last Changed Author: 0mp Last Changed Rev: 562417 Last Changed Date: 2021-01-23 23:01:38 +0300 (Sat, 23 Jan 2021) With kindest regards, Kostya Berger =20 =20 From owner-freebsd-current@freebsd.org Mon Jan 25 19:55:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DA1C94EF559 for ; Mon, 25 Jan 2021 19:55:23 +0000 (UTC) (envelope-from jhb@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPgZg5ykwz3DpB; Mon, 25 Jan 2021 19:55:23 +0000 (UTC) (envelope-from jhb@FreeBSD.org) Received: from John-Baldwins-MacBook-Pro.local (unknown [IPv6:2601:648:8681:1cb0:5c12:2e91:6a1e:30bf]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) (Authenticated sender: jhb) by smtp.freebsd.org (Postfix) with ESMTPSA id 78F8617BC; Mon, 25 Jan 2021 19:55:23 +0000 (UTC) (envelope-from jhb@FreeBSD.org) To: Neel Chauhan , freebsd-current@freebsd.org References: From: John Baldwin Subject: Re: Can In-Kernel TLS (kTLS) work with any OpenSSL Application? Message-ID: <77a3f82a-5235-f702-41d5-c1edafbab6c3@FreeBSD.org> Date: Mon, 25 Jan 2021 11:55:22 -0800 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.14; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=windows-1252; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 19:55:23 -0000 On 1/20/21 12:21 PM, Neel Chauhan wrote: > Hi freebsd-current@, > > I know that In-Kernel TLS was merged into the FreeBSD HEAD tree a while > back. > > With 13.0-RELEASE around the corner, I'm thinking about upgrading my > home server, well if I can accelerate any SSL application. > > I'm asking because I have a home server on a symmetrical Gigabit > connection (Google Fiber/Webpass), and that server runs a Tor relay. If > you're interested in how Tor works, the EFF has a writeup: > https://www.eff.org/pages/what-tor-relay > > But the main point for you all is: more-or-less Tor relays deal with > 1000s TLS connections going into and out of the server. > > Would In-Kernel TLS help with an application like Tor (or even load > balancers/TLS termination), or is it more for things like web servers > sending static files via sendfile() (e.g. CDN used by Netflix). It depends. Applications with allow OpenSSL to use a socket directly (e.g. via SSL_set_fd() or via SSL_connect() or the like) will work with kernel TLS transparently. This includes things like apache, nginx, fetch, wget, curl, etc. However, some applications use OpenSSL purely as a data transformation library and manage the socket I/O separately (e.g. OpenVPN). KTLS will not work with these applications since OpenSSL doesn't "know" about the socket in question. > My server could also work with Intel's QuickAssist (since it has an > Intel Xeon "Scalable" CPU). Would QuickAssist SSL be more helpful here? You can use this with ktls_ocf.ko and the qat(4) drivers. I am working, btw, on merging KTLS into base OpenSSL and hope to have it present in 13.0. As you noted, applications would need to be changed to use SSL_sendfile() to get the best performance on TX. We don't really have an analog on the receive side in our syscall API. One might be able to do some creative things with aio_read(4) perhaps, but I haven't implemented that. Also, currently RX offload always returns individual records with the full TLS header via recvmsg(). Linux's RX offload only includes the message for non-application-data messages so that one could in theory do bulk read(2) calls larger than a single TLS record. OpenSSL itself though always reads a single TLS record at a time, so if I were to change this (e.g. with a new socket option to toggle headers for application data), this would only be relevant to software that "knew" it was using KTLS and would use direct read/write after letting OpenSSL (or a similar library) handle the handshake. -- John Baldwin From owner-freebsd-current@freebsd.org Mon Jan 25 20:13:22 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 500F64EFFF8 for ; Mon, 25 Jan 2021 20:13:22 +0000 (UTC) (envelope-from mike@sentex.net) Received: from pyroxene2a.sentex.ca (pyroxene19.sentex.ca [IPv6:2607:f3e0:0:3::19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "pyroxene.sentex.ca", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPgzP3r55z3H9G for ; Mon, 25 Jan 2021 20:13:21 +0000 (UTC) (envelope-from mike@sentex.net) Received: from [IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c] ([IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c]) by pyroxene2a.sentex.ca (8.15.2/8.15.2) with ESMTPS id 10PKDIOt015903 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO); Mon, 25 Jan 2021 15:13:18 -0500 (EST) (envelope-from mike@sentex.net) Subject: Re: ZFS feature compatibility? To: Michael Butler , freebsd-current References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> From: mike tancsa Message-ID: <51abb80d-9d51-4de5-d369-e32f1a2981d5@sentex.net> Date: Mon, 25 Jan 2021 15:13:19 -0500 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: 4DPgzP3r55z3H9G X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:3::19 as permitted sender) smtp.mailfrom=mike@sentex.net X-Spamd-Result: default: False [-1.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f3e0:0:3::19:from]; FREEFALL_USER(0.00)[mike]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; HFILTER_HELO_IP_A(1.00)[pyroxene2a.sentex.ca]; HFILTER_HELO_NORES_A_OR_MX(0.30)[pyroxene2a.sentex.ca]; DMARC_NA(0.00)[sentex.net]; SPAMHAUS_ZRD(0.00)[2607:f3e0:0:3::19:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 20:13:22 -0000 I ran into an issue not being able to boot because of v2 bookmarks on the boot pool on RELENG_13 just last Friday.     ---Mike On 1/25/2021 2:31 PM, Michael Butler via freebsd-current wrote: > I have a few machines on which I've been hesitant to run 'zpool > upgrade' as I'm not sure of the (boot?) implications. They report like > this .. > > imb@toshi:/home/imb> uname -a > FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD > 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 > root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/TOSHI >  amd64 > > imb@toshi:/home/imb> zpool status >   pool: zroot >  state: ONLINE > status: Some supported features are not enabled on the pool. The pool can >         still be used, but some features are unavailable. > action: Enable all features using 'zpool upgrade'. Once this is done, >         the pool may no longer be accessible by software that does not > support >         the features. See zpool-features(5) for details. > > Is it safe to upgrade the root pool? > >     imb > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to > "freebsd-current-unsubscribe@freebsd.org" > From owner-freebsd-current@freebsd.org Mon Jan 25 20:15:59 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AA9644F04FE for ; Mon, 25 Jan 2021 20:15:59 +0000 (UTC) (envelope-from mike@sentex.net) Received: from pyroxene2a.sentex.ca (pyroxene19.sentex.ca [IPv6:2607:f3e0:0:3::19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "pyroxene.sentex.ca", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPh2R13WFz3HKB for ; Mon, 25 Jan 2021 20:15:59 +0000 (UTC) (envelope-from mike@sentex.net) Received: from [IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c] ([IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c]) by pyroxene2a.sentex.ca (8.15.2/8.15.2) with ESMTPS id 10PKFwoA016741 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO); Mon, 25 Jan 2021 15:15:58 -0500 (EST) (envelope-from mike@sentex.net) Subject: Re: ZFS feature compatibility? To: Toomas Soome , Michael Butler Cc: freebsd-current References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> From: mike tancsa Message-ID: <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> Date: Mon, 25 Jan 2021 15:15:59 -0500 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: 4DPh2R13WFz3HKB X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:3::19 as permitted sender) smtp.mailfrom=mike@sentex.net X-Spamd-Result: default: False [-1.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; HFILTER_HELO_IP_A(1.00)[pyroxene2a.sentex.ca]; HFILTER_HELO_NORES_A_OR_MX(0.30)[pyroxene2a.sentex.ca]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[me.com,protected-networks.net]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f3e0:0:3::19:from]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEFALL_USER(0.00)[mike]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; DMARC_NA(0.00)[sentex.net]; SPAMHAUS_ZRD(0.00)[2607:f3e0:0:3::19:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 20:15:59 -0000 On 1/25/2021 2:37 PM, Toomas Soome via freebsd-current wrote: > >> On 25. Jan 2021, at 21:31, Michael Butler via freebsd-current wrote: >> >> I have a few machines on which I've been hesitant to run 'zpool upgrade' as I'm not sure of the (boot?) implications. They report like this .. >> >> imb@toshi:/home/imb> uname -a >> FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/TOSHI amd64 >> >> imb@toshi:/home/imb> zpool status >> pool: zroot >> state: ONLINE >> status: Some supported features are not enabled on the pool. The pool can >> still be used, but some features are unavailable. >> action: Enable all features using 'zpool upgrade'. Once this is done, >> the pool may no longer be accessible by software that does not support >> the features. See zpool-features(5) for details. >> >> Is it safe to upgrade the root pool? >> >> imb > We can not boot from encrypted pool and draid. Rest is all ok. Please note, you may need to update the bootblocks. > last Friday on zoo.freebsd.org, mjg@freebsd.org and I could not boot again because v2 bookmarks were on the boot pool.  I had to boot from another disk, remove the bookmarks and then boot. This was on RELENG_13 (stable/13-c256203-g51d73a3e46c)     ---Mike From owner-freebsd-current@freebsd.org Mon Jan 25 20:29:41 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B787B4F0D31 for ; Mon, 25 Jan 2021 20:29:41 +0000 (UTC) (envelope-from rozhuk.im@gmail.com) Received: from mail-lf1-x136.google.com (mail-lf1-x136.google.com [IPv6:2a00:1450:4864:20::136]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPhLD5tc7z3JKf for ; Mon, 25 Jan 2021 20:29:40 +0000 (UTC) (envelope-from rozhuk.im@gmail.com) Received: by mail-lf1-x136.google.com with SMTP id v67so19741806lfa.0 for ; Mon, 25 Jan 2021 12:29:40 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:date:to:cc:subject:message-id:mime-version :content-transfer-encoding; bh=cmX2zW5qoVZ6sG6dngh5PArOXIWKAM50EHaIHD4ueLE=; b=GR9WwAL+/gzBlgbSIUcW38pFo2zi68fHt3tbGROo0PBrcdT1yDgaOokc5NwzaRCGta jwL0nefZGBXFc7vmWV2UWWlhFCZjrAph5MVj34Cw7Gf8MqF3mqYESFmWHy3p8cm41ddE eaIPdECEYFTUF8g8cILILOgZx61xn5hxccaw68W3Yz/cz0dYizVAYUPSADwN1SRxtQNP zm1UV2m031YqPj7EOUpUL9vDUbORxxbe4+KigdNSwQWnVPoZG3LCah8tRW3jU2QXcHws lPr2u9o9czo5ZnQVyT/QT1xW9mQph1cmKMPMOxDMoR1BK2CAZRSBsvygJiDYVm9luAWL 4i5Q== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:date:to:cc:subject:message-id:mime-version :content-transfer-encoding; bh=cmX2zW5qoVZ6sG6dngh5PArOXIWKAM50EHaIHD4ueLE=; b=qtELgkaz7MtG3Zy5e1PZw6Ld7TOIpMloXkpt0ORAT9KVokrMhvMtUfB0b4wl6aD/xm duBBqPtXBwJom9HisjHuxtTO4WCYLv/khDNBSGyS3/fUq6xhw39Ih1TJAk4pqlR8vaB6 f3+seWGHxla0ru8M2Znj0LAgU5PNRbznA0wwUJYyWujd40zb1bFLe5DJxq/ppVl/q1BT +Dsn9AlwYuU9qMhfvxFvTGAyRn8nR2GV1K5dv2pHgtuC972jIKDhr79D6gVXlCChnKD/ ewikLqZ9qZ+N8pHIS/Cp3iEexz80LBjxQKkWzcN9ALAxOGl+yfc+BzxowAGjWkqVWtJh 9fvg== X-Gm-Message-State: AOAM530KZ2oa98+MgLfg9pUmhK5HQKk880CxiyBrDOKDB0Pnp1PJjblM YCV1RFi7DBzR5yLItwrl5/vZmorbNSM= X-Google-Smtp-Source: ABdhPJzBODZ3oEvigsyh2klAyz9l3B54nCFqo//ALDB0YjhdBRG2BfQYiChPmcFtXi6qaVsNEolefQ== X-Received: by 2002:a05:6512:110a:: with SMTP id l10mr1061993lfg.140.1611606578848; Mon, 25 Jan 2021 12:29:38 -0800 (PST) Received: from rimwks.local ([2001:470:1f15:3d8:7285:c2ff:fe37:5722]) by smtp.gmail.com with ESMTPSA id k185sm945883lfd.239.2021.01.25.12.29.37 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Mon, 25 Jan 2021 12:29:38 -0800 (PST) From: Rozhuk Ivan X-Google-Original-From: Rozhuk Ivan Date: Mon, 25 Jan 2021 23:29:33 +0300 To: freebsd-current@freebsd.org Cc: Rozhuk Ivan Subject: fsck strange output Message-ID: <20210125232933.1ad108d1@rimwks.local> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable X-Rspamd-Queue-Id: 4DPhLD5tc7z3JKf X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=GR9WwAL+; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of rozhukim@gmail.com designates 2a00:1450:4864:20::136 as permitted sender) smtp.mailfrom=rozhukim@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::136:from]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::136:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::136:from]; FREEMAIL_CC(0.00)[gmail.com]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 20:29:41 -0000 Hi! I am on fresh 13 and on auto fsck got: Jan 25 23:14:13 3des kernel: Starting file system checks: Jan 25 23:14:13 3des kernel: /dev/gptid/81241708-8948-11e9-b1ae-049226c061d= 6: CANNOT READ BLK: 11072 Jan 25 23:14:13 3des kernel: /dev/gptid/81241708-8948-11e9-b1ae-049226c061d= 6: UNEXPECTED SOFT UPDATE INCONSISTENCY; RUN fsck MANUALLY. Jan 25 23:14:13 3des kernel: File system preen failed, trying fsck -y -T ff= s:-R,-r -T ufs:-R,-r Jan 25 23:14:13 3des kernel: ** /dev/gptid/81241708-8948-11e9-b1ae-049226c0= 61d6 Jan 25 23:14:13 3des kernel: ** Last Mounted on / Jan 25 23:14:13 3des kernel: ** Root file system Jan 25 23:14:13 3des kernel: ** Phase 1 - Check Blocks and Sizes Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 11072 Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CONTINUE? yes Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: THE FOLLOWING DISK SECTORS COULD NOT BE READ: Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 5129280 Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CONTINUE? yes Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: THE FOLLOWING DISK SECTORS COULD NOT BE READ: Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 6411520 Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CONTINUE? yes Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: THE FOLLOWING DISK SECTORS COULD NOT BE READ: Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 7693888 Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY Jan 25 23:14:13 3des kernel:=20 Jan 25 23:14:13 3des kernel: CONTINUE? yes .... Disk is 100% alive, got same on other HW. fsck -y - have no this strange problem with reading. Is it OK "CANNOT READ BLK ..." ? =46rom my rc.conf: fsck_y_enable=3D"YES" # Set to YES to do fsck -y if the initial preen fail= s. fsck_y_flags=3D"-T ffs:-R,-r -T ufs:-R,-r" # Additional flags for fsck -y background_fsck=3D"NO" # Attempt to run fsck in the background where possi= ble. From owner-freebsd-current@freebsd.org Mon Jan 25 20:52:00 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 302354F1631 for ; Mon, 25 Jan 2021 20:52:00 +0000 (UTC) (envelope-from phk@critter.freebsd.dk) Received: from phk.freebsd.dk (phk.freebsd.dk [130.225.244.222]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPhqy6CYSz3Kpq for ; Mon, 25 Jan 2021 20:51:58 +0000 (UTC) (envelope-from phk@critter.freebsd.dk) Received: from critter.freebsd.dk (v-critter.freebsd.dk [192.168.55.3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by phk.freebsd.dk (Postfix) with ESMTPS id 531ED8A3CA; Mon, 25 Jan 2021 20:51:51 +0000 (UTC) Received: from critter.freebsd.dk (localhost [127.0.0.1]) by critter.freebsd.dk (8.16.1/8.16.1) with ESMTPS id 10PKpoBd068618 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Mon, 25 Jan 2021 20:51:50 GMT (envelope-from phk@critter.freebsd.dk) Received: (from phk@localhost) by critter.freebsd.dk (8.16.1/8.16.1/Submit) id 10PKpoTd068617; Mon, 25 Jan 2021 20:51:50 GMT (envelope-from phk) To: Rozhuk Ivan cc: freebsd-current@freebsd.org Subject: Re: fsck strange output In-reply-to: <20210125232933.1ad108d1@rimwks.local> From: "Poul-Henning Kamp" References: <20210125232933.1ad108d1@rimwks.local> MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <68615.1611607910.1@critter.freebsd.dk> Date: Mon, 25 Jan 2021 20:51:50 +0000 Message-ID: <68616.1611607910@critter.freebsd.dk> X-Rspamd-Queue-Id: 4DPhqy6CYSz3Kpq X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of phk@critter.freebsd.dk designates 130.225.244.222 as permitted sender) smtp.mailfrom=phk@critter.freebsd.dk X-Spamd-Result: default: False [-3.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[130.225.244.222:from]; FREEFALL_USER(0.00)[phk]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; ARC_NA(0.00)[]; DMARC_NA(0.00)[freebsd.dk]; SPAMHAUS_ZRD(0.00)[130.225.244.222:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[phk@phk.freebsd.dk,phk@critter.freebsd.dk]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:1835, ipnet:130.225.0.0/16, country:EU]; FROM_NEQ_ENVFROM(0.00)[phk@phk.freebsd.dk,phk@critter.freebsd.dk]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 20:52:00 -0000 -------- Rozhuk Ivan writes: > Disk is 100% alive, got same on other HW. A disk can be alive and still have individually unreadable sectors, that is, IMO, the most common failure mode. Try: recoverdisk -v /dev/whatever That will attempt to read all sectors on the disk. -- Poul-Henning Kamp | UNIX since Zilog Zeus 3.20 phk@FreeBSD.ORG | TCP/IP since RFC 956 FreeBSD committer | BSD since 4.3-tahoe Never attribute to malice what can adequately be explained by incompetence. From owner-freebsd-current@freebsd.org Mon Jan 25 21:04:06 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7A4AB4F1A13 for ; Mon, 25 Jan 2021 21:04:06 +0000 (UTC) (envelope-from tsoome@me.com) Received: from pv50p00im-ztdg10011901.me.com (pv50p00im-ztdg10011901.me.com [17.58.6.50]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPj5x3WNbz3LYg for ; Mon, 25 Jan 2021 21:04:05 +0000 (UTC) (envelope-from tsoome@me.com) Received: from nazgul.lan (148-52-235-80.sta.estpak.ee [80.235.52.148]) by pv50p00im-ztdg10011901.me.com (Postfix) with ESMTPSA id 8B62F8006D9; Mon, 25 Jan 2021 21:04:01 +0000 (UTC) From: Toomas Soome Message-Id: <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: ZFS feature compatibility? Date: Mon, 25 Jan 2021 23:03:59 +0200 In-Reply-To: <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> Cc: Michael Butler , freebsd-current To: mike tancsa References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-25_09:2021-01-25, 2021-01-25 signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 malwarescore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1011 mlxscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-2006250000 definitions=main-2101250107 X-Rspamd-Queue-Id: 4DPj5x3WNbz3LYg X-Spamd-Bar: - X-Spamd-Result: default: False [-1.42 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[17.58.6.50:from]; FREEMAIL_FROM(0.00)[me.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:17.58.0.0/16]; URI_COUNT_ODD(1.00)[5]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[me.com:+]; DMARC_POLICY_ALLOW(-0.50)[me.com,quarantine]; NEURAL_HAM_SHORT(-0.92)[-0.917]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[me.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[17.58.6.50:from]; ASN(0.00)[asn:714, ipnet:17.58.0.0/20, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[me.com:s=1a1hai]; FREEFALL_USER(0.00)[tsoome]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; DWL_DNSWL_NONE(0.00)[me.com:dkim]; SPAMHAUS_ZRD(0.00)[17.58.6.50:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[80.235.52.148:received]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[17.58.6.50:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:04:06 -0000 > On 25. Jan 2021, at 22:15, mike tancsa wrote: >=20 > On 1/25/2021 2:37 PM, Toomas Soome via freebsd-current wrote: >>=20 >>> On 25. Jan 2021, at 21:31, Michael Butler via freebsd-current = wrote: >>>=20 >>> I have a few machines on which I've been hesitant to run 'zpool = upgrade' as I'm not sure of the (boot?) implications. They report like = this .. >>>=20 >>> imb@toshi:/home/imb> uname -a >>> FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD = 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 = root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/= TOSHI amd64 >>>=20 >>> imb@toshi:/home/imb> zpool status >>> pool: zroot >>> state: ONLINE >>> status: Some supported features are not enabled on the pool. The = pool can >>> still be used, but some features are unavailable. >>> action: Enable all features using 'zpool upgrade'. Once this is = done, >>> the pool may no longer be accessible by software that does not = support >>> the features. See zpool-features(5) for details. >>>=20 >>> Is it safe to upgrade the root pool? >>>=20 >>> imb >> We can not boot from encrypted pool and draid. Rest is all ok. Please = note, you may need to update the bootblocks. >>=20 > last Friday on zoo.freebsd.org , = mjg@freebsd.org and I could not boot > again because v2 bookmarks were on the boot pool. I had to boot from > another disk, remove the bookmarks and then boot. This was on = RELENG_13 > (stable/13-c256203-g51d73a3e46c) >=20 > =E2=80=94Mike /* * List of ZFS features supported for read */ static const char *features_for_read[] =3D { "org.illumos:lz4_compress", "com.delphix:hole_birth", "com.delphix:extensible_dataset", "com.delphix:embedded_data", "org.open-zfs:large_blocks", "org.illumos:sha512", "org.illumos:skein", "org.zfsonlinux:large_dnode", "com.joyent:multi_vdev_crash_dump", "com.delphix:spacemap_histogram", "com.delphix:zpool_checkpoint", "com.delphix:spacemap_v2", "com.datto:encryption", "com.datto:bookmark_v2", "org.zfsonlinux:allocation_classes", "com.datto:resilver_defer", "com.delphix:device_removal", "com.delphix:obsolete_counts", "com.intel:allocation_classes", "org.freebsd:zstd_compress", "com.delphix:bookmark_written", NULL }; Are you sure you have bootblocks updated? ESP for UEFI boot and = freebsd-boot for BIOS boot. rgds, toomas= From owner-freebsd-current@freebsd.org Mon Jan 25 21:08:09 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 06B974F19CE for ; Mon, 25 Jan 2021 21:08:09 +0000 (UTC) (envelope-from allanjude@freebsd.org) Received: from tor1-11.mx.scaleengine.net (tor1-11.mx.scaleengine.net [209.51.186.6]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPjBc5Q23z3Llp for ; Mon, 25 Jan 2021 21:08:08 +0000 (UTC) (envelope-from allanjude@freebsd.org) Received: from [10.1.1.2] (Seawolf.HML3.ScaleEngine.net [209.51.186.28]) (Authenticated sender: allanjude.freebsd@scaleengine.com) by tor1-11.mx.scaleengine.net (Postfix) with ESMTPSA id 622D21BDEF for ; Mon, 25 Jan 2021 21:08:02 +0000 (UTC) DKIM-Filter: OpenDKIM Filter v2.10.3 tor1-11.mx.scaleengine.net 622D21BDEF Subject: Re: ZFS feature compatibility? To: freebsd-current@freebsd.org References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> From: Allan Jude Message-ID: Date: Mon, 25 Jan 2021 16:08:00 -0500 User-Agent: Mozilla/5.0 (Windows NT 6.1; Win64; x64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4DPjBc5Q23z3Llp X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; ASN(0.00)[asn:6939, ipnet:209.51.160.0/19, country:US]; local_wl_from(0.00)[freebsd.org] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:08:09 -0000 On 2021-01-25 16:03, Toomas Soome via freebsd-current wrote: > > >> On 25. Jan 2021, at 22:15, mike tancsa wrote: >> >> On 1/25/2021 2:37 PM, Toomas Soome via freebsd-current wrote: >>> >>>> On 25. Jan 2021, at 21:31, Michael Butler via freebsd-current wrote: >>>> >>>> I have a few machines on which I've been hesitant to run 'zpool upgrade' as I'm not sure of the (boot?) implications. They report like this .. >>>> >>>> imb@toshi:/home/imb> uname -a >>>> FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/TOSHI amd64 >>>> >>>> imb@toshi:/home/imb> zpool status >>>> pool: zroot >>>> state: ONLINE >>>> status: Some supported features are not enabled on the pool. The pool can >>>> still be used, but some features are unavailable. >>>> action: Enable all features using 'zpool upgrade'. Once this is done, >>>> the pool may no longer be accessible by software that does not support >>>> the features. See zpool-features(5) for details. >>>> >>>> Is it safe to upgrade the root pool? >>>> >>>> imb >>> We can not boot from encrypted pool and draid. Rest is all ok. Please note, you may need to update the bootblocks. >>> >> last Friday on zoo.freebsd.org , mjg@freebsd.org and I could not boot >> again because v2 bookmarks were on the boot pool. I had to boot from >> another disk, remove the bookmarks and then boot. This was on RELENG_13 >> (stable/13-c256203-g51d73a3e46c) >> >> —Mike > > /* > * List of ZFS features supported for read > */ > static const char *features_for_read[] = { > "org.illumos:lz4_compress", > "com.delphix:hole_birth", > "com.delphix:extensible_dataset", > "com.delphix:embedded_data", > "org.open-zfs:large_blocks", > "org.illumos:sha512", > "org.illumos:skein", > "org.zfsonlinux:large_dnode", > "com.joyent:multi_vdev_crash_dump", > "com.delphix:spacemap_histogram", > "com.delphix:zpool_checkpoint", > "com.delphix:spacemap_v2", > "com.datto:encryption", > "com.datto:bookmark_v2", > "org.zfsonlinux:allocation_classes", > "com.datto:resilver_defer", > "com.delphix:device_removal", > "com.delphix:obsolete_counts", > "com.intel:allocation_classes", > "org.freebsd:zstd_compress", > "com.delphix:bookmark_written", > NULL > }; > > Are you sure you have bootblocks updated? ESP for UEFI boot and freebsd-boot for BIOS boot. > > rgds, > toomas > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > Toomas: how difficult do we think it would be to make a ports version of the updated boot code, especially for the case of people using the openzfs-kmod on 12.2? -- Allan Jude From owner-freebsd-current@freebsd.org Mon Jan 25 21:17:18 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id CE5DE4F1F95 for ; Mon, 25 Jan 2021 21:17:18 +0000 (UTC) (envelope-from mike@sentex.net) Received: from pyroxene2a.sentex.ca (pyroxene19.sentex.ca [IPv6:2607:f3e0:0:3::19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "pyroxene.sentex.ca", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPjPB1080z3MP5 for ; Mon, 25 Jan 2021 21:17:18 +0000 (UTC) (envelope-from mike@sentex.net) Received: from [IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c] ([IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c]) by pyroxene2a.sentex.ca (8.15.2/8.15.2) with ESMTPS id 10PLHHW6036699 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO); Mon, 25 Jan 2021 16:17:17 -0500 (EST) (envelope-from mike@sentex.net) To: Toomas Soome Cc: Michael Butler , freebsd-current , Mateusz Guzik References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> From: mike tancsa Subject: Re: ZFS feature compatibility? Message-ID: Date: Mon, 25 Jan 2021 16:17:18 -0500 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Content-Language: en-US X-Rspamd-Queue-Id: 4DPjPB1080z3MP5 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:3::19 as permitted sender) smtp.mailfrom=mike@sentex.net X-Spamd-Result: default: False [-1.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; HFILTER_HELO_IP_A(1.00)[pyroxene2a.sentex.ca]; HFILTER_HELO_NORES_A_OR_MX(0.30)[pyroxene2a.sentex.ca]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[me.com]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f3e0:0:3::19:from]; MIME_TRACE(0.00)[0:+]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEFALL_USER(0.00)[mike]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sentex.net]; SPAMHAUS_ZRD(0.00)[2607:f3e0:0:3::19:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; FREEMAIL_CC(0.00)[protected-networks.net,freebsd.org,gmail.com]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:17:18 -0000 On 1/25/2021 4:03 PM, Toomas Soome wrote: > > >> On 25. Jan 2021, at 22:15, mike tancsa > > wrote: >> >> On 1/25/2021 2:37 PM, Toomas Soome via freebsd-current wrote: >>> >>>> On 25. Jan 2021, at 21:31, Michael Butler via freebsd-current >>>> > >>>> wrote: >>>> >>>> I have a few machines on which I've been hesitant to run 'zpool >>>> upgrade' as I'm not sure of the (boot?) implications. They report >>>> like this .. >>>> >>>> imb@toshi:/home/imb> uname -a >>>> FreeBSD toshi.auburn.protected-networks.net >>>> 14.0-CURRENT FreeBSD >>>> 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 >>>> root@toshi.auburn.protected-networks.net >>>> :/usr/obj/usr/src/a= md64.amd64/sys/TOSHI >>>> amd64 >>>> >>>> imb@toshi:/home/imb> zpool status >>>> pool: zroot >>>> state: ONLINE >>>> status: Some supported features are not enabled on the pool. The >>>> pool can >>>> =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0still be used, but some features= are unavailable. >>>> action: Enable all features using 'zpool upgrade'. Once this is done= , >>>> =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0the pool may no longer be access= ible by software that does >>>> not support >>>> =C2=A0=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0the features. See zpool-features= (5) for details. >>>> >>>> Is it safe to upgrade the root pool? >>>> >>>> imb >>> We can not boot from encrypted pool and draid. Rest is all ok. >>> Please note, you may need to update the bootblocks. >>> >> last Friday on=C2=A0zoo.freebsd.org >> ,=C2=A0mjg@freebsd.org >> =C2=A0and I could not boot >> again because v2 bookmarks were on the boot pool.=C2=A0 I had to boot = from >> another disk, remove the bookmarks and then boot. This was on RELENG_1= 3 >> (stable/13-c256203-g51d73a3e46c) >> >> =C2=A0=C2=A0=C2=A0 =E2=80=94Mike > > /* > =C2=A0* List of ZFS features supported for read > =C2=A0*/ > static const char *features_for_read[] =3D { > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.illumos:lz4_compress", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:hole_birth", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:extensible_dataset", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:embedded_data", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.open-zfs:large_blocks", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.illumos:sha512", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.illumos:skein", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.zfsonlinux:large_dnode", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.joyent:multi_vdev_crash_dump", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:spacemap_histogram", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:zpool_checkpoint", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:spacemap_v2", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.datto:encryption", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.datto:bookmark_v2", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.zfsonlinux:allocation_classes", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.datto:resilver_defer", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:device_removal", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:obsolete_counts", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.intel:allocation_classes", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "org.freebsd:zstd_compress", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 "com.delphix:bookmark_written", > =C2=A0 =C2=A0 =C2=A0 =C2=A0 NULL > }; > > Are you sure you have bootblocks updated? ESP for UEFI boot and > freebsd-boot for BIOS boot. > > mjg did them IIRC.=C2=A0 I just checked to make sure both were done and t= hey seem identical root@zoo2:/home/mdtancsa # dd if=3D/dev/ada8p2 of=3D/tmp/8 1024+0 records in 1024+0 records out 524288 bytes transferred in 0.046479 secs (11280092 bytes/sec) root@zoo2:/home/mdtancsa # dd if=3D/dev/ada9p2 of=3D/tmp/9 1024+0 records in 1024+0 records out 524288 bytes transferred in 0.054717 secs (9581751 bytes/sec) root@zoo2:/home/mdtancsa # md5 /tmp/8 /tmp/9 MD5 (/tmp/8) =3D e294b1344cbb49c751474facc39998ec MD5 (/tmp/9) =3D e294b1344cbb49c751474facc39998ec root@zoo2:/home/mdtancsa # Is there a way to check from the bin if its the right version ? strings of the file doesnt seem to show anything useful.=C2=A0 I wonder if its th= e UEFI boot that got missed ?=C2=A0 Just gpart bootcode -p /boot/boot1.efifat -i 1ada8 gpart bootcode -p /boot/boot1.efifat -i 1ada9 I take it ? MD5 (/tmp/81) =3D ff8762fa2b885347a0030b45b0f3844e MD5 (/tmp/91) =3D e0fa5369ddb0471373bca6b29e027680 MD5 (/boot/boot1.efi) =3D c023e2c74479b2f0710ab0337a7bab4f root@zoo2:/boot # dd if=3D/dev/ada9p1 of=3D/tmp/91 bs=3D1m 200+0 records in 200+0 records out 209715200 bytes transferred in 0.557007 secs (376503669 bytes/sec) root@zoo2:/boot # dd if=3D/dev/ada8p1 of=3D/tmp/81 bs=3D1m 200+0 records in 200+0 records out 209715200 bytes transferred in 0.475806 secs (440757874 bytes/sec) root@zoo2:/boot # md5 /tmp/81 /tmp/91 /boot/boot1 boot1=C2=A0=C2=A0=C2=A0=C2=A0=C2=A0 boot1.efi* root@zoo2:/boot # md5 /tmp/81 /tmp/91 /boot/boot1.efi MD5 (/tmp/81) =3D ff8762fa2b885347a0030b45b0f3844e MD5 (/tmp/91) =3D e0fa5369ddb0471373bca6b29e027680 MD5 (/boot/boot1.efi) =3D c023e2c74479b2f0710ab0337a7bab4f I am guessing they extracted boot blocks should match, no ? =C2=A0=C2=A0=C2=A0 ---Mike From owner-freebsd-current@freebsd.org Mon Jan 25 21:40:03 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A63524F2913 for ; Mon, 25 Jan 2021 21:40:03 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPjvR46t7z3Nfx for ; Mon, 25 Jan 2021 21:40:03 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from weatherwax.trouble.is (weatherwax.trouble.is [IPv6:2a00:1098:82:3a::1]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "weatherwax.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 69AC52663 for ; Mon, 25 Jan 2021 21:40:03 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from rincewind.trouble.is (rincewind.trouble.is [95.216.22.234]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (4096 bits)) (Client CN "rincewind.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) by weatherwax.trouble.is (Postfix) with ESMTPS id 4DPjvQ3McPz1y2v for ; Mon, 25 Jan 2021 21:40:02 +0000 (UTC) Received: by rincewind.trouble.is (Postfix, authenticated sender philip) id 4DPjvN6rYwz6Fhh; Mon, 25 Jan 2021 21:40:00 +0000 (UTC) From: "Philip Paeps" To: "FreeBSD Current" Subject: Re: pkg for 14-current Date: Tue, 26 Jan 2021 05:39:57 +0800 X-Clacks-Overhead: GNU Terry Pratchett X-Mailer: MailMate (1.14r5757) Message-ID: <38C29D42-9BE9-4279-909E-DBE98482D9A4@freebsd.org> In-Reply-To: <20210124.191829.1703374243123280023.yasu@utahime.org> References: <20210124.191128.347098475829517878.ish@amail.plala.or.jp> <20210124.191829.1703374243123280023.yasu@utahime.org> MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:40:03 -0000 On 2021-01-24 18:18:29 (+0800), Yasuhiro Kimura wrote: > From: Masachika ISHIZUKA > Subject: pkg for 14-current > Date: Sun, 24 Jan 2021 19:11:28 +0900 (JST) > >> Hi. >> >> I updated to 14-current from 13-current and reinstalled >> ports-mgmt/pkg. >> I cannot get meta files for 14-current. >> How can I use pkg on 14-current ? >> >>> # pkg update >>> Updating FreeBSD repository catalogue... >>> pkg: http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/meta.txz: >>> Not Found >>> repository FreeBSD has no meta file, using default settings >>> pkg: >>> http://pkgmir.geo.freebsd.org/FreeBSD:14:amd64/latest/packagesite.txz: >>> Not Found >>> Unable to update repository FreeBSD >>> Error updating repositories! > > All what you can do is to wait until build of offical packages for > 14-CURRENT has completed unless you build them by yourself. The first package build for 14-CURRENT is visible on the mirrors now (as of a couple of minutes ago). Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From owner-freebsd-current@freebsd.org Mon Jan 25 21:52:38 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C37724F2CCC for ; Mon, 25 Jan 2021 21:52:38 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (phouka1.phouka.net [107.170.196.116]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "phouka.net", Issuer "Go Daddy Secure Certificate Authority - G2" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPk9x48dqz3QDZ for ; Mon, 25 Jan 2021 21:52:37 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (localhost [127.0.0.1]) by phouka1.phouka.net (8.16.1/8.16.1) with ESMTPS id 10PLpKsv054719 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Mon, 25 Jan 2021 13:51:20 -0800 (PST) (envelope-from warlock@phouka1.phouka.net) Received: (from warlock@localhost) by phouka1.phouka.net (8.16.1/8.16.1/Submit) id 10PLpJZ5054715; Mon, 25 Jan 2021 13:51:19 -0800 (PST) (envelope-from warlock) Date: Mon, 25 Jan 2021 13:51:18 -0800 From: John Kennedy To: mike tancsa Cc: Toomas Soome , Michael Butler , freebsd-current , Mateusz Guzik Subject: Re: ZFS feature compatibility? Message-ID: References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: X-Rspamd-Queue-Id: 4DPk9x48dqz3QDZ X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of warlock@phouka1.phouka.net has no SPF policy when checking 107.170.196.116) smtp.mailfrom=warlock@phouka1.phouka.net X-Spamd-Result: default: False [-0.80 / 15.00]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; FREEMAIL_CC(0.00)[me.com,protected-networks.net,freebsd.org,gmail.com]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.170.196.116:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[phouka.net]; AUTH_NA(1.00)[]; RCPT_COUNT_FIVE(0.00)[5]; SPAMHAUS_ZRD(0.00)[107.170.196.116:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[warlock@phouka.net,warlock@phouka1.phouka.net]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:14061, ipnet:107.170.192.0/18, country:US]; FROM_NEQ_ENVFROM(0.00)[warlock@phouka.net,warlock@phouka1.phouka.net]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:52:38 -0000 On Mon, Jan 25, 2021 at 04:17:18PM -0500, mike tancsa wrote: > Is there a way to check from the bin if its the right version ? strings > of the file doesnt seem to show anything useful. I wonder if its the > UEFI boot that got missed ? Just > > gpart bootcode -p /boot/boot1.efifat -i 1ada8 > gpart bootcode -p /boot/boot1.efifat -i 1ada9 > > I take it ? I don't think that is the way to update UEFI anymore (although last time I looked it was still documented that way in one place). For my last bootcode (which had UEFI & BIOS) update, I basically did this: gpart show nvd0 => 40 976773088 nvd0 GPT (466G) 40 409600 1 efi (200M) 409640 1024 2 freebsd-boot (512K) 410664 984 - free - (492K) 411648 16777216 3 freebsd-swap (8.0G) 17188864 959584256 4 freebsd-zfs (458G) 976773120 8 - free - (4.0K) gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 2 nvd0 partcode written to nvd0p2 bootcode written to nvd0 mount -vt msdosfs /dev/nvd0p1 /mnt /dev/nvd0p1 on /mnt (msdosfs, local, writes: sync 1 async 0, reads: sync 13 async 0, fsid 5c00000032000000) install -p -m755 /boot/loader.efi /mnt/efi/boot/BOOTx64.efi umount -v /mnt /dev/nvd0p1: unmount from /mnt From owner-freebsd-current@freebsd.org Mon Jan 25 21:56:07 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EAE564F322B for ; Mon, 25 Jan 2021 21:56:07 +0000 (UTC) (envelope-from mike@sentex.net) Received: from pyroxene2a.sentex.ca (pyroxene19.sentex.ca [IPv6:2607:f3e0:0:3::19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "pyroxene.sentex.ca", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPkFz2wR3z3QC4 for ; Mon, 25 Jan 2021 21:56:07 +0000 (UTC) (envelope-from mike@sentex.net) Received: from [IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c] ([IPv6:2607:f3e0:0:4:6803:7f97:bbf4:4a3c]) by pyroxene2a.sentex.ca (8.15.2/8.15.2) with ESMTPS id 10PLu68i049456 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO); Mon, 25 Jan 2021 16:56:06 -0500 (EST) (envelope-from mike@sentex.net) Subject: Re: ZFS feature compatibility? To: John Kennedy Cc: Toomas Soome , Michael Butler , freebsd-current , Mateusz Guzik References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> From: mike tancsa Message-ID: <1fddab2c-f8bc-4f5e-d2b5-a32442786f3e@sentex.net> Date: Mon, 25 Jan 2021 16:56:07 -0500 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: 4DPkFz2wR3z3QC4 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:3::19 as permitted sender) smtp.mailfrom=mike@sentex.net X-Spamd-Result: default: False [-1.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; HFILTER_HELO_IP_A(1.00)[pyroxene2a.sentex.ca]; HFILTER_HELO_NORES_A_OR_MX(0.30)[pyroxene2a.sentex.ca]; RCPT_COUNT_FIVE(0.00)[5]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f3e0:0:3::19:from]; MIME_TRACE(0.00)[0:+]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEFALL_USER(0.00)[mike]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sentex.net]; SPAMHAUS_ZRD(0.00)[2607:f3e0:0:3::19:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; FREEMAIL_CC(0.00)[me.com,protected-networks.net,freebsd.org,gmail.com]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:56:08 -0000 On 1/25/2021 4:51 PM, John Kennedy wrote: > On Mon, Jan 25, 2021 at 04:17:18PM -0500, mike tancsa wrote: >> Is there a way to check from the bin if its the right version ? strings >> of the file doesnt seem to show anything useful.  I wonder if its the >> UEFI boot that got missed ?  Just >> >> gpart bootcode -p /boot/boot1.efifat -i 1ada8 >> gpart bootcode -p /boot/boot1.efifat -i 1ada9 >> >> I take it ? > I don't think that is the way to update UEFI anymore (although last time I > looked it was still documented that way in one place). > > For my last bootcode (which had UEFI & BIOS) update, I basically did this: > > gpart show nvd0 > => 40 976773088 nvd0 GPT (466G) > 40 409600 1 efi (200M) > 409640 1024 2 freebsd-boot (512K) > 410664 984 - free - (492K) > 411648 16777216 3 freebsd-swap (8.0G) > 17188864 959584256 4 freebsd-zfs (458G) > 976773120 8 - free - (4.0K) > > gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 2 nvd0 > partcode written to nvd0p2 > bootcode written to nvd0 > > mount -vt msdosfs /dev/nvd0p1 /mnt > /dev/nvd0p1 on /mnt (msdosfs, local, writes: sync 1 async 0, reads: sync 13 async 0, fsid 5c00000032000000) > install -p -m755 /boot/loader.efi /mnt/efi/boot/BOOTx64.efi > umount -v /mnt > /dev/nvd0p1: unmount from /mnt Thanks, I am new to the EFI world.  Does the name now have to be BOOTx64.efi ? root@zoo2:/boot # ls -l /mnt/EFI/freebsd/ total 824 -rwxr-xr-x  1 root  wheel  843776 Nov 21 10:50 loader.efi root@zoo2:/boot #     ---Mike > > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > From owner-freebsd-current@freebsd.org Mon Jan 25 21:59:13 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6DEA14F3544 for ; Mon, 25 Jan 2021 21:59:13 +0000 (UTC) (envelope-from tsoome@me.com) Received: from pv50p00im-ztdg10021101.me.com (pv50p00im-ztdg10021101.me.com [17.58.6.44]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPkKX4kdNz3R6m for ; Mon, 25 Jan 2021 21:59:12 +0000 (UTC) (envelope-from tsoome@me.com) Received: from nazgul.lan (148-52-235-80.sta.estpak.ee [80.235.52.148]) by pv50p00im-ztdg10021101.me.com (Postfix) with ESMTPSA id 6477A1801EB; Mon, 25 Jan 2021 21:59:10 +0000 (UTC) From: Toomas Soome Message-Id: <6B3B86C9-515A-43AF-9A0A-FA7876D4BBA8@me.com> Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: ZFS feature compatibility? Date: Mon, 25 Jan 2021 23:59:08 +0200 In-Reply-To: Cc: freebsd-current@freebsd.org To: Allan Jude References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-25_09:2021-01-25, 2021-01-25 signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 malwarescore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1015 mlxscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-2006250000 definitions=main-2101250109 X-Rspamd-Queue-Id: 4DPkKX4kdNz3R6m X-Spamd-Bar: - X-Spamd-Result: default: False [-1.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:17.58.0.0/16:c]; FREEMAIL_FROM(0.00)[me.com]; MV_CASE(0.50)[]; URI_COUNT_ODD(1.00)[3]; DKIM_TRACE(0.00)[me.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[me.com,quarantine]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[me.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[17.58.6.44:from]; DWL_DNSWL_NONE(0.00)[me.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[me.com:s=1a1hai]; FREEFALL_USER(0.00)[tsoome]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:714, ipnet:17.58.0.0/20, country:US]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; SPAMHAUS_ZRD(0.00)[17.58.6.44:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[80.235.52.148:received]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[17.58.6.44:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[17.58.6.44:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:59:13 -0000 > On 25. Jan 2021, at 23:08, Allan Jude wrote: >=20 > On 2021-01-25 16:03, Toomas Soome via freebsd-current wrote: >>=20 >>=20 >>> On 25. Jan 2021, at 22:15, mike tancsa wrote: >>>=20 >>> On 1/25/2021 2:37 PM, Toomas Soome via freebsd-current wrote: >>>>=20 >>>>> On 25. Jan 2021, at 21:31, Michael Butler via freebsd-current = wrote: >>>>>=20 >>>>> I have a few machines on which I've been hesitant to run 'zpool = upgrade' as I'm not sure of the (boot?) implications. They report like = this .. >>>>>=20 >>>>> imb@toshi:/home/imb> uname -a >>>>> FreeBSD toshi.auburn.protected-networks.net 14.0-CURRENT FreeBSD = 14.0-CURRENT #25 main-eb61de5b78: Fri Jan 22 10:03:02 EST 2021 = root@toshi.auburn.protected-networks.net:/usr/obj/usr/src/amd64.amd64/sys/= TOSHI amd64 >>>>>=20 >>>>> imb@toshi:/home/imb> zpool status >>>>> pool: zroot >>>>> state: ONLINE >>>>> status: Some supported features are not enabled on the pool. The = pool can >>>>> still be used, but some features are unavailable. >>>>> action: Enable all features using 'zpool upgrade'. Once this is = done, >>>>> the pool may no longer be accessible by software that does = not support >>>>> the features. See zpool-features(5) for details. >>>>>=20 >>>>> Is it safe to upgrade the root pool? >>>>>=20 >>>>> imb >>>> We can not boot from encrypted pool and draid. Rest is all ok. = Please note, you may need to update the bootblocks. >>>>=20 >>> last Friday on zoo.freebsd.org = >, mjg@freebsd.org = > and I could not boot >>> again because v2 bookmarks were on the boot pool. I had to boot = from >>> another disk, remove the bookmarks and then boot. This was on = RELENG_13 >>> (stable/13-c256203-g51d73a3e46c) >>>=20 >>> =E2=80=94Mike >>=20 >> /* >> * List of ZFS features supported for read >> */ >> static const char *features_for_read[] =3D { >> "org.illumos:lz4_compress", >> "com.delphix:hole_birth", >> "com.delphix:extensible_dataset", >> "com.delphix:embedded_data", >> "org.open-zfs:large_blocks", >> "org.illumos:sha512", >> "org.illumos:skein", >> "org.zfsonlinux:large_dnode", >> "com.joyent:multi_vdev_crash_dump", >> "com.delphix:spacemap_histogram", >> "com.delphix:zpool_checkpoint", >> "com.delphix:spacemap_v2", >> "com.datto:encryption", >> "com.datto:bookmark_v2", >> "org.zfsonlinux:allocation_classes", >> "com.datto:resilver_defer", >> "com.delphix:device_removal", >> "com.delphix:obsolete_counts", >> "com.intel:allocation_classes", >> "org.freebsd:zstd_compress", >> "com.delphix:bookmark_written", >> NULL >> }; >>=20 >> Are you sure you have bootblocks updated? ESP for UEFI boot and = freebsd-boot for BIOS boot. >>=20 >> rgds, >> toomas >> _______________________________________________ >> freebsd-current@freebsd.org = mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-current = >> To unsubscribe, send any mail to = "freebsd-current-unsubscribe@freebsd.org = " >>=20 >=20 > Toomas: how difficult do we think it would be to make a ports version = of > the updated boot code, especially for the case of people using the > openzfs-kmod on 12.2? >=20 >=20 zstd would be interesting=E2=80=A6 =20 rgds, toomas From owner-freebsd-current@freebsd.org Mon Jan 25 22:08:53 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B223A4F3D18 for ; Mon, 25 Jan 2021 22:08:53 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-wm1-x336.google.com (mail-wm1-x336.google.com [IPv6:2a00:1450:4864:20::336]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPkXj0dzJz3hdp for ; Mon, 25 Jan 2021 22:08:52 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-wm1-x336.google.com with SMTP id e15so992713wme.0 for ; Mon, 25 Jan 2021 14:08:52 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:from:to:references:message-id:date:user-agent:mime-version :in-reply-to:content-language; bh=j55MbzB0ZEmVLzE3w7BjPQuEXJsKULKhbTN+FjZTJOI=; b=cex+/xf2zy/kMpxYXOzEIkm11GprLommcmKy3f5qkty45XU+JC+g7KYB4W2HZNW/59 bikagJ7fthVWQjcpUriSrNA1zHwBgyhAE1PxRBMPR7dHYVE0aLyJOjsx9lqX3YD2uzJh ceyvGRxgFh0YmpEsN1R3Xnk3cneJfZBvuHJLwHlImJWEdfUCbVYry6hl5c5Cx3tgCtCy 1F02TvmNw1ExKl/QGzgyxR++f+iAPwskOx2SiVS+If7BSOqzoGe+y8Y/+/rRC1WgRvol RCIJU6ykCWZjkpvOFVnrUihx0OdVx5NbMs7JtWU+U1SGpEyI1Y1JLWmdu3dhN7WLL6H/ 4I1g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:from:to:references:message-id:date :user-agent:mime-version:in-reply-to:content-language; bh=j55MbzB0ZEmVLzE3w7BjPQuEXJsKULKhbTN+FjZTJOI=; b=p9lJWJPi5qdjXBGRws/7rdDL+UPec8VNEDR5KS0Z2LgDzPhoLV73qtmP/NzCffhCOU v7q9sU7HaDQHH5gCAo3GfzzPervVVdJIfNfK/UV/OlIMlLtKgO+21uMR1bPakM+tRpR6 oBLCTrzxABFncjgt9q9K9tOFry7NtlZUQosg+zv/oxmZjQ8Px1V9hoA4iZY2KXIrg5Ud taljO1cDTRwUtbPGoFRI6Q1+dWc8dL3LBNC0ItCEDoajcjHdxHmdffdWpieENCF3oiDO J708av4bLP6zQ2v2JLBs3IntJDBjQGPuOYJI22Cjp+xFG6b2+Qp/CPzdfYIYJ3s/EzfG j2lQ== X-Gm-Message-State: AOAM5303tet4fi2X8WtbSYqXzjRmPttg/RAs4AhD4EN2LxI1rKVjTN2m jjyUwbtqs7b91bCCFsPYcw46EJWFvLWsVg== X-Google-Smtp-Source: ABdhPJxfK/7y194U3k/NX0JU9EREgwaDMB2bsw5WTcIaQQWBW3zYjfHkMHeRvDZm62YqovEzlhz+Qw== X-Received: by 2002:a1c:6608:: with SMTP id a8mr1914731wmc.132.1611612530673; Mon, 25 Jan 2021 14:08:50 -0800 (PST) Received: from [192.168.1.11] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id s23sm616150wmc.35.2021.01.25.14.08.49 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Mon, 25 Jan 2021 14:08:49 -0800 (PST) Subject: Re: FreeBSD-provided .vhd with VirtualBox: gpart I/O errors after resizing the virtual hard disk From: Graham Perrin To: freebsd-current@freebsd.org References: Message-ID: <1826b286-b7da-9fa0-989f-bba3bc1f88e4@gmail.com> Date: Mon, 25 Jan 2021 22:08:48 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Language: en-GB X-Rspamd-Queue-Id: 4DPkXj0dzJz3hdp X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=cex+/xf2; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::336 as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-2.28 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_EQ_ENVFROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::336:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::336:from:127.0.2.255]; MIME_TRACE(0.00)[0:+,1:+,2:~]; NEURAL_SPAM_SHORT(0.72)[0.723]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::336:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 22:08:53 -0000 On 17/01/2021 18:22, Graham Perrin wrote: > VirtualBox 5.2.44 r139111 on FreeBSD-CURRENT. > > 01. Add FreeBSD-12.2-RELEASE-amd64.vhd to a machine > 02. use Virtual Disk Manager to resize it to 2.0 TB > 03. apply, close > 04. boot single user > 05. gpart show /dev/ada0 > 07. observe reported corruption > 08. gpart recover /dev/ada0 > 09. I/O error > 10. gpart show /dev/ada0 > 11. no reported corruption > 12. shutdown -r now > 13. observe reported corruption: > > > gptboot: invalid backup GPT header > > > > For me, this seems to be consistently reproducible. > > Thoughts? > > Boot proceeds and I guess that the > UFS file system is automatically grown, but the reported I/O errors > make me nervous. > > % uname -v > FreeBSD 13.0-CURRENT #75 main-c572-g82397d791: Sun Jan  3 20:00:09 GMT > 2021 > root@mowa219-gjp4-8570p:/usr/obj/usr/src/amd64.amd64/sys/GENERIC-NODEBUG > % > With FreeBSD-provided 'FreeBSD-12.1-RELEASE-amd64.vhd', things seem even worse. Please see, for example, this screen recording: What's going wrong? Is it necessary to boot first from something _other_ than the resized disk, for things such as gpart recover to proceed without I/O error for the resized disk? From owner-freebsd-current@freebsd.org Mon Jan 25 22:24:20 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 843594F4483 for ; Mon, 25 Jan 2021 22:24:20 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (phouka1.phouka.net [107.170.196.116]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "phouka.net", Issuer "Go Daddy Secure Certificate Authority - G2" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPktW4qRNz3jQ0 for ; Mon, 25 Jan 2021 22:24:19 +0000 (UTC) (envelope-from warlock@phouka1.phouka.net) Received: from phouka1.phouka.net (localhost [127.0.0.1]) by phouka1.phouka.net (8.16.1/8.16.1) with ESMTPS id 10PMN1P4056332 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Mon, 25 Jan 2021 14:23:02 -0800 (PST) (envelope-from warlock@phouka1.phouka.net) Received: (from warlock@localhost) by phouka1.phouka.net (8.16.1/8.16.1/Submit) id 10PMN1DF056331; Mon, 25 Jan 2021 14:23:01 -0800 (PST) (envelope-from warlock) Date: Mon, 25 Jan 2021 14:23:00 -0800 From: John Kennedy To: mike tancsa Cc: freebsd-current Subject: Re: ZFS feature compatibility? Message-ID: References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> <1fddab2c-f8bc-4f5e-d2b5-a32442786f3e@sentex.net> MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <1fddab2c-f8bc-4f5e-d2b5-a32442786f3e@sentex.net> X-Rspamd-Queue-Id: 4DPktW4qRNz3jQ0 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of warlock@phouka1.phouka.net has no SPF policy when checking 107.170.196.116) smtp.mailfrom=warlock@phouka1.phouka.net X-Spamd-Result: default: False [-0.80 / 15.00]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.170.196.116:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[phouka.net]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[107.170.196.116:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FORGED_SENDER(0.30)[warlock@phouka.net,warlock@phouka1.phouka.net]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MIME_TRACE(0.00)[0:+]; FROM_NEQ_ENVFROM(0.00)[warlock@phouka.net,warlock@phouka1.phouka.net]; ASN(0.00)[asn:14061, ipnet:107.170.192.0/18, country:US] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 22:24:20 -0000 > Thanks, I am new to the EFI world. Does the name now have to be > BOOTx64.efi ? > > root@zoo2:/boot # ls -l /mnt/EFI/freebsd/ > total 824 > -rwxr-xr-x 1 root wheel 843776 Nov 21 10:50 loader.efi > root@zoo2:/boot # I don't know. This came out of an email thread I had a while ago: Date: Thu, 9 Jul 2020 14:18:54 -0700 From: John Kennedy To: Kyle Evans Cc: FreeBSD-STABLE Mailing List Subject: Re: 12.1p7 no longer boots after doing zpool upgrade -a The "new" documentation was here: https://wiki.freebsd.org/UEFI The older stuff is still mentioned here: https://wiki.freebsd.org/RootOnZFS/GPTZFSBoot From owner-freebsd-current@freebsd.org Mon Jan 25 22:48:07 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 777624F5115 for ; Mon, 25 Jan 2021 22:48:07 +0000 (UTC) (envelope-from tsoome@me.com) Received: from pv50p00im-zteg10021401.me.com (pv50p00im-zteg10021401.me.com [17.58.6.47]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPlPy3ys0z3mJW for ; Mon, 25 Jan 2021 22:48:06 +0000 (UTC) (envelope-from tsoome@me.com) Received: from nazgul.lan (148-52-235-80.sta.estpak.ee [80.235.52.148]) by pv50p00im-zteg10021401.me.com (Postfix) with ESMTPSA id DFC85480365; Mon, 25 Jan 2021 22:48:03 +0000 (UTC) From: Toomas Soome Message-Id: <25414B7E-70F0-4B91-BB39-5BA994C0BF0B@me.com> Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: ZFS feature compatibility? Date: Tue, 26 Jan 2021 00:48:01 +0200 In-Reply-To: Cc: mike tancsa , freebsd-current To: John Kennedy References: <28fbf9cd-0f56-f6a0-1ddf-186aeed59b95@protected-networks.net> <9e183db9-2ca5-a7bd-2665-cc468d4b69db@sentex.net> <207F268A-30E3-45BE-9377-79C3DC31C328@me.com> <1fddab2c-f8bc-4f5e-d2b5-a32442786f3e@sentex.net> X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-25_10:2021-01-25, 2021-01-25 signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 malwarescore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1015 mlxscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-2006250000 definitions=main-2101250114 X-Rspamd-Queue-Id: 4DPlPy3ys0z3mJW X-Spamd-Bar: / X-Spamd-Result: default: False [-0.58 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[me.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:17.58.0.0/16]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[me.com:+]; DMARC_POLICY_ALLOW(-0.50)[me.com,quarantine]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[me.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[17.58.6.47:from]; ASN(0.00)[asn:714, ipnet:17.58.0.0/20, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[me.com:s=1a1hai]; FREEFALL_USER(0.00)[tsoome]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(0.92)[0.920]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; DWL_DNSWL_NONE(0.00)[me.com:dkim]; SPAMHAUS_ZRD(0.00)[17.58.6.47:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[80.235.52.148:received]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[17.58.6.47:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[17.58.6.47:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 22:48:07 -0000 > On 26. Jan 2021, at 00:23, John Kennedy wrote: >=20 >> Thanks, I am new to the EFI world. Does the name now have to be >> BOOTx64.efi ? >>=20 >> root@zoo2:/boot # ls -l /mnt/EFI/freebsd/ >> total 824 >> -rwxr-xr-x 1 root wheel 843776 Nov 21 10:50 loader.efi >> root@zoo2:/boot # >=20 if there is no UEFI bootmanager configured (see man efibootmgr), then = (ESP) efi/boot/bootx64.efi is default. with efibootmgr(8), you can = configure custom path, such as (ESP) efi/freebsd/loader.efi rgds, toomas > I don't know. This came out of an email thread I had a while ago: >=20 > Date: Thu, 9 Jul 2020 14:18:54 -0700 > From: John Kennedy > To: Kyle Evans > Cc: FreeBSD-STABLE Mailing List > Subject: Re: 12.1p7 no longer boots after doing zpool upgrade -a >=20 > The "new" documentation was here: >=20 > https://wiki.freebsd.org/UEFI >=20 > The older stuff is still mentioned here: >=20 > https://wiki.freebsd.org/RootOnZFS/GPTZFSBoot >=20 > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to = "freebsd-current-unsubscribe@freebsd.org" From owner-freebsd-current@freebsd.org Mon Jan 25 22:57:16 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 123854F567D for ; Mon, 25 Jan 2021 22:57:16 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from out4-smtp.messagingengine.com (out4-smtp.messagingengine.com [66.111.4.28]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPlcW23nXz3nL5 for ; Mon, 25 Jan 2021 22:57:15 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by mailout.nyi.internal (Postfix) with ESMTP id 46DDF5C018C for ; Mon, 25 Jan 2021 17:57:14 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute1.internal (MEProxy); Mon, 25 Jan 2021 17:57:14 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:references:mime-version :content-type:in-reply-to; s=fm1; bh=dzW6+eNdxf9aXFFIN90AOS84lRO F2JnIMMKunbSdpWc=; b=OoXgRXwM0WMzQQS2BbiLogv7U+KKKNN5a76HCkdhqHW 2+0JiBDQjOq+dfh81r+2FJdH1Jyd2IxSvpEj84GEeVxE6NqSdIY8VGvDiv0usQrP hw4KOFTFaePgGgSFluSv9rtw/ZE2bXg5zJcwLrKqbcrr76yFyjaHScJTFOlzcnX7 5816XYtUTF1SjeMkp4Hei6C66ICHeYh3qmsQnAvMFQlGnCh468uaUZm0nTKOPjnU S0p32SjkkaylPou+KT/Gaa3F2yjl9YukK0YMFhpLGn6F6ZvsCHxV1hBomW8zo1Lq 6ssSYWxsNqjduy9FLBoRJqoX9TE9+Q/tAU3kH9HAuSw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm1; bh=dzW6+e Ndxf9aXFFIN90AOS84lROF2JnIMMKunbSdpWc=; b=byez4EgejUYpyd4QzSv9gm FUBZLdwSNpY3aI//W+IYACWCLq2I4aXx8TDK6hWWykcDb46YFglI9H+RPgvJEw/M GgG5ZX7xntCllOViwsawKU2FwcDxMmKalL+0DPD3ZpzLstKz/wPox2og2g7hEvOr RFIladIngLtfpT7OY01M3eOeciWMKltgZfd5Cd7dOArIaWMckKk5tVUT8SSPil23 MBeFNYtHZ0a5RrrC5a/I07ztuIILLgpVZxdEeTzzX2kir+dsQY50KQ6Po+srl+Bt dolC8aBabGQykbF50EW5XIC7Q4cSdIK/H3Af7MigLA466duxgEOm+Cj9aAR7qZYw == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduledrvdeggddtvdcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfhfgggtuggjsehgtderre dttddvnecuhfhrohhmpehtvggthhdqlhhishhtshcuoehtvggthhdqlhhishhtshesiiih gihsthdrnhgvtheqnecuggftrfgrthhtvghrnheptedttdduuefggeeghfekkeetkeejle efffelheejfffgffdtfeeftdejgeeuieffnecuffhomhgrihhnpehfrhgvvggsshgurdho rhhgnecukfhppeekvddrjedtrdeluddruddtudenucevlhhushhtvghrufhiiigvpedtne curfgrrhgrmhepmhgrihhlfhhrohhmpehtvggthhdqlhhishhtshesiiihgihsthdrnhgv th X-ME-Proxy: Received: from desktop (fws.zyxst.net [82.70.91.101]) by mail.messagingengine.com (Postfix) with ESMTPA id B1AA3240062 for ; Mon, 25 Jan 2021 17:57:13 -0500 (EST) Date: Mon, 25 Jan 2021 22:57:11 +0000 From: tech-lists To: freebsd-current@freebsd.org Subject: Re: Getting /usr/src to match specific git hash? Message-ID: Mail-Followup-To: freebsd-current@freebsd.org References: <20210124035852.GA73653@troutmask.apl.washington.edu> <20210124.130805.532159532765637026.yasu@utahime.org> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="r/ZhGAND02hHtMOF" Content-Disposition: inline In-Reply-To: <20210124.130805.532159532765637026.yasu@utahime.org> X-Rspamd-Queue-Id: 4DPlcW23nXz3nL5 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm1 header.b=OoXgRXwM; dkim=pass header.d=messagingengine.com header.s=fm1 header.b=byez4Ege; dmarc=none; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 66.111.4.28 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-4.20 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[66.111.4.28:from]; R_SPF_ALLOW(-0.20)[+ip4:66.111.4.28]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[66.111.4.28:from]; ASN(0.00)[asn:11403, ipnet:66.111.4.0/24, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_IN_DNSWL_LOW(-0.10)[66.111.4.28:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm1,messagingengine.com:s=fm1]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[zyxst.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[66.111.4.28:from:127.0.2.255]; RCVD_TLS_LAST(0.00)[]; MID_RHS_NOT_FQDN(0.50)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 22:57:16 -0000 --r/ZhGAND02hHtMOF Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: >From: Steve Kargl >Subject: Getting /usr/src to match specific git hash? >Date: Sat, 23 Jan 2021 19:58:52 -0800 > >> Suppose one has an empty /usr/src. >> >> Suppose further that one had to re-install a 32-bit >> i386-*-freebsd with the 24 Dec 2020 image available >> from freebsd.org. >> >> uname -a for the booted kernel shows >> >> % uname -a >> FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ >> 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ >> root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC i386 >> >> How does one use git to pull the exact sources that match >> this specifc kernel? > >cd /usr >git clone https://git.freebsd.org/src.git >cd src >git checkout 3cc0c0d66a0 I have the exact same issue. The installation I have is: 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC 2020 The method described doesn't work for me for some reason: [...] root@rpi4:/usr # git clone https://git.freebsd.org/src.git =20 Cloning into 'src'... remote: Enumerating objects: 377505, done. remote: Counting objects: 100% (377505/377505), done. remote: Compressing objects: 100% (26583/26583), done. remote: Total 3831969 (delta 371848), reused 350922 (delta 350922), pack-re= used 3454464 Receiving objects: 100% (3831969/3831969), 1.14 GiB | 6.28 MiB/s, done. Resolving deltas: 100% (3034679/3034679), done. Updating files: 100% (85162/85162), done. root@rpi4:/usr # cd src root@rpi4:/usr/src # git checkout 2ed50808d2b =20 error: pathspec '2ed50808d2b' did not match any file(s) known to git thanks, --=20 J. --r/ZhGAND02hHtMOF Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAmAPTL0ACgkQs8o7QhFz NAVnSxAAg3I5sS3aP9eLpvBLegdL1Ffh+x3kQTSJaxKwa6R8vnTnMdhRjQl5+K1J TAvgmtXGwBbFAIPYqZJ0BAYifhJwnK2R7/Hn39Edlz9rZScq7//Dv2pr9b7ZOtxJ gNyPtxeAfwr01vk86UECixgtl7GMMBRdXl4jUhWwoVG2eJh7fBXNl8fm1/GLVxpN l9ZkQY5Af3T08V0nNgUqooxlzTSIWR9pn3Jjcr0kxhYAZ1a6QZTrXODXNpoJGujl vv7Tl96OMMZjqvEaQH4DSJ8TBnLYUGZ8l/vsj0BhKsEQQOtrm43weMQoJnyWViZN oU8hS90kcCL7eKFygAg+/oi4gm7di+nr53O/NCyG7CJs+b7jzWsAEX7hV6hvQvyP NxcG0wEyryX8z99AaMedoXCF628qiyGB+rUfVX8HcmUsR6tAHxAv/H2Fcl9+Ou57 aVBqxDla3tXc6u0/Nm0O8DN4B8QJ2XFzIzu+0h1P/gEYDCyte7UW4hztU9qh9FDy KWr+0sMrJ1rOg+MCTyNoc8izl/EdyV2e07bTPY5IhTR3EDRsMKyt0O4jRxSLNCkV n5la3FJpEs9ggmu4kWN3laOrRqEUzJeDlqHTacMsxIqPVrhbszL/x2qIhTdMs9rN IDnViLFA0dFl8WPspxqAzLOwyNvU9H9p8rYx5e2AJcFuaqALjvg= =ikLn -----END PGP SIGNATURE----- --r/ZhGAND02hHtMOF-- From owner-freebsd-current@freebsd.org Mon Jan 25 23:04:27 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9F20E4F5A66 for ; Mon, 25 Jan 2021 23:04:27 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-qt1-x833.google.com (mail-qt1-x833.google.com [IPv6:2607:f8b0:4864:20::833]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPlmp6ZsXz3p4B for ; Mon, 25 Jan 2021 23:04:26 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: by mail-qt1-x833.google.com with SMTP id d15so10985954qtw.12 for ; Mon, 25 Jan 2021 15:04:26 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=6rL+DdOtKldLkoTeoW73t35iBkofZdvP+pjc9AMK1o8=; b=zO6Ai0uGIR4L9mojGRPAhm1a1k9EM51NZoew40Vkv3h0LDsW8teFWLFFdGSmNpiQjz ZBIb7maknygCGBJ8R27TMm+yVwEg9MIzf4TEgIXzfBRN26LoTUAIUjyhvG5piq+u1K/D +2Ig2xaT2APr22cMWQJnsypfH5p3OnQFfYIrTH+P+UwMOXiwaNmVQMcW18Q4FuBR8pWj PCEmKGgbk+ILzkkV97gvZ+NUIUwRuQtxkljqn/OeE7ocDWA32f+4Yr7BMJGtjKOavkRA lU4MpxRCwK4LpgdwHj2Bo2/Z77ArEApp16bW9MTwJTE/EXi+c4j8QnZOWWu2IJZuripy NVMQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=6rL+DdOtKldLkoTeoW73t35iBkofZdvP+pjc9AMK1o8=; b=PMFxtLGmhjxd01vvBWhBLev5Cp9suu+CnJbf0KdJ7zGTMV8UwdwStqIzT8dQ+fAa0v Mpaggu6TK8FqAEvA4ThA6kIXqSKI+NeoVYTkqoc3BYk4jO/flJ0W9w8D6LauTugc//tH hkBt3kw+p78qmxWhAiWgtGoD3/5yH9fQFPzyrCR5MzUhIDeKLpqlo5JEkT9KfCZ1wex3 sqdNl8gAmQp8OOz9c+46zxKSDTrX/rEosaRZV3KbHhJfac3RWhdLbgG2uykKBnL1Mw6t ++64tfrlTTH9HQao0nb4WRTkqkpjRp8fCuCCJi5V22K4R4dG+rJ4uA0AaCozfzsmfu0i T2ew== X-Gm-Message-State: AOAM530QvTSEpgepuCFxzEm4FM8bSTos8sotvC0ZCZSDtcSDCkO6Om5U W6fn+hOnxkcqqWYc3uY0c1SrQOmaKlhJxYoR99WOzkPHp/fSgw== X-Google-Smtp-Source: ABdhPJyuW0WwVDsn1LnsP2vcjHspI0uVJ1kird/ULsUoqO4JrjIiuvFEcu++wn/4kkNv2RutV6T/fQ3AjYBk+DT+Tkw= X-Received: by 2002:ac8:72cc:: with SMTP id o12mr2770072qtp.101.1611615865570; Mon, 25 Jan 2021 15:04:25 -0800 (PST) MIME-Version: 1.0 References: <20210124035852.GA73653@troutmask.apl.washington.edu> <20210124.130805.532159532765637026.yasu@utahime.org> In-Reply-To: From: Warner Losh Date: Mon, 25 Jan 2021 16:04:14 -0700 Message-ID: Subject: Re: Getting /usr/src to match specific git hash? To: FreeBSD Current X-Rspamd-Queue-Id: 4DPlmp6ZsXz3p4B X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20150623.gappssmtp.com header.s=20150623 header.b=zO6Ai0uG; dmarc=none; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2607:f8b0:4864:20::833) smtp.mailfrom=wlosh@bsdimp.com X-Spamd-Result: default: False [0.98 / 15.00]; URI_COUNT_ODD(1.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20150623.gappssmtp.com:+]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::833:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.89)[-0.893]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20150623.gappssmtp.com:s=20150623]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.97)[-0.972]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[bsdimp.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::833:from:127.0.2.255]; NEURAL_SPAM_SHORT(0.85)[0.849]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::833:from]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 23:04:27 -0000 On Mon, Jan 25, 2021 at 3:57 PM tech-lists wrote: > On Sun, Jan 24, 2021 at 01:08:05PM +0900, Yasuhiro Kimura wrote: > >From: Steve Kargl > >Subject: Getting /usr/src to match specific git hash? > >Date: Sat, 23 Jan 2021 19:58:52 -0800 > > > >> Suppose one has an empty /usr/src. > >> > >> Suppose further that one had to re-install a 32-bit > >> i386-*-freebsd with the 24 Dec 2020 image available > >> from freebsd.org. > >> > >> uname -a for the booted kernel shows > >> > >> % uname -a > >> FreeBSD mobile 13.0-CURRENT FreeBSD 13.0-CURRENT #0 \ > >> 3cc0c0d66a0-c255241(main)-dirty: Thu Dec 24 05:43:23 UTC 2020 \ > >> root@releng1.nyi.freebsd.org:/usr/obj/usr/src/i386.i386/sys/GENERIC > i386 > >> > >> How does one use git to pull the exact sources that match > >> this specifc kernel? > > > >cd /usr > >git clone https://git.freebsd.org/src.git > >cd src > >git checkout 3cc0c0d66a0 > > I have the exact same issue. The installation I have is: > > 13.0-CURRENT #0 2ed50808d2b-c254384(main): Thu Nov 12 10:03:35 UTC 2020 > > The method described doesn't work for me for some reason: > > [...] > root@rpi4:/usr # git clone https://git.freebsd.org/src.git > Cloning into 'src'... > remote: Enumerating objects: 377505, done. > remote: Counting objects: 100% (377505/377505), done. > remote: Compressing objects: 100% (26583/26583), done. > remote: Total 3831969 (delta 371848), reused 350922 (delta 350922), > pack-reused 3454464 > Receiving objects: 100% (3831969/3831969), 1.14 GiB | 6.28 MiB/s, done. > Resolving deltas: 100% (3034679/3034679), done. > Updating files: 100% (85162/85162), done. > root@rpi4:/usr # cd src > root@rpi4:/usr/src # git checkout 2ed50808d2b > error: pathspec '2ed50808d2b' did not match any file(s) known to git > For the archives, this is because this hash is from the old beta hashes that we got rid of. there's another thread that has all the details. Warner From owner-freebsd-current@freebsd.org Mon Jan 25 23:36:54 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E6B8D4F6888 for ; Mon, 25 Jan 2021 23:36:54 +0000 (UTC) (envelope-from mckusick@mckusick.com) Received: from chez.mckusick.com (chez.mckusick.com [70.36.157.235]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPmVG0mn4z3qWm for ; Mon, 25 Jan 2021 23:36:53 +0000 (UTC) (envelope-from mckusick@mckusick.com) Received: from chez.mckusick.com (localhost [IPv6:::1]) by chez.mckusick.com (8.15.2/8.15.2) with ESMTP id 10PNeCR4068248; Mon, 25 Jan 2021 15:40:12 -0800 (PST) (envelope-from mckusick@mckusick.com) Message-Id: <202101252340.10PNeCR4068248@chez.mckusick.com> From: Kirk McKusick To: Rozhuk Ivan Subject: Re: fsck strange output cc: freebsd-current@freebsd.org X-URL: http://WWW.McKusick.COM/ Reply-To: Kirk McKusick In-reply-to: <20210125232933.1ad108d1@rimwks.local> Comments: In-reply-to Rozhuk Ivan message dated "Mon, 25 Jan 2021 23:29:33 +0300." MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <68246.1611618012.1@chez.mckusick.com> Content-Transfer-Encoding: quoted-printable Date: Mon, 25 Jan 2021 15:40:12 -0800 X-Spam-Status: No, score=-1.4 required=5.0 tests=BAYES_00,MISSING_MID, UNPARSEABLE_RELAY autolearn=no autolearn_force=no version=3.4.1 X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on chez.mckusick.com X-Rspamd-Queue-Id: 4DPmVG0mn4z3qWm X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of mckusick@mckusick.com has no SPF policy when checking 70.36.157.235) smtp.mailfrom=mckusick@mckusick.com X-Spamd-Result: default: False [-2.10 / 15.00]; HAS_REPLYTO(0.00)[mckusick@mckusick.com]; TO_DN_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[70.36.157.235:from]; ASN(0.00)[asn:46375, ipnet:70.36.128.0/19, country:US]; R_DKIM_NA(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; FREEFALL_USER(0.00)[mckusick]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[mckusick.com]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[70.36.157.235:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 23:36:55 -0000 > From: Rozhuk Ivan > Date: Mon, 25 Jan 2021 23:29:33 +0300 > To: freebsd-current@freebsd.org > Cc: Rozhuk Ivan > Subject: fsck strange output > = > Hi! > = > I am on fresh 13 and on auto fsck got: > = > Jan 25 23:14:13 3des kernel: Starting file system checks: > Jan 25 23:14:13 3des kernel: /dev/gptid/81241708-8948-11e9-b1ae-049226c0= 61d6: CANNOT READ BLK: 11072 > Jan 25 23:14:13 3des kernel: /dev/gptid/81241708-8948-11e9-b1ae-049226c0= 61d6: UNEXPECTED SOFT UPDATE INCONSISTENCY; RUN fsck MANUALLY. > Jan 25 23:14:13 3des kernel: File system preen failed, trying fsck -y -T= ffs:-R,-r -T ufs:-R,-r > Jan 25 23:14:13 3des kernel: ** /dev/gptid/81241708-8948-11e9-b1ae-04922= 6c061d6 > Jan 25 23:14:13 3des kernel: ** Last Mounted on / > Jan 25 23:14:13 3des kernel: ** Root file system > Jan 25 23:14:13 3des kernel: ** Phase 1 - Check Blocks and Sizes > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 11072 > Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CONTINUE? yes > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: THE FOLLOWING DISK SECTORS COULD NOT BE REA= D: > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 5129280 > Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CONTINUE? yes > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: THE FOLLOWING DISK SECTORS COULD NOT BE REA= D: > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 6411520 > Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CONTINUE? yes > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: THE FOLLOWING DISK SECTORS COULD NOT BE REA= D: > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CANNOT READ BLK: 7693888 > Jan 25 23:14:13 3des kernel: UNEXPECTED SOFT UPDATE INCONSISTENCY > Jan 25 23:14:13 3des kernel: = > Jan 25 23:14:13 3des kernel: CONTINUE? yes > .... > = > Disk is 100% alive, got same on other HW. > fsck -y - have no this strange problem with reading. > = > Is it OK "CANNOT READ BLK ..." ? > = > = > >From my rc.conf: > fsck_y_enable=3D"YES" # Set to YES to do fsck -y if the initial preen f= ails. > fsck_y_flags=3D"-T ffs:-R,-r -T ufs:-R,-r" # Additional flags for fsck -= y > background_fsck=3D"NO" # Attempt to run fsck in the background where po= ssible. Please try this patch to fsck_ffs and see if it fixes your problem. Kirk McKusick =3D-=3D-=3D *** sbin/fsck_ffs/inode.c.orig 2021-01-07 15:04:04.969086284 -0800 --- sbin/fsck_ffs/inode.c 2021-01-25 15:29:06.404803358 -0800 *************** *** 611,618 **** sizeof(struct ufs1_dinode) : sizeof(struct ufs2_dinode)); readpercg =3D inosused / fullcnt; partialcnt =3D inosused % fullcnt; ! partialsize =3D partialcnt * ((sblock.fs_magic =3D=3D FS_UFS1_MAGIC) ? ! sizeof(struct ufs1_dinode) : sizeof(struct ufs2_dinode)); if (partialcnt !=3D 0) { readpercg++; } else { --- 611,619 ---- sizeof(struct ufs1_dinode) : sizeof(struct ufs2_dinode)); readpercg =3D inosused / fullcnt; partialcnt =3D inosused % fullcnt; ! partialsize =3D fragroundup(&sblock, ! partialcnt * ((sblock.fs_magic =3D=3D FS_UFS1_MAGIC) ? ! sizeof(struct ufs1_dinode) : sizeof(struct ufs2_dinode))); if (partialcnt !=3D 0) { readpercg++; } else { From owner-freebsd-current@freebsd.org Tue Jan 26 00:58:07 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B78894F83A8 for ; Tue, 26 Jan 2021 00:58:07 +0000 (UTC) (envelope-from rozhuk.im@gmail.com) Received: from mail-lj1-x22e.google.com (mail-lj1-x22e.google.com [IPv6:2a00:1450:4864:20::22e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPpHy2GPLz4Qqd; Tue, 26 Jan 2021 00:58:06 +0000 (UTC) (envelope-from rozhuk.im@gmail.com) Received: by mail-lj1-x22e.google.com with SMTP id l12so15105497ljc.3; Mon, 25 Jan 2021 16:58:06 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:date:to:cc:subject:message-id:in-reply-to:references :mime-version:content-transfer-encoding; bh=1gqkkZp29Rqf00b3L2pHBxxnaLhoc7qAhygMfHf2BKQ=; b=CZo+3C4dUD7kRj80MnvMyel/SLar6lsgP7L0z/N7tkRZrqmhvUbhUQ8q4z2eF1u71p bgGzg+W+fsUj11bIcLxdGGn8YNHIEU6ICpwxWAS/FH2P7qDW7y7YydCnVjOe4pZ9JsuE OYrmCdK9AU00bR+Wa/NLBorReDKNb7Juk+UiA/Kq51mAIaJYQ1+RnYMy7u5KZ5Ev0uoi boIN2w/+9t0wfrn7JVGgCMdgcYSeLLycrt5FSnDZYXY4+dawA7ISbOIMF1AIO3sKckwQ vyq7NdQ8BH8JFrrRIrfvbtsm7wV5Zcdi9vqVSEPPIrmH8I9UFHZmes3n7CMpmnCMzOf9 FDrA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:date:to:cc:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=1gqkkZp29Rqf00b3L2pHBxxnaLhoc7qAhygMfHf2BKQ=; b=EGRhykiAUXQ3oeTA4dQHWbUgxzVH6TPciJAQs3PW4BTGKWVg78Bv2pNU5wN2eT+wLD 0q6LgI/w9Asmqqm2g8RHxC0Xt9iBRdb6R5/aSVcRoLI4pYGSMzIzBd3UPrJ5Sopgor5q u8HsbX3iRb2+cwxadMeu5/UIfU96VUqjHot5sh31cTFd2zTme1zH4eSBzOHCQANnC0yX nCihnZEi8iaWXEyigXVZLfeLDnX+Xe+ZP04yuJg6KjGg+C6Zx0qgyU/qdpgsmdZMyBwN RzJnWfCDtr45W2MzapqkCDkhiEPU3gELRwmA/31siFMfspzvnklSNutp3Ohjg034fxnj txQg== X-Gm-Message-State: AOAM531clzv25hxPnjb5tCgWu2ivXQNGgvdWg56obgbkiGMDAN4muBfT n8smhU6Kwm0cowENRMgn357xt2HoDCc= X-Google-Smtp-Source: ABdhPJyiG98EFrXbQ6fLlYAZQLKnyUMZ1dmh05IgfIDUfIGyqZJJLyz/Pw+VUswDgm7KB9TiLkvzng== X-Received: by 2002:a2e:b4a7:: with SMTP id q7mr1482665ljm.391.1611622683857; Mon, 25 Jan 2021 16:58:03 -0800 (PST) Received: from rimwks.local ([2001:470:1f15:3d8:7285:c2ff:fe37:5722]) by smtp.gmail.com with ESMTPSA id z6sm2721689ljz.71.2021.01.25.16.58.02 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Mon, 25 Jan 2021 16:58:03 -0800 (PST) From: Rozhuk Ivan X-Google-Original-From: Rozhuk Ivan Date: Tue, 26 Jan 2021 03:58:01 +0300 To: "Poul-Henning Kamp" Cc: freebsd-current@freebsd.org, Kirk McKusick Subject: Re: fsck strange output Message-ID: <20210126035801.4cddd775@rimwks.local> In-Reply-To: <68616.1611607910@critter.freebsd.dk> References: <20210125232933.1ad108d1@rimwks.local> <68616.1611607910@critter.freebsd.dk> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DPpHy2GPLz4Qqd X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=CZo+3C4d; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of rozhukim@gmail.com designates 2a00:1450:4864:20::22e as permitted sender) smtp.mailfrom=rozhukim@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::22e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::22e:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::22e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 00:58:07 -0000 On Mon, 25 Jan 2021 20:51:50 +0000 "Poul-Henning Kamp" wrote: > > Disk is 100% alive, got same on other HW. > > A disk can be alive and still have individually unreadable sectors, > that is, IMO, the most common failure mode. > > Try: > recoverdisk -v /dev/whatever > > That will attempt to read all sectors on the disk. > This happen on 4 different systems, that: - based on Ryzen zen/zen+ - FreeBSD 13 2 systems have ECC that works and show no errors. At least on 12 and prev on read error - kernel show messages from drivers/geom. recoverdisk -v - show no error. I can reproduce this in VBox after disable "soft update journaling". (I hope that you will not require from me to check VBox HW too :) ) VBOx - no "CANNOT READ BLK": # tunefs -p /dev/ada0p2 tunefs: POSIX.1e ACLs: (-a) disabled tunefs: NFSv4 ACLs: (-N) disabled tunefs: MAC multilabel: (-l) disabled tunefs: soft updates: (-n) enabled tunefs: soft update journaling: (-j) enabled tunefs: gjournal: (-J) disabled tunefs: trim: (-t) disabled tunefs: maximum blocks per file in a cylinder group: (-e) 4096 tunefs: average file size: (-f) 16384 tunefs: average number of files in a directory: (-s) 64 tunefs: minimum percentage of free space: (-m) 2% tunefs: space to hold for metadata blocks: (-k) 1600 tunefs: optimization preference: (-o) space tunefs: volume label: (-L) VBOx - "CANNOT READ BLK" is present: # tunefs -p /dev/ada0p2 tunefs: POSIX.1e ACLs: (-a) disabled tunefs: NFSv4 ACLs: (-N) disabled tunefs: MAC multilabel: (-l) disabled tunefs: soft updates: (-n) enabled tunefs: soft update journaling: (-j) disabled tunefs: gjournal: (-J) disabled tunefs: trim: (-t) disabled tunefs: maximum blocks per file in a cylinder group: (-e) 4096 tunefs: average file size: (-f) 16384 tunefs: average number of files in a directory: (-s) 64 tunefs: minimum percentage of free space: (-m) 2% tunefs: space to hold for metadata blocks: (-k) 1600 tunefs: optimization preference: (-o) space tunefs: volume label: (-L) 5cc52631b3b88dfc36d8049dc8bece8573c5f9af [PATCH] Rewrite the disk I/O management system in fsck_ffs(8). Other Since this commit this issue started. I check: build system from prev commit - OK, build from this - "CANNOT READ BLK". From owner-freebsd-current@freebsd.org Tue Jan 26 03:14:59 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8F3AA4FCEBC for ; Tue, 26 Jan 2021 03:14:59 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic305-21.consmr.mail.gq1.yahoo.com (sonic305-21.consmr.mail.gq1.yahoo.com [98.137.64.84]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPsKt4RRYz4c7S for ; Tue, 26 Jan 2021 03:14:58 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611630896; bh=BhzlfE0ayXIlhZ4sTl5z6D3K9dV96ZgjFcCUP/ZAhjj=; h=From:Subject:Date:To:From:Subject:Reply-To; b=rpVDs0D6CHCkpxI+Etvnb7Uj/+pE9nhfX/+J37Don7ab6twQLwwewlMBxGyFPaAu6fI7p6+HJ2JrXJkmbiCuHVbPGXHwd8qKRcC8GLWKZuicyzmN4eNQ5Hvzp+sumLFJTKIjOejEp77a5O1xVVYr7iynOG20HVwpGSPgdSiTRdkGbhKyaDzhX6l+6/5nJMqjMzN86bKtUpqV5QlzJZL8uHqGSyYm8iHGuUKIez2ZRTdnTMFjrMaSxtLUdT9qdapS4C7X+VlM9xb6wKkLBtFzf455/m0nCWf3v52hrPkaScgIMt5ZHXgBGpbnzXpvByNHoXSCwnwN1ptf56bsdv6PAw== X-YMail-OSG: WnDuI6QVM1m64eLnb5HzEycnW0kXUwx_8.2lz3hgxPOkvw621GtykJOizZx4RGX DZi_C5Rwp6V1X.QHR9h9eD.H3ai2mul2koyYBqdduV3nmax.D9buJw3hkvgfKLhjDUeHkYvA4zs9 XLdyI8V77ovpDaRGospb_UlJlqQ17eMlQYUabe8YFavvnChviW0PQSgSKGrRCN.fw5NT5Du1t7ym jcfUeRoWtrFBDjHH2jsbYWTBdDo22zw9C.5K2gcAOtr086QisrS2HK6ynhS9LhBvW7Zix7Q2Wgi_ mT82D_bD9A8_rH19cpWaoxNqjXFg1wAujvVg2Ii1d514K2PgzOgJlOiY69F555YNKNQIWRAetsCn UaC2VNSkGQck_nfXit82.MIK.uA4wTF9rITb2WJR2UFMy8PljTXqSxHUr8eKZ4uWU7vywvQgjaV6 FEgipCV6iMf76UByWVDwuwmCKZ0EJAN9wHruKxR7_EaMUaJadvKFNMYIiTDEk2p6U7gP1wRmx1wk bts9WTSTIlvXoC0U3N.c3ZXf62VxpTivslzX.DDUWNUxz2yNgjOKuAj7M6uyehHG2HRiZv49nG_G bEtejO0prk9MdDHgnFc4xp36l16lVTXXRH4lsor5i7wPlXcJI2YJX1i.DLQsCDnDt8PBJpp0JyXx 9WkOAjZbxvUJOLvEhbAvEJVDHperJL3vDMegIQFF5yq.KVuVJGiTEtfk.MXpNg_GbyK4YCzXrOod ifxMHox_qImURh9cLjhJCx2ACGWfYhJQTfS_CpVc9wKyLduFrwveC6Ego1Qyv_OZHQMr6i3DUmGM Wa4XWmgD_8O8SklGIzTBDr7ib2ROXnnp2OoUShyfQBPLnl9yntjWyibLd.l8OC2cU7z_ZtXcalY9 nrTvfp07zCbIv6lWL0CBKoezHxZJgR9XHbnuijiXCZ0SoPWyjVR0RlQsg4OcyhPmfOrHYd9MSLOW JWiViNt1MO4YneX6dnLowbQg72BweoamHKXPAIr7jsBYrHJ1jwqUzpHgS5NXjyTEfXHRWr.SDRyn dt6fwFqJaSuR1RGlbPHHie1TXqfKUtIqQ82DiMLiy7JW_n0IoI1yDEsllPDnU3HcCi2dDa48q_da g4qjw.vJwCvTLCPWGpXZMi5fvI226Hxx9kFckY9B635DamM6BUrQPARhvhh8QBtVCuUVByBDcKjP 74o7JgdojNA2mzdubQ8M8YHKzDpUUuIEjKunAws0I6lOxBp7p4zUEpHe0WY4.HpvpOnWEzl6BfS4 PR75SCyuQI0o9cOp.PsPy4UGCUjF5ZkYMK5_l.uoymWKeFiKy1xm85.41nC6uKjJJqr8fcpJge4Z wT_mGERWG59rbi8Kv.Hg92xFemLIrHDRbPwhoquGdg0Y9oCJu3OYAXh2Hq.oJMRR2vst8xFbE3WU fTD5G7mfTP8wKiAdLPDnV_I.pU5SSymAiTTGWqTuvd2SJuTTYa4GGxEwSYvxi6bFKe.wBeev3HkB sY4rUja4Za.ileK.K4G1Je9ITKfkKNd3Vk5Wm6H810OAHdkhM_QnKLtIbpQ6jtgBozxnW7Pu8Ugc SNZtZ_Qhcq358DQieKCw2m8uVa9a.OZ3bsED2k.OcxBtvHWLqJ1oWfeIx6.pvov6W9ekCnON24Ry CYXjNVwJgHhdTlh2T71_ftkdTCQl_UB0lnN5sGG4YuggpEcSBNxTV_GsrXGaL93SO7OzGMim.ipi edOoutQj_q3XHPuqaOQPvOStrUIJYPKatFtMGhwuFHTdYVK9gZtR8wByBrjBPKQE5BgYI4zfn55T eyvPia0qVntwHukJ24GSUUSfjsnKIRXdQyCRyflLIQjeWM5HT6OaSh0VMY2faG34aYjvS3oleVer DwzaHbPHvH7LGKJWhuPRwxCWQn_hpEE6D4OaVeKcq9oIhLQB22lZRg_axMlVVyVTwle0Cgpf.kcE hSJARbW49SXSKhT6.sG2EyeOYJbC.krj4c5wfgnaPvqgmbB2UE6YK8BoE41ybSaHwjGB.hhp68Ai D7vYWJbBqfjQsEfgCgWhylHpL4oqx7iHARRbsBUn.0Asl97sP5fh4U6dy1p_VpOcWHUJ5D33jvVJ n1rVwTxNlIi9oX8KU9UtAzo6kxApOo2dCpniEqmb4TsTEZxNjH6uc.G9Jrn6AWJv.J3i8XD3KDhY IKctmqPAhjwvB_wPuiCvBFu95PXfP0i7z0m1swYDI5WRShsopgGDLrdHncNufU8aBhVhziVm0HCA KRca7ziJh_Gj6tFw4zdwHhdv0JzdfMvsCF4iOD4_GwOI0SdklhdhcNCp7jSWvhmlG62.UBV66h2Z B3B8c_inBcSMxxKvpSc3TlTnakz.IPPFL1o7qo_S4mShdUfjDYpNtiBpFttU15rosNgJdcibr_F. eYskUlI.lqVhvoqdTBQRaYj2v06gGuIEpT.E5s3ExQgPdHwHMz0zMf5LRC80w6mihC0v8NIxSPsW MOZTywa7OTuiFwxT0ipg5ew-- Received: from sonic.gate.mail.ne1.yahoo.com by sonic305.consmr.mail.gq1.yahoo.com with HTTP; Tue, 26 Jan 2021 03:14:56 +0000 Received: by smtp422.mail.gq1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 38e2a8cbce17b6afbe3e8bb7a1053330; Tue, 26 Jan 2021 03:14:54 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: pkg for 14-current Message-Id: Date: Mon, 25 Jan 2021 19:14:53 -0800 To: Philip Paeps , Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: X-Rspamd-Queue-Id: 4DPsKt4RRYz4c7S X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.84:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.64.84:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.84:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.84:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 03:14:59 -0000 Philip Paeps philip at freebsd.org wrote on Mon Jan 25 21:40:03 UTC 2021 : > The first package build for 14-CURRENT is visible on the mirrors now = (as=20 > of a couple of minutes ago). It has been a bit so I tried and it failed for what I tried so I looked at http://pkg.freebsd.org . It reported: QUOTE This is pkg0.tuk.FreeBSD.org - a West Coast, USA mirror for FreeBSD = downloads. END QUOTE But nothing with FreeBSD:14 was listed on the page. So I explicitly tried: http://pkg.freebsd.org/FreeBSD:14:i386/ http://pkg.freebsd.org/FreeBSD:14:amd64/ http://pkg.freebsd.org/FreeBSD:14:aarch64/ http://pkg.freebsd.org/FreeBSD:14:powerpc64/ and only the first two were found. I checked those 4 because of previously having looked at https://pkg-status.freebsd.org and what it then reported as building or having been built with a main- prefixed Jail name: main-amd64 , main-i386 , main-arm64 , main-powerpc64 . It looks like the main-arm64 build that is active started before stable/13 was created. It looks like the main-powerpc64 build is older (and it finished) and there will not be powerpc64 materials until a new build is started and it completes. I did not see evidence of Jail names like main-armv7 , main-armv6 , main-mips , or main-mip64 . So I assume that those are not being experimented with yet. =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Tue Jan 26 03:21:19 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 536524FD53A for ; Tue, 26 Jan 2021 03:21:19 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id 4DPsTC12qRz4cYb for ; Tue, 26 Jan 2021 03:21:19 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 23BAA4FD235; Tue, 26 Jan 2021 03:21:19 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2384D4FD234 for ; Tue, 26 Jan 2021 03:21:19 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPsTB73yHz4cbk for ; Tue, 26 Jan 2021 03:21:18 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1611631277; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=BHbmKsEbfffPpEBme6MtwFJg/O4=; b=V4VjliPl0uRkYmGdIwP717Q5gBGmgguwMUm8qV22PRl6wVzKDB1MO0nYAR0sLbR8 bXPLrGqn3dGlIEHauTq3qxR+n5Z9LoD79ecXV24gl+OS2o/451VdSVcvD/tCRXZp 8fh3HswoOAZ/4rxzPE4DyGUrmC883VbZ1OyiR1DC7/TelkQuFjJ0OogXF0PXJz1W dE869MaIlRaVJr0XP2QqhN75ssR8R1UbST3vPmPUwEbprVd3L5Qi121zM2cBZvym /bQ9YqF02D199242OFmygoi/JGUq51TxLAF/TYZB7pA6DIV88+gw4NXMzqqpTww9 Z2Qg6soBMvl73WyEch+ZOA==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.3 cv=d5KLNirE c=1 sm=1 tr=0 cx=a_idp_x a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=EmqxpYm9HcoA:10 a=48faUk6PgeAA:10 a=Pnwg9sloP2yxOOvE0l8A:9 a=CjuIK1q_8ugA:10 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:14079] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id 41/0C-41496-DAA8F006; Mon, 25 Jan 2021 22:21:17 -0500 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24591.35500.33066.12845@jerusalem.litteratus.org> Date: Mon, 25 Jan 2021 22:21:16 -0500 From: Robert Huff To: Niclas Zeising , current@freebsd.org, x11@freebsd.org Subject: Re: loading drm crashes system In-Reply-To: <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verditct: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledrvdeggdehhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfujgfpteevqfftnfgvrghrnhhinhhgpdftvefppdfqfgfvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeggtgfgkfffhffvufgjfhfosehtjeertdertddvnecuhfhrohhmpeftohgsvghrthcujfhufhhfuceorhhosggvrhhthhhufhhfsehrtghnrdgtohhmqeenucggtffrrghtthgvrhhnpedttdelkeethfeggefgveelueegvdeludehueeuvdegjeeivdffiefffeethffgueenucfkphepvddtledriedrvdeftddrgeeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledriedrvdeftddrgeeknedpmhgrihhlfhhrohhmpehrohgsvghrthhhuhhffhesrhgtnhdrtghomhenpdhrtghpthhtohepiigvihhsihhnghdofhhrvggvsghsugesuggrvghmohhnihgtrdhsvgen X-Rspamd-Queue-Id: 4DPsTB73yHz4cbk X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[freebsd]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 03:21:19 -0000 Niclas Zeising asks: > Which version of drm-current-kmod? 5.4.62.g20210118 > Can you try to remove it and build it directly from an updated ports > tree, without using PORTS_MODULES=, and see if that helps? It does not. > > The GPU is a Radeon HD 3300, and at one point this used to work. > > When did it stop working? September ... I _think_. After the switch from sc to vt+drm, things worked for a while ... then they didn't for several months ... then - September??? - they worked for about two weeks ... then they didn't again. Respectfully, Robert Huff From owner-freebsd-current@freebsd.org Tue Jan 26 03:21:41 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6464E4FD0F0 for ; Tue, 26 Jan 2021 03:21:41 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPsTd2PYlz4cZC; Tue, 26 Jan 2021 03:21:41 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from weatherwax.trouble.is (weatherwax.trouble.is [46.235.227.50]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "weatherwax.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 33D7F5D81; Tue, 26 Jan 2021 03:21:41 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from rincewind.trouble.is (rincewind.trouble.is [95.216.22.234]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "rincewind.trouble.is", Issuer "Let's Encrypt Authority X3" (verified OK)) by weatherwax.trouble.is (Postfix) with ESMTPS id 4DPsTc22Fcz1yCc; Tue, 26 Jan 2021 03:21:40 +0000 (UTC) Received: by rincewind.trouble.is (Postfix, authenticated sender philip) id 4DPsTZ5tryz6G7b; Tue, 26 Jan 2021 03:21:38 +0000 (UTC) From: "Philip Paeps" To: "Mark Millard" Cc: "Current FreeBSD" Subject: Re: pkg for 14-current Date: Tue, 26 Jan 2021 11:21:35 +0800 X-Clacks-Overhead: GNU Terry Pratchett X-Mailer: MailMate (1.14r5757) Message-ID: <321CEDCC-51FA-4876-936B-624558020A1C@freebsd.org> In-Reply-To: References: MIME-Version: 1.0 Content-Type: text/plain; format=flowed X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 03:21:41 -0000 On 2021-01-26 11:14:53 (+0800), Mark Millard wrote: > Philip Paeps philip at freebsd.org wrote on > Mon Jan 25 21:40:03 UTC 2021 : > >> The first package build for 14-CURRENT is visible on the mirrors now >> (as >> of a couple of minutes ago). > > It has been a bit so I tried and it failed for > what I tried so I looked at http://pkg.freebsd.org . It reported: > > QUOTE > This is pkg0.tuk.FreeBSD.org - a West Coast, USA mirror for FreeBSD > downloads. > END QUOTE > > But nothing with FreeBSD:14 was listed on the page. So I > explicitly tried: > > http://pkg.freebsd.org/FreeBSD:14:i386/ > http://pkg.freebsd.org/FreeBSD:14:amd64/ > http://pkg.freebsd.org/FreeBSD:14:aarch64/ > http://pkg.freebsd.org/FreeBSD:14:powerpc64/ > > and only the first two were found. I've not updated the index.html pages on the mirrors yet. (Actually, I did update them, but I forgot to commit the change - I'll go and do that now.) So far, only the amd64 and i386 builds appear to have completed. I've not seen builds completed for the other archs. Builds should trickle in for the other archs when they complete. Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From owner-freebsd-current@freebsd.org Tue Jan 26 06:34:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0B5694E1782 for ; Tue, 26 Jan 2021 06:34:23 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from p-impout008.msg.pkvw.co.charter.net (p-impout008aa.msg.pkvw.co.charter.net [47.43.26.139]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPxly2FvPz4pRC for ; Tue, 26 Jan 2021 06:34:20 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from [192.168.13.11] ([45.47.45.55]) by cmsmtp with ESMTP id 4HvZluCKnWkb14Hval1Q9Z; Tue, 26 Jan 2021 06:34:14 +0000 X-Authority-Analysis: v=2.3 cv=X+cs11be c=1 sm=1 tr=0 a=oJ4f3sEZGTo/oTi6ieWQlw==:117 a=oJ4f3sEZGTo/oTi6ieWQlw==:17 a=IkcTkHD0fZMA:10 a=zo9bOBlR_v_D4wp3fesA:9 a=QEXdDO2ut3YA:10 To: freebsd-current@freebsd.org From: monochrome Subject: problem building virtualbox-ose-kmod Message-ID: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> Date: Tue, 26 Jan 2021 01:34:13 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-CMAE-Envelope: MS4wfB22DmwEkFHH+hcoCEW5tmc2kNJel+15645j8hdWlyFV0kfAkO+qhd8+WsN10HVjmO0e/bKWBshnzuqh2OldCTHDQjGuVD2f34RDUU+gxAwx/RZYtGPK EqzKnRPD/uhxKZC+i29NCJIT6cH/xY7DpgdV5AzsBh2goReDE11ZoXNmxUhzUp1Wle7MpapXIBw6pg== X-Rspamd-Queue-Id: 4DPxly2FvPz4pRC X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of monochrome@twcny.rr.com designates 47.43.26.139 as permitted sender) smtp.mailfrom=monochrome@twcny.rr.com X-Spamd-Result: default: False [-3.18 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[45.47.45.55:received]; FROM_HAS_DN(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[47.43.26.139:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:47.43.26.0/24]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[rr.com]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.88)[-0.883]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:40294, ipnet:47.43.24.0/21, country:US]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 06:34:23 -0000 having this issue building virtualbox-ose-kmod, its been like this for a while but I deinstalled and forgot, for quite a while now, maybe over a month. now that I've moved from 13-current to stable/13 I thought I would try to put it back, but it still wont build. I haven't seen anyone else with this problem, did I miss a memo? . . . --- semfastmutex-r0drv-freebsd.o --- cc -O2 -pipe -fno-strict-aliasing -DRT_OS_FREEBSD -DIN_RING0 -DIN_RT_R0 -DIN_SUP_R0 -DSUPDRV_WITH_RELEASE_LOGGER -DVBOX -DRT_WITH_VBOX -w -DVBOX_WITH_HARDENING -DVBOX_WITH_64_BITS_GUESTS -DRT_ARCH_AMD64 -Werror -D_KERNEL -DKLD_MODULE -nostdinc -Iinclude -I. -Ir0drv -include /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src/vboxdrv/opt_global.h -I. -I/usr/src/sys -I/usr/src/sys/contrib/ck/include -fno-common -fno-omit-frame-pointer -mno-omit-leaf-frame-pointer -fdebug-prefix-map=./machine=/usr/src/sys/amd64/include -fdebug-prefix-map=./x86=/usr/src/sys/x86/include -MD -MF.depend.semfastmutex-r0drv-freebsd.o -MTsemfastmutex-r0drv-freebsd.o -mcmodel=kernel -mno-red-zone -mno-mmx -mno-sse -msoft-float -fno-asynchronous-unwind-tables -ffreestanding -fwrapv -fstack-protector -Wall -Wredundant-decls -Wnested-externs -Wstrict-prototypes -Wmissing-prototypes -Wpointer-arith -Wcast-qual -Wundef -Wno-pointer-sign -D__printf__=__freebsd_kprintf__ -Wmissing-include-dirs -fdiagnostics-show-option -Wno-unknown-pragmas -Wno-error-tautological-compare -Wno-error-empty-body -Wno-error-parentheses-equality -Wno-error-unused-function -Wno-error-pointer-sign -Wno-error-shift-negative-value -Wno-address-of-packed-member -Wno-format-zero-length -mno-aes -mno-avx -std=iso9899:1999 -c /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src/vboxdrv/r0drv/freebsd/semfastmutex-r0drv-freebsd.c -o semfastmutex-r0drv-freebsd.o --- memobj-r0drv-freebsd.o --- /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src/vboxdrv/r0drv/freebsd/memobj-r0drv-freebsd.c:887:80: error: too few arguments to function call, expected 6, have 5 int krc = vm_map_protect(pVmMap, AddrStart, AddrEnd, ProtectionFlags, FALSE); ~~~~~~~~~~~~~~ ^ /usr/src/sys/vm/vm_map.h:517:5: note: 'vm_map_protect' declared here int vm_map_protect(vm_map_t map, vm_offset_t start, vm_offset_t end, ^ 1 error generated. *** [memobj-r0drv-freebsd.o] Error code 1 make[3]: stopped in /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src/vboxdrv 1 error make[3]: stopped in /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src/vboxdrv *** [all] Error code 2 make[2]: stopped in /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src 1 error make[2]: stopped in /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src ===> Compilation failed unexpectedly. Try to set MAKE_JOBS_UNSAFE=yes and rebuild before reporting the failure to the maintainer. *** Error code 1 Stop. make[1]: stopped in /usr/ports/emulators/virtualbox-ose-kmod *** Error code 1 Stop. make: stopped in /usr/ports/emulators/virtualbox-ose-kmod From owner-freebsd-current@freebsd.org Tue Jan 26 07:02:12 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3E1694E22B3 for ; Tue, 26 Jan 2021 07:02:12 +0000 (UTC) (envelope-from danfe@freebsd.org) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DPyN413hrz4qnh for ; Tue, 26 Jan 2021 07:02:12 +0000 (UTC) (envelope-from danfe@freebsd.org) Received: by mailman.nyi.freebsd.org (Postfix) id 220A74E1E57; Tue, 26 Jan 2021 07:02:12 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 21B624E1E56; Tue, 26 Jan 2021 07:02:12 +0000 (UTC) (envelope-from danfe@freebsd.org) Received: from freefall.freebsd.org (freefall.freebsd.org [IPv6:2610:1c1:1:6074::16:84]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "freefall.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPyN40Xgwz4qXJ; Tue, 26 Jan 2021 07:02:12 +0000 (UTC) (envelope-from danfe@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1611644532; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=wT7w4MEE6UEyEe858LQ6pbrfa/NOZanLaFHah/ouHGI=; b=ct0XUuPcU12UU8ulaZN2f95x/Ttz/2AJVfaWuxFEcXHELKLtp4GYX3C2nIgr7bA+ErpRYl XoY8hwBO1KOhq8PljSFHTxpw5XRta/nFlKPxYzj+sYyyTDmLW03XAqbJYrEthaCqbg9OMy W3nicg2HlqkesIGcMEU/Hqdh1lXQ/+qm7kQg+4BQ5g2FqsT+3cTy0Cfsy8vJWdViY5kod5 zsMfH7TKb2RkYD2knz0cG8AF4crQXfmtP5cfDdrOHTmgq2lTNIvRmTkmwypX5M4AX2L41y zov7kWm2Y8PhncFZDsnRkUtokNzHBYVhP+v7fOgZ/K1GYWokXfH95ynQlnq20g== Received: by freefall.freebsd.org (Postfix, from userid 1033) id 0301914053; Tue, 26 Jan 2021 07:02:11 +0000 (UTC) Date: Tue, 26 Jan 2021 07:02:11 +0000 From: Alexey Dokuchaev To: Robert Huff Cc: Niclas Zeising , current@freebsd.org, x11@freebsd.org Subject: Re: loading drm crashes system Message-ID: <20210126070211.GB43439@FreeBSD.org> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <24591.35500.33066.12845@jerusalem.litteratus.org> ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1611644532; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=wT7w4MEE6UEyEe858LQ6pbrfa/NOZanLaFHah/ouHGI=; b=NV5Op4+mTK/9VO9Bbl12eg2/P5eKP/5ddsp2e/A1u7/sByFmP37eCbu96n7oYuMWABjJ/g GtTVVzeGFjeJrQOxGFisaalTxe8la5+ZLvqHgSh582/A+6rLco32U7Qz/DnRO7Lrwh4XzF 8cEkbZpuUR2Kz4EeovgfqJ2bWznf0P0/AT/mH7exDd76ykRAnkYR95YEOEtHLEu8mj0xT3 DWOB55F1vE51ER61jVDivi0sYLT5YoBQeXcJ0AtcZxarWsEGFFT6iuxxMRp7Zbxz4supiC /4JpIBefxDz5q9iYlw32qFg47yzweOLbqGW9q9qkPoLVQQpMPO/yOCJ6ZEG6fA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1611644532; a=rsa-sha256; cv=none; b=alHRMxn9Cav1fAh/iOTh9tu6sK9xZbGawIwPM36WoPUjmucgxlDwp0RGSsW1f2d8xz+kg9 zW9mnX7YuMIS8F2jTZI1108ds3qCUFgJBKkQKuoWB1F1XHHNe/EFt+ZlFq9rBtEgYB7m6o 8H+qsAG5LCSD1i4ZI5F/TFFJLtdMWspcT37RGEE5rCc1DGpiRnB+o4xGXDZehydmrVaigH /rZ+KaUBQMhyb65AqUv+4ClHEGQYb5KVIpkSplBIlYcXrVUqMhkmo8PumQMGV3ls8b6jq0 faZRGcF2Fw7gubKd7Bm1n+AtsNq18akBoToAknTbyw4TRoTOpwRbNp4cFi0l6Q== ARC-Authentication-Results: i=1; mx1.freebsd.org; none X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 07:02:12 -0000 On Mon, Jan 25, 2021 at 10:21:16PM -0500, Robert Huff wrote: > Niclas Zeising asks: > > When did it stop working? > > September ... I _think_. Yeah, that sounds about right. There are known issues with Radeon cards, they were quite well supported a year ago, then something got broken. I've promised to bisect this and find the cause, but there were several syscall-related changes in -CURRENT though the course of the last year, so bisecting just the kernel is not enough (machine won't get to login prompt if the userland does not match), which cripples the process. I still intend to take this quest, just not sure when. :( ./danfe From owner-freebsd-current@freebsd.org Tue Jan 26 07:23:41 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 82F3E4E27F7 for ; Tue, 26 Jan 2021 07:23:41 +0000 (UTC) (envelope-from zarychtam@plan-b.pwste.edu.pl) Received: from plan-b.pwste.edu.pl (plan-b.pwste.edu.pl [IPv6:2001:678:618::40]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "plan-b.pwste.edu.pl", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPyrq6fXCz4rcb for ; Tue, 26 Jan 2021 07:23:39 +0000 (UTC) (envelope-from zarychtam@plan-b.pwste.edu.pl) Received: from fomalhaut.potoki.eu (dom.potoki.eu [62.133.140.50]) (authenticated bits=0) by plan-b.pwste.edu.pl (8.16.1/8.16.1) with ESMTPSA id 10Q7NTvv006867 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128 verify=NO) for ; Tue, 26 Jan 2021 08:23:29 +0100 (CET) (envelope-from zarychtam@plan-b.pwste.edu.pl) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=plan-b.pwste.edu.pl; s=plan-b-mailer; t=1611645809; bh=dqV8+mtbOmZ+GmwpAjGk+W/5PWxM7osDNaENaJHanEw=; h=To:References:From:Subject:Date:In-Reply-To; b=sJkrJjpnR07ud4S0ExI8XhgajD0T//BDe1AzWzeAiUVxgsJpE0LfCnqMPVAw15i6b RVujhMl0ujCKIxo/R2aogdbeKXx8h4v88XXXkVc27D0afck9hgeZCOzreM9ENrAVPn 9+4TvuAtnT2sjzD1BngpjVkT11GiIv8FkJDB5KkqTS7XLlf4mf/Az8PajIKm7fr+XK U8mumWcc1a9DNZB2FQIiq0G6s2ym6LON6GQFolADGb8XD5IsZYOyoqM6b53fJxfBln ZGZ1COALLiCFI1kZsaOsiZnb95qXufp6o1dfD3wDui2juyzW1hL1U5x4aYvKK5XeoG e+12xUf3AaZmg== X-Authentication-Warning: plan-b.pwste.edu.pl: Host dom.potoki.eu [62.133.140.50] claimed to be fomalhaut.potoki.eu To: freebsd-current@freebsd.org References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> From: Marek Zarychta Subject: Re: loading drm crashes system Message-ID: <84516c3c-15fb-9e58-c335-4992c04a9fe1@plan-b.pwste.edu.pl> Date: Tue, 26 Jan 2021 08:23:24 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <20210126070211.GB43439@FreeBSD.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4DPyrq6fXCz4rcb X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=plan-b.pwste.edu.pl header.s=plan-b-mailer header.b=sJkrJjpn; dmarc=pass (policy=none) header.from=plan-b.pwste.edu.pl; spf=none (mx1.freebsd.org: domain of zarychtam@plan-b.pwste.edu.pl has no SPF policy when checking 2001:678:618::40) smtp.mailfrom=zarychtam@plan-b.pwste.edu.pl X-Spamd-Result: default: False [-3.80 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_XAW(0.00)[]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[plan-b.pwste.edu.pl:+]; DMARC_POLICY_ALLOW(-0.50)[plan-b.pwste.edu.pl,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:678:618::40:from]; ASN(0.00)[asn:206006, ipnet:2001:678:618::/48, country:PL]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[plan-b.pwste.edu.pl:s=plan-b-mailer]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_MED(-2.00)[pwste.edu.pl:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2001:678:618::40:from:127.0.2.255]; NEURAL_SPAM_SHORT(1.00)[1.000]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 07:23:41 -0000 W dniu 26.01.2021 o 08:02, Alexey Dokuchaev pisze: > On Mon, Jan 25, 2021 at 10:21:16PM -0500, Robert Huff wrote: >> Niclas Zeising asks: >>> When did it stop working? >> >> September ... I _think_. > > Yeah, that sounds about right. > > There are known issues with Radeon cards, they were quite well supported > a year ago, then something got broken. I've promised to bisect this and > find the cause, but there were several syscall-related changes in -CURRENT > though the course of the last year, so bisecting just the kernel is not > enough (machine won't get to login prompt if the userland does not match), > which cripples the process. > > I still intend to take this quest, just not sure when. :( > > ./danfe > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > TBH I have backed up deprecated port graphics/drm-legacy-kmod and use it on 13-ALPHA. The port graphics/drm-current-kmod was unusable (console resolution, flaky gdm start etc.), tough no panics were observed. One should be still able to build graphics/drm-legacy-kmod on 14-CURRENT for some time till the issue gets resolved. -- Marek Zarychta From owner-freebsd-current@freebsd.org Tue Jan 26 07:58:45 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E260D4E353C for ; Tue, 26 Jan 2021 07:58:45 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-wm1-x332.google.com (mail-wm1-x332.google.com [IPv6:2a00:1450:4864:20::332]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPzdJ68Djz4smV for ; Tue, 26 Jan 2021 07:58:44 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-wm1-x332.google.com with SMTP id c127so1822961wmf.5 for ; Mon, 25 Jan 2021 23:58:44 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=tdE+rKt6EVGBpgIEDV+Lf2VdzTPEuRGUE7eqbYhyFH4=; b=pcpwT9f6M1lLEK0TYwytVTNVnHGW9qcKkHs96irrOsB+SlYflKN8QFZDR1MhKVkeNF Muwkw/uKxxGH3/GMHP0GB0ixYWWB3b2jIUDOYI1N+uTwjiAUHKw3vakWCOZd9SqYqlcr mhjQOnx2m2sVRm6piL68udscRj14P7EzPkC3WPpNV5uYumbi+Hpjiz0S0kQmMZ0BlAmw ZDWKLpdjDuXdySLuPxR2hi/3dHeRFbh5Xrb4ogIBSso/0VChkCdWN82HT9VdP8cnxlL2 mJ5jcFxLvEmHy5aN7mQVUuW6xMAGPk+NfqVTx6NqA5LSlJEv35Qn28iTVNWOKKJAOheb HqcA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=tdE+rKt6EVGBpgIEDV+Lf2VdzTPEuRGUE7eqbYhyFH4=; b=eKI0Cw5grUUlg6A/ELijBZLtwVn+kn4JZlq9lUm9T2J37QcZLE8G81Ju5Sn1/KDyS2 ouVOKhOZ5CuwIgKUn0SmPZlS8n0ierIkriowy4yRN3oXo9RY8J9evU+WlOGMItUctDwL 7/mEAVOmcc0ReBicCwPVoX7uiiBxBuIxRPp0yNoW2gvKn/i2vF/vzVQxHVwKudqqGJ9H cgfkUiD836TOB9rZdMWOgCCS+WIz0xHZtvPNQLC4Mz5zlzSTO0L/HHd5Oezb1nPfiz0n pl4ISJACoa6Xtlrd2QlKJQHdoeJtMAKfzwy2CfO24Lt268F5SBEGTBVxD67H7Yw549t7 T/RQ== X-Gm-Message-State: AOAM532T/O7Q1F9OTTxPl29dZ1X13ielU52IZtOnNiVJZ55FPgmlYfzX /1aExP8QwdBQp0NoHyzegp1iBikZT4u/ww== X-Google-Smtp-Source: ABdhPJwAr5CJTigNDKDBNW8MQX71UF16X7fmaKuTyzhsGW+JC8RNZwrcA3LzmxRg1MFc84yZjv0Uow== X-Received: by 2002:a05:600c:154f:: with SMTP id f15mr3536871wmg.46.1611647923170; Mon, 25 Jan 2021 23:58:43 -0800 (PST) Received: from [192.168.1.11] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id d199sm2191078wmd.1.2021.01.25.23.58.42 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Mon, 25 Jan 2021 23:58:42 -0800 (PST) Subject: DRM and Radeon To: freebsd-current@freebsd.org References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> From: Graham Perrin Message-ID: Date: Tue, 26 Jan 2021 07:58:41 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <20210126070211.GB43439@FreeBSD.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-GB X-Rspamd-Queue-Id: 4DPzdJ68Djz4smV X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=pcpwT9f6; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::332 as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-2.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::332:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::332:from:127.0.2.255]; NEURAL_SPAM_SHORT(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::332:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 07:58:45 -0000 On 26/01/2021 07:02, Alexey Dokuchaev wrote: > Re: loading drm crashes system > … There are known issues with Radeon cards, they were quite well > supported a year ago, then something got broken. I've promised to > bisect this and find the cause, but there were several > syscall-related changes in -CURRENT though the course of the last > year, so bisecting just the kernel is not enough (machine won't get > to login prompt if the userland does not match), which cripples the > process. > > I still intend to take this quest, just not sure when. :( > > ./danfe Any cards in particular? – whilst I didn't mention Radeon there, for me it _was_ the Radeon story that seemed to improve a few months ago. AMD Thames [Radeon HD 7550M/7570M/7650M] From owner-freebsd-current@freebsd.org Tue Jan 26 08:13:20 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7EF424E4215 for ; Tue, 26 Jan 2021 08:13:20 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic303-23.consmr.mail.gq1.yahoo.com (sonic303-23.consmr.mail.gq1.yahoo.com [98.137.64.204]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPzy72hvgz4tj6 for ; Tue, 26 Jan 2021 08:13:18 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611648797; bh=6awMNCJPi3aRSoUOV2r4zG18ZUhvjS4rLTSKKclJevi=; h=From:Subject:Date:To:From:Subject:Reply-To; b=FmGMknXdUKx/tzSgeHdvO73vBvBXOLLf3Rm2d22j/Z4rqC/4nfj2cpfK+RIqWR1JMSbHe/TPdt411mON5TWHiTIVnUjYxPZM10AK0bQMHcIceNLsQgbXe6U6lfLqgEUHfHbEKD8EN4zjAw06DoA252oK0qsilTt3kZlRyGzZ9WvgqoBIERhMxjOm4XawvEs+DCwhTdJtYYAVMgnMcnsm4Fp+6wEvfV6aUOVaOPYq13dNVPrl4w0Q0MgPwLYE2VY2t5mJf22pTp2dQ0CHu41sYwinu3nH99ZJa0nDthCXpN1AN8rlHSl6i50JSQiUfmgmRoTbVxUQC6YReh1PA05Fqg== X-YMail-OSG: kbihx9cVM1kI9NMqBhJLevMGXg3oZOHnXhvcQXiLhp71SQ.p7emm0IpjQeAn8X3 nMAYcAm21ldZhrrXUuOHGQui20Bh5htFsBnLj6Kg38V3FxVb1WaWz2dvDVoo4Hr_2G1JLHCwtUuX lmw9bWC_18wQ7emVZ612G4VPvEna5RdACWZxhNrEIS.YRpazAa2xMUePU0QUKz7F13T1robh_t.s Tq__O4BHg5EGHtf3enxSY8l0KjffV.pssiWMto6NL8wGDPPCqk3rY2n9qgUhcgMOfn0S9rpFjnuq 7I_TZx3zSoj.Yt559PCewi2G1Fq8Ia4HieK0sLuK1Blat00j01wKt0lvte9GK4rPH7EsT8MPN6UE jhl1q7odRd142ZR3FKu3ILCf3IsBcFFKnv.9fzqbCt5ugJD9mZPHsZQrZWat_kU9xg4GBOtwXdag z38noS9WRwxHrmf6UAG2DS4IOVF8a0xpUtdZBw_C0AVoaFVN9sjmpQJpdfNXyZqerCfr5vZ7krVB CrixwnQGGflsuHbTIltFGM5QpDwLU0_mH7_fF9OFyUZ.E1ZkIhuqDeVr.VuBQ6GnBkXmKx09IeC4 RENWqerpC7iiKB.W32OwkUK07hU9MQLLK.AvhSHVcZdBONuWEJcmtvRn37UB5scixAgKJlXoKExU 7VoFanqAeDT3c1vGvHfK9_GAehBHt3wLMt7f1aPRRaar2C920ayUERsordaBAhNM5zrC5Quv7Gnu 0lLfPtGqj3V0hLnd7qGbOc9J13taIMn1pnfyDs9nDP6DYmEXm0TOZHV7UgzHjttwZWMi7tGam8oB GL0rmb_bwfOkJOZtm_u14QbyCOIXMWofwIcnbG0RQ0a56EaWXxyXOpuvvF3VsrzzWAUsZfB9AbHF .BdMrBXUsU9BbiaRwiYMHiENie_9Jo31KP7EG4yao.zSt2HAoJrNe4zzd6uXgMmpvLBYxlFxU9vl 0k8sTtvn7Vhlxqd1T9fS7woGkVF8iCXFHaRQVKac.f9HfJGJ2Khfa1ik6gnyrR_f4R2F1gnRwRTq WSA6AW7940T9576.DQk_qb1IWmFCbfeBIpGrG91RyPEATPGVw3Wo80qUmPGXq4qQGI7VWOfF4Au8 8gZgmkEfiaDUSkxTOy2cIT73PYSW0XGI0YnysWGZ61geLoaKzQPhoF.WfYFgkqSv6aOIyQCvAMxe whMwq7Y7JvFbjxD69GSA9WharSEqZqBb9bs87pkAEMxYHTtuLq6mGQw7BcouQKFlowp74T608KtX rDXkwYUZ6atZ7uXhCBuwgu7MNBYdrAJtHyUMunB49HMjvc7_S3YGzSCkVW1utsFc96GiJEtyBWbf g2bA8CtWT9rXQ5d5putRnahnBGin.y23PA_fytWRL0KNJFt6r78mZlk6YCSQcu8oeAQyYOvIy46w ZA8IItFjEXWzOqFz.jaCqPiV0z3aSJ2M1JoJWQjnY22kdzcOkJK2h5RAMKBQbCn6rdpE2o4q_EnZ YW9btgADefB6dDDUJJpUCWwVSvpe9rgoeqNHiejgtcuWqXQOwdH0TIXKaY5eBgzFqWvYND8A9X90 2wHRqqCQGXrnv57nkOV6PFjtJ9mtUgqk2hH4pv.Ix5O2J5mSOGtiAZbstUnAWhQbqNJmjWyOcHMD yu6iNoJ23BX34csb9Y49PERWGPs3zwRcbqarNB0U7W2FwVkuOIU4hAWkSUTj.8pJstlJUz9A4t3V zWUAN3BepoToQfGwa8s3OuKNhPGswBj.Tho3H8pdEpslOPrjhrvYYfeklTqrNOiF9hbuQNO3Oy8l lbSp_MtWXAK7Wraa7QXMkFZpTnDpTcgIWsyirCWfafut1DEk4Pq2Azapgn0x_9BFuzBy5BL4lNxP mpo3BBLIYyT27q6sZlf_Tcc.7VNDrfWBiI2.AlYzBm.VvtNdaX87pYLBHwhHEcAzPkQQ1m_x1VDi adqGxoXqTYx4gZMCggkLHnTiIJIYSU9GbVERYkOwGA.n3Wdclg02nTIvjsmEf9.PHZQbIZqTdfy1 IG12Gb2QZ32zr2QoQ3DdvDtmJ0atOHHnnFklC38q_y9Fy5humXX6_p3zlf9l2oLpQ9iPTnSZYmnX VbaiLmHzxttb354uMpYn56A.Wtr0g5BY5RA8u.3UCiJglHv7UfO0IRx2MnAzIVKrL48VBKIcGa1N .rLTrR0CFQ5_x__8IoCpIqWhEcru4Yf7BGU067gkDr0qtsGyZdK2pq_QrjfhQe.lLEvumS7mwg.N 5h5UHnyLZkdTHwfjpowVnEnspaVJrYMptOn0IZPfsR9GElfdESSDHsZSUgYtA_WeRg8PgEK72EI6 .KEFy.gvcGJpq7gZ_iuWGDOQlr5IS_E6aAJCjdq4mh23xKSxM5X6BxVl1eXxDlny9VY0.Qdp3BUK k5gQogLiY4wq9dnOKRU_ygWCczwkTUmhdVnS0o1MPpdewbkYpjpJddHYElIsybndGBhM- Received: from sonic.gate.mail.ne1.yahoo.com by sonic303.consmr.mail.gq1.yahoo.com with HTTP; Tue, 26 Jan 2021 08:13:17 +0000 Received: by smtp406.mail.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 18dd9128dc3c554ca88fa5b63d9452c0; Tue, 26 Jan 2021 08:13:13 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: problem building virtualbox-ose-kmod Message-Id: Date: Tue, 26 Jan 2021 00:13:11 -0800 To: monochrome@twcny.rr.com, Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: X-Rspamd-Queue-Id: 4DPzy72hvgz4tj6 X-Spamd-Bar: - X-Spamd-Result: default: False [-1.50 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.204:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.64.204:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.204:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.204:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 08:13:20 -0000 monochrome monochrome at twcny.rr.com wrote on Tue Jan 26 06:34:23 UTC 2021 : > . . . for quite a while now, maybe over a month . . . > --- memobj-r0drv-freebsd.o --- > = /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebs= d.amd64/release/bin/src/vboxdrv/r0drv/freebsd/memobj-r0drv-freebsd.c:887:8= 0:=20 > error: too few arguments to function call, expected 6, have 5 > int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd,=20 > ProtectionFlags, FALSE); > ~~~~~~~~~~~~~~=20 > ^ > /usr/src/sys/vm/vm_map.h:517:5: note: 'vm_map_protect' declared here > int vm_map_protect(vm_map_t map, vm_offset_t start, vm_offset_t end, > ^ > 1 error generated. > *** [memobj-r0drv-freebsd.o] Error code 1 The change from 5 parameters to 6 parameters is recent: main's = 0659df6faddf as of 2021-01-12 23:35:22 +0000 (commit). Its one line description is: QUOTE vm_map_protect: allow to set prot and max_prot in one go END QUOTE It added a "int flags" parameter. https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D252952 is about: vm_map_protect manual page requires an update after 0659df6faddf . . . (So if there was a problem about a month ago, there may be another problem as well as the above that was something else, the above just happens first now.) Looks like emulators/virtualbox-ose-kmod needs to track the kernel change(s). =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Tue Jan 26 08:19:04 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9931E4E4701 for ; Tue, 26 Jan 2021 08:19:04 +0000 (UTC) (envelope-from zarychtam@plan-b.pwste.edu.pl) Received: from plan-b.pwste.edu.pl (plan-b.pwste.edu.pl [IPv6:2001:678:618::40]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "plan-b.pwste.edu.pl", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ04l6Pn4z4vNm for ; Tue, 26 Jan 2021 08:19:03 +0000 (UTC) (envelope-from zarychtam@plan-b.pwste.edu.pl) Received: from fomalhaut.potoki.eu (dom.potoki.eu [62.133.140.50]) (authenticated bits=0) by plan-b.pwste.edu.pl (8.16.1/8.16.1) with ESMTPSA id 10Q8J2xB017784 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128 verify=NO); Tue, 26 Jan 2021 09:19:02 +0100 (CET) (envelope-from zarychtam@plan-b.pwste.edu.pl) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=plan-b.pwste.edu.pl; s=plan-b-mailer; t=1611649142; bh=myTbLRRdbs827DlLjjlvzAJQC855dVFPL/YtXG3eqnM=; h=To:References:From:Subject:Date:In-Reply-To; b=ioHF8WKFe+3lZs64NtAFFrC0ms+61ZPex/4SCL3gO80vCfe1sMYldplPpNUt3GDBe UNXAkl+VOO8gf/Mwao15aC+bSFD3+DfmS1WaYr3L3KLeH93NAKWvfBhOXiPyWVxTFI 8UTFyJg2fuFDIucemHeh/8M15f+kX3qh8ZTPzNmcsM+ylD09dqFUFbT2YuBBrGjRAD VG4D4Aipf6bk5WBwOAkWSvdvpkYn3OD+D+2KxjIHoUW/4Fol+st00oMGBFKn/QuaRD kozgml4S7bIHe/kMNoyZJjr/L7kG8K4YcjrkqbC+V8F7bcz5iqiOlqZCewj9rnqIPf VVDImgJ4K2Rqw== X-Authentication-Warning: plan-b.pwste.edu.pl: Host dom.potoki.eu [62.133.140.50] claimed to be fomalhaut.potoki.eu To: Graham Perrin , freebsd-current@freebsd.org References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> From: Marek Zarychta Subject: Re: DRM and Radeon Message-ID: <4933479c-b5a6-fa2e-09be-f5a0190d6f1b@plan-b.pwste.edu.pl> Date: Tue, 26 Jan 2021 09:18:56 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4DQ04l6Pn4z4vNm X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=plan-b.pwste.edu.pl header.s=plan-b-mailer header.b=ioHF8WKF; dmarc=pass (policy=none) header.from=plan-b.pwste.edu.pl; spf=none (mx1.freebsd.org: domain of zarychtam@plan-b.pwste.edu.pl has no SPF policy when checking 2001:678:618::40) smtp.mailfrom=zarychtam@plan-b.pwste.edu.pl X-Spamd-Result: default: False [-3.80 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; HAS_XAW(0.00)[]; DKIM_TRACE(0.00)[plan-b.pwste.edu.pl:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[plan-b.pwste.edu.pl,none]; FREEMAIL_TO(0.00)[gmail.com,freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:678:618::40:from]; ASN(0.00)[asn:206006, ipnet:2001:678:618::/48, country:PL]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[plan-b.pwste.edu.pl:s=plan-b-mailer]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_MED(-2.00)[pwste.edu.pl:dkim]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[2001:678:618::40:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 08:19:04 -0000 W dniu 26.01.2021 o 08:58, Graham Perrin pisze: > On 26/01/2021 07:02, Alexey Dokuchaev wrote: > > > > Re: loading drm crashes system > > > > … There are known issues with Radeon cards, they were quite well > > supported a year ago, then something got broken. I've promised to > > bisect this and find the cause, but there were several > > syscall-related changes in -CURRENT though the course of the last > > year, so bisecting just the kernel is not enough (machine won't get > > to login prompt if the userland does not match), which cripples the > > process. > > > > I still intend to take this quest, just not sure when. :( > > > > ./danfe > > > Any cards in particular? > > > – whilst I didn't mention Radeon there, for me it _was_ the Radeon story > that seemed to improve a few months ago. > > AMD Thames > [Radeon HD 7550M/7570M/7650M] For example old RS880 [Radeon HD 4200]. After deprecation of graphics/drm-fbsd12.0-kmod I found that it is still supported fine on 12-STABLE with legacy /boot/kernel/radeonkms.ko from the base. While trying the driver from graphics/drm-fbsd12.0-kmod I was not able to use this card with gdm, only startx or x11/slim worked. On 13-ALPHA this card still works fine with deprecated graphics/drm-legacy-kmod. -- Marek Zarychta From owner-freebsd-current@freebsd.org Tue Jan 26 08:19:39 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C7CE64E481A for ; Tue, 26 Jan 2021 08:19:39 +0000 (UTC) (envelope-from hlh@restart.be) Received: from tignes.restart.be (tignes.restart.be [37.187.123.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "tignes.restart.be", Issuer "CA master" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ05Q4zrSz4vlQ for ; Tue, 26 Jan 2021 08:19:38 +0000 (UTC) (envelope-from hlh@restart.be) X-Comment: SPF check N/A for local connections - client-ip=192.168.25.127; helo=restart.be; envelope-from=hlh@restart.be; receiver= DKIM-Filter: OpenDKIM Filter v2.10.3 tignes.restart.be 4DQ05G5VpvzX4 Received: from restart.be (norquay.tunnel.bel [192.168.25.127]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.restart.be", Issuer "CA master" (verified OK)) by tignes.restart.be (Postfix) with ESMTPS id 4DQ05G5VpvzX4; Tue, 26 Jan 2021 09:19:28 +0100 (CET) Received: from morzine.restart.bel (morzine.restart.be [IPv6:2001:41d0:a:f40b:1:1:0:1]) (authenticated bits=0) by restart.be (8.16.1/8.16.1) with ESMTPSA id 10Q8JNAf015263 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=OK); Tue, 26 Jan 2021 09:19:27 +0100 (CET) (envelope-from hlh@restart.be) X-Authentication-Warning: norquay.restart.bel: Host morzine.restart.be [IPv6:2001:41d0:a:f40b:1:1:0:1] claimed to be morzine.restart.bel Subject: Re: problem building virtualbox-ose-kmod To: Mark Millard , monochrome@twcny.rr.com, Current FreeBSD References: From: Henri Hennebert Message-ID: <218de9a3-9cd6-b133-09d9-7919efa592a8@restart.be> Date: Tue, 26 Jan 2021 09:19:23 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=windows-1252; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQ05Q4zrSz4vlQ X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[restart.be:s=tignes]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:37.187.123.11/32]; MIME_GOOD(-0.10)[text/plain]; HAS_XAW(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_SPAM_SHORT(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[37.187.123.11:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[restart.be:+]; DMARC_POLICY_ALLOW(-0.50)[restart.be,reject]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEMAIL_TO(0.00)[yahoo.com,twcny.rr.com,freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[37.187.123.11:from]; ASN(0.00)[asn:16276, ipnet:37.187.0.0/16, country:FR]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 08:19:39 -0000 On 1/26/21 9:13 AM, Mark Millard via freebsd-current wrote: > monochrome monochrome at twcny.rr.com wrote on > Tue Jan 26 06:34:23 UTC 2021 : > >> . . . for quite a while now, maybe over a month . . . > >> --- memobj-r0drv-freebsd.o --- >> /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/freebsd.amd64/release/bin/src/vboxdrv/r0drv/freebsd/memobj-r0drv-freebsd.c:887:80: >> error: too few arguments to function call, expected 6, have 5 >> int krc = vm_map_protect(pVmMap, AddrStart, AddrEnd, >> ProtectionFlags, FALSE); >> ~~~~~~~~~~~~~~ >> ^ >> /usr/src/sys/vm/vm_map.h:517:5: note: 'vm_map_protect' declared here >> int vm_map_protect(vm_map_t map, vm_offset_t start, vm_offset_t end, >> ^ >> 1 error generated. >> *** [memobj-r0drv-freebsd.o] Error code 1 > > > The change from 5 parameters to 6 parameters is recent: main's 0659df6faddf > as of 2021-01-12 23:35:22 +0000 (commit). Its one line description is: > > QUOTE > vm_map_protect: allow to set prot and max_prot in one go > END QUOTE > > It added a "int flags" parameter. > > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=252952 is about: > > vm_map_protect manual page requires an update after 0659df6faddf . . . > > (So if there was a problem about a month ago, there may be another > problem as well as the above that was something else, the above just > happens first now.) > > Looks like emulators/virtualbox-ose-kmod needs to track the kernel > change(s). > See solution in https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=252675 Henri From owner-freebsd-current@freebsd.org Tue Jan 26 08:38:39 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 241FC4E4B72 for ; Tue, 26 Jan 2021 08:38:39 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic316-8.consmr.mail.gq1.yahoo.com (sonic316-8.consmr.mail.gq1.yahoo.com [98.137.69.32]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ0WL1jMhz3CPP for ; Tue, 26 Jan 2021 08:38:37 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611650316; bh=NOv9p+ULvFlFQBofX+MMLOUNox90SdI0gOHWC1MqXfm=; h=From:Subject:Date:To:From:Subject:Reply-To; b=k6GBLdAJ2Bd45SpETQTYHikw85Bze6d0EgFvA+Z8BtVIRVI86g7wL4p5bQM8wUoUFzQPjIEAZlq85F8VJpfmBKlbNXp9YHZH/c+YD3PnfUet1gZlUzVaC4qz8dfFMUP78Rx0DhifZWiNiUwqk4RpuCf52syQRA6oZ811T+rlSsdBmKzj10xITryX/jw0EkchUS2A1gAFUG7a8lTHd5QBLfx4yCPJWF6AeDwytYVvBmUYrxVPwP6POvBDs2RM1Oy9VCCDt409AMWWb+eaB9zuzRM9XBremAg6B9P0L+NqmxGZPwobCl1tjCuBpAfpbM0Q9uqOrbqxol1SEGIApJMlOQ== X-YMail-OSG: JWDvSgcVM1kJLMGnHwqpX4R_kIq66XNkZfYNxZ4s3afAKxn6S41TvPFqcDUzUpV D5pG3TLvtyIpmxh.PwES6d1ViJFGL5dLp0c5fopLWw8htXMW6x_jzFrFew93x3n3yElGyGuaPd8S lYgbDPM1.V2b49drVOsbd5MNwyx1PVL_eAFTDR9I4plX6OYmzq0vCeFi9iesEn6ZTxx6MBCzdtwW i0_09N7_MO5SYe4SmlPM2F5lxM99OxPn9f0OejA8lde_jrNy7.pvvahwjXdS4dw32lt5m5eXYEe4 PWnnJje30CPqc95kZarXH1uRiqSX989QW8.L6a0QosQEsPmgQ6q_TzUL3iJjdz2wGP6pNdPPQkkc nMJPyZOqmB.0kgQEt7HOKLOKSuL0MY69jieyyzQYusaIi8AJtfARqs6jDlndfBQ8Fr_C.vyT15KD vHi6ZSu6fnkO9dioFTedzbSIRhoKZJ52sQCBlPlfhZBv03SMqlGVvsYqrZxqiUtOPDFNakOjb59f VoruybKoptjRv1QjOVwm3HnGMk99EbEOmwNbqEnkt4AttK0tMCQaDMCVWw7sK0YSD.mUA8I.ZU9R Oq4XC1zqqDzhNRtVo2.FTpDsUEVTY_j1vaaN5vCcpQ3a6.sV4pirzW..eBmOKjXaxnY7qwOIYxM2 VELf51zUXg1KU7BgX7TXRFxfpvj4aQwDsvcY_6h9YrG7qKm5sspVvw6rWJKC9beDmeBwjy7VdQO6 LqSVMF3f51QtMxuIgXDmuJcfXA9GdcW42VqRKD2HkWoCSIkTaUyxF1YsLMT6LcIKjqSbuZak9aeE i8zutL0w7E8qNmFLaz3wTx8UBoMZtynt.V0WEq4cAnEB57ASGmkKGEUb2K9fhEJhoDdfAn_e1R3. Z7ek8XS9EAYREwp.RgRGos12R2xEGwPM_Rmvb9eDRBCKwzXZPFBToMdRMPuqXCyjae1SNxxo4MHr U43dcWH6Llk1z9wreWxvIg5yBSIy8zvQJi.YtZCOjKOtVW6DuN_Htz_AJvAxHmSn6nByKC884Yq8 nYp2hES2A7ecq_QPWI6LaT3yrGp3wqNgkGNcuxg55TS2AeyRHTH8veH2ADivQUl14uO1HyHiHqiC WprNefWbkLNVk0DincwPeKny9OGWFi2gREJ_.NUTds5IuWnStGNwMQTpk7LlS9N2uzLEZR2McoKY pmrgZPhMiCHiOEl.xZLwgp5S_vdJNIj.JDLJKAMwe.jB_pF.NjSSp9dcT9nP43kt9HOSP_QlOQ9x qOLsOSUqd5NJADCrCpayIFEKu0GInZfZ_91iSBXEVKN5iaM5Iu4sbxGzotHSKG_1ddvpt2thMGYu aq7Lf09aZUlhfR4djq30NWbMFGJzyEjL76036X6AlNvs6Ig6AoTJFyFU07ixP23ioX3N8_vAaelN CZq_owOzIOFiUxcHjt8DHLu6wgCNHtS5sVJPNx8NX0MRuB5CwFDqFCZ0ZA3rl1zbYhAklN1dqaiR pmCPDhF9k5vxJRTOBoAJ9IAdJOPOo4vA7vg8dT_JhICtbHl0xXDBREFaqMBwrZmkgZJKMooY_SG1 lS8M8jAq5BzQhCxAkfHLB1SNEZaiEzM9tcc9BSbmRh7_iUbGsAvfBsywtDZSm5X8xpwcwWLlcxM8 gHYdQqngpLMFQ70Yr9a5s63Z.GnkyvWPp34oWTqYzNOjIhj4M4AdK9dmrjQYQhIBMWBN2nlivClw 47ijiSA_MEJ7yCqBq0aBk5YIzR7BMzAFJHy4CM9TPGJsYiXlmjaPXY36WEwBUtBUA..abSUMYXDj fgNhpyIyzErD25ZfLzj57y27yT_McTH68pXXE70bS7aoJbRIE0b9xmxhjqXG82F50rBMTXZ.QtIb wNnoOJrWG0p3eK3ZcB9gISXi1OEcxKmOmmMXegIjwCRz38lHrTMMqSy5ibyvWj_JAy0LQsb1cn_Z 6mfkMbFRqJKyqXpFfCABMCWb95eNFDIfxtiP8xTJ9_SnqvTkXgyfCa8PIVTDd4_vhskDXj7udFwI vKbIgDQoa5gO3NQbIhX7_st67dTi5sW3nPhmZlvjadhCLUrIX8eO2JncS13ZM29sm7ytOKrJTeLP 0lfeGUy4NsqnIxfXnuvzdUjbwMbq5NCPz3wVed3Lhq_oAiKMih7cfpjfIxdBz4cctj2bKy0OKNNL JB2iOlG.BXDiWiubv50eoQXGtPcG8.0ApY5DICpKFvlCVjC38GdQDfq7v_JwPAlpBJXfCFH46iG. Bg5OzETEfNMlPML5RVza3X25Wub1I1JqT.fBL4MEH1bIpSWUEkT.fFwrrf2nm8P7tKUBHlkcxPLG .Ja2xo7hTsO5wWzUethRcKmPr34Bvl7g9NN3dKp6wwL48SPkb4bj2W88mm2vuSbVkfOt1dE11dak q1mfTGqwTHNi1ZzlBrPwb.ggPk8uNPYejgAfUdQJIrBqPCfq00Af50GBVpm.HUsZXeOd79miKRBj ykhsqQDuonGzBO3L5ziQ- Received: from sonic.gate.mail.ne1.yahoo.com by sonic316.consmr.mail.gq1.yahoo.com with HTTP; Tue, 26 Jan 2021 08:38:36 +0000 Received: by smtp415.mail.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 47b116be396610769645af5ab4438370; Tue, 26 Jan 2021 08:38:31 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: fsck strange output Message-Id: <8CE20D3F-9C06-4884-9811-3A0F4B4142A2@yahoo.com> Date: Tue, 26 Jan 2021 00:38:28 -0800 To: rozhuk.im@gmail.co, Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: <8CE20D3F-9C06-4884-9811-3A0F4B4142A2.ref@yahoo.com> X-Rspamd-Queue-Id: 4DQ0WL1jMhz3CPP X-Spamd-Bar: - X-Spamd-Result: default: False [-1.50 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.69.32:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.69.32:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.69.32:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.69.32:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 08:38:39 -0000 Rozhuk Ivan rozhuk.im at gmail.com wrote on Tue Jan 26 00:58:07 UTC 2021 : > This happen on 4 different systems, that: > - based on Ryzen zen/zen+ > - FreeBSD 13 > > 2 systems have ECC that works and show no errors. This is just a example-contexts note: I've seen what appears to be the same type of "UNEXPECTED SOFT UPDATE INCONSISTENCY" issue on an old 2-socket/2-cores-each PowerMac G5 powerpc64 configuration that was running main from after 5cc52631b3b8 . So, in this case, I do not expect that the problem is special to Ryzen or related CPUs. === Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Tue Jan 26 09:15:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1F7DD4E65F3 for ; Tue, 26 Jan 2021 09:15:23 +0000 (UTC) (envelope-from tsoome@me.com) Received: from pv50p00im-ztdg10022001.me.com (pv50p00im-ztdg10022001.me.com [17.58.6.58]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ1Kk1gmbz3Fyc for ; Tue, 26 Jan 2021 09:15:22 +0000 (UTC) (envelope-from tsoome@me.com) Received: from nazgul.lan (148-52-235-80.sta.estpak.ee [80.235.52.148]) by pv50p00im-ztdg10022001.me.com (Postfix) with ESMTPSA id 7A69CA0583; Tue, 26 Jan 2021 09:15:19 +0000 (UTC) From: Toomas Soome Message-Id: <5DFFA1C6-EBC3-4C22-B678-45BA48C9ECF1@me.com> Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: DRM and Radeon Date: Tue, 26 Jan 2021 11:15:17 +0200 In-Reply-To: <4933479c-b5a6-fa2e-09be-f5a0190d6f1b@plan-b.pwste.edu.pl> Cc: Graham Perrin , freebsd-current@freebsd.org To: Marek Zarychta References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> <4933479c-b5a6-fa2e-09be-f5a0190d6f1b@plan-b.pwste.edu.pl> X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-26_06:2021-01-25, 2021-01-26 signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 malwarescore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1011 mlxscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-2006250000 definitions=main-2101260050 X-Rspamd-Queue-Id: 4DQ1Kk1gmbz3Fyc X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.48 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[me.com]; MV_CASE(0.50)[]; RWL_MAILSPIKE_GOOD(0.00)[17.58.6.58:from]; R_SPF_ALLOW(-0.20)[+ip4:17.58.0.0/16]; DKIM_TRACE(0.00)[me.com:+]; DMARC_POLICY_ALLOW(-0.50)[me.com,quarantine]; NEURAL_HAM_SHORT(-0.98)[-0.980]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[me.com]; ASN(0.00)[asn:714, ipnet:17.58.0.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[17.58.6.58:from]; DWL_DNSWL_NONE(0.00)[me.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[me.com:s=1a1hai]; FREEFALL_USER(0.00)[tsoome]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; SPAMHAUS_ZRD(0.00)[17.58.6.58:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[80.235.52.148:received]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[17.58.6.58:from]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 09:15:23 -0000 > On 26. Jan 2021, at 10:18, Marek Zarychta = wrote: >=20 > W dniu 26.01.2021 o 08:58, Graham Perrin pisze: >> On 26/01/2021 07:02, Alexey Dokuchaev wrote: >> > Re: loading drm crashes system >> > =E2=80=A6 There are known issues with Radeon cards, they were quite = well >> > supported a year ago, then something got broken. I've promised to >> > bisect this and find the cause, but there were several >> > syscall-related changes in -CURRENT though the course of the last >> > year, so bisecting just the kernel is not enough (machine won't get >> > to login prompt if the userland does not match), which cripples the >> > process. >> > >> > I still intend to take this quest, just not sure when. :( >> > >> > ./danfe >> Any cards in particular? >> = =E2=80=93 whilst I didn't mention = Radeon there, for me it _was_ the Radeon story that seemed to improve a = few months ago. >> AMD Thames = [Radeon HD 7550M/7570M/7650M] >=20 >=20 >=20 > For example old RS880 [Radeon HD 4200]. After deprecation of = graphics/drm-fbsd12.0-kmod I found that it is still supported fine on = 12-STABLE with legacy /boot/kernel/radeonkms.ko from the base. While = trying the driver from graphics/drm-fbsd12.0-kmod I was not able to use = this card with gdm, only startx or x11/slim worked. On 13-ALPHA this = card still works fine with deprecated graphics/drm-legacy-kmod. >=20 >=20 Does gdm start X in specific way? I mean, afaik, gdm is X11 client as = any other, so the question would be, how does gdm get Xorg started, what = is different compared to startx etc? Might it be about gdm user = permissions to access drm devices? my 2cents.. toomas= From owner-freebsd-current@freebsd.org Tue Jan 26 09:37:34 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3C1474E6E71 for ; Tue, 26 Jan 2021 09:37:34 +0000 (UTC) (envelope-from sergey.dyatko@gmail.com) Received: from mail-lf1-x12a.google.com (mail-lf1-x12a.google.com [IPv6:2a00:1450:4864:20::12a]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ1qK3pcKz3HWw for ; Tue, 26 Jan 2021 09:37:33 +0000 (UTC) (envelope-from sergey.dyatko@gmail.com) Received: by mail-lf1-x12a.google.com with SMTP id b26so21843752lff.9 for ; Tue, 26 Jan 2021 01:37:33 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=/LTVnwvjU0sF/EoC/gqA/1mjL6/yv8ON72RP9h8l1W4=; b=lP9Je3VXeUHTPoOLZ8LXCkC4PXJya7WWviRv8K5aRXrmKP45/NCCkIYYVOifELlK/n bdsC0jO4xBdPhqN9vuaCmLIbX6xR9TH91IDJeuKEFlSJZOGxZqTbGrKDIYPqHYprs8l2 AuHlnBa+BeUx08Gdqr8kOv9XIylmnp09gk/N9NSUAuX9Nf8VoalR1v4f+H4oMx3hZ7fV 8NkZ3Z4kSb0AmjO+KoMyE2ZE5fH6he2yazWC91gtLm+9F4UyIZNWYyKMNDO+U/LqGX9s JMuJO3hPKY1JqxYb0aSNf5Qs7gEajr1y7j1BUvsfe+zbSDk0DyxBAgDIJtqRHDbiiLPF vVJg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=/LTVnwvjU0sF/EoC/gqA/1mjL6/yv8ON72RP9h8l1W4=; b=jZ4MN++5co45Ibe7ZnIQ6RGhqSHwP7nc5x2IAdkeX2itLfPjK5qG95U2BVFOpZu2EG 614TaeTUY2LeqJYXOd9hSFZ5b6Jtz+btWNxsViy/04eTCpYdcRq3+CAR8rjNs+Ko2mtg Cf3japSI2RcoyWJu+fkbypdgutRC+mmmkC0lX/OeBmL9pH0jYNtp3W3VdsZx0hi0OxxA H9rxCRzGDuWkwApc+5FkuNvRPagj6wB1ZfQk6JQvOSJj5XMg5vooC/dCbSLJT8r7ak/9 nvaOlhFd4AHQ9Kf5umx4hqR/W+ufmABroCJvDoHr+LLnQ/OYwwPXHLaeJUxhAu5YFZ8l EuVg== X-Gm-Message-State: AOAM530W2LKEnMLlViHUT5UzRwc4abt7XWnulSS8ei82WufVC+JZigqC L7irikKPk3BMu3KDUuhQX28cVcaP7GE= X-Google-Smtp-Source: ABdhPJx9dcwe1mRY77bvcfIJzqs2uk3PtK+GAjpnTvH2vezacS6nZ0S/CP3ODZZv3YzJoxPV11wM3g== X-Received: by 2002:ac2:5ed0:: with SMTP id d16mr667818lfq.644.1611653850495; Tue, 26 Jan 2021 01:37:30 -0800 (PST) Received: from laptop.domain ([86.57.155.118]) by smtp.gmail.com with ESMTPSA id p23sm2481157lfe.243.2021.01.26.01.37.29 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 26 Jan 2021 01:37:29 -0800 (PST) Date: Tue, 26 Jan 2021 12:37:59 +0300 From: "Sergey V. Dyatko" To: Subject: tools/toos/{zfsboottest|bootparttest} build broken Message-ID: <20210126123759.126b0e35@laptop.domain> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQ1qK3pcKz3HWw X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=lP9Je3VX; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sergeydyatko@gmail.com designates 2a00:1450:4864:20::12a as permitted sender) smtp.mailfrom=sergeydyatko@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::12a:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::12a:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::12a:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 09:37:34 -0000 Hi, root@hostname:/usr/src/tools/tools/bootparttest # make [Creating objdir /usr/obj/usr/src/amd64.amd64/tools/tools/bootparttest...] make: don't know how to make crc32.c. Stop make: stopped in /usr/src/tools/tools/bootparttest root@hostname:/usr/src/tools/tools/zfsboottest # make ln -sf /usr/src/sys/i386/include machine cc -O1 -I/usr/src/stand/zfs -I/usr/src/sys/cddl/boot/zfs -I. -fdiagnostics-show-option -W -Wextra -Wno-sign-compare -Wno-unused-parameter -m32 -g -MD -MF.depend.zfsboottest.o -MTzfsboottest.o -std=gnu99 -Wno-format-zero-length -fstack-protector-strong -Wsystem-headers -Werror -Wall -Wno-format-y2k -W -Wno-unused-parameter -Wstrict-prototypes -Wmissing-prototypes -Wpointer-arith -Wreturn-type -Wcast-qual -Wwrite-strings -Wswitch -Wshadow -Wunused-parameter -Wcast-align -Wchar-subscripts -Winline -Wnested-externs -Wredundant-decls -Wold-style-definition -Wno-pointer-sign -Wmissing-variable-declarations -Wthread-safety -Wno-empty-body -Wno-string-plus-int -Wno-unused-const-variable -Qunused-arguments -c /usr/src/tools/tools/zfsboottest/zfsboottest.c -o zfsboottest.o /usr/src/tools/tools/zfsboottest/zfsboottest.c:49:1: error: no previous prototype for function 'pager_output' [-Werror,-Wmissing-prototypes] pager_output(const char *line) ^ /usr/src/tools/tools/zfsboottest/zfsboottest.c:48:1: note: declare 'static' if the function is not intended to be used outside of this translation unit int ^ static /usr/src/tools/tools/zfsboottest/zfsboottest.c:57:1: error: no previous prototype for function 'ldi_get_size' [-Werror,-Wmissing-prototypes] ldi_get_size(void *priv) ^ /usr/src/tools/tools/zfsboottest/zfsboottest.c:56:1: note: declare 'static' if the function is not intended to be used outside of this translation unit uint64_t ^ static In file included from /usr/src/tools/tools/zfsboottest/zfsboottest.c:72: /usr/include/libzfs.h:37:10: fatal error: 'libnvpair.h' file not found #include ^~~~~~~~~~~~~ 3 errors generated. *** Error code 1 Stop. make: stopped in /usr/src/tools/tools/zfsboottest -- wbr, Sergey From owner-freebsd-current@freebsd.org Tue Jan 26 09:52:26 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9DD1F4E790B for ; Tue, 26 Jan 2021 09:52:26 +0000 (UTC) (envelope-from Krasznai.Andras@mands.hu) Received: from mail2.mands.hu (mail2.mands.hu [93.189.114.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client CN "*.mands.hu", Issuer "e-Szigno SSL CA 2014" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ28R51Rlz3Jcp for ; Tue, 26 Jan 2021 09:52:23 +0000 (UTC) (envelope-from Krasznai.Andras@mands.hu) From: =?iso-8859-2?Q?M=26S_-_Krasznai_Andr=E1s?= To: freebsd-current Subject: svnlite behaviour changed? Thread-Topic: svnlite behaviour changed? Thread-Index: AdbzxzXUn04Pu0w/ToOLjK8wgOp+4g== Date: Tue, 26 Jan 2021 09:52:15 +0000 Message-ID: <1a720adb5916423ca35396a23554c85f@MSEXCH13.mands.hu> Accept-Language: en-US, hu-HU Content-Language: hu-HU X-MS-Has-Attach: yes X-MS-TNEF-Correlator: x-ms-exchange-transport-fromentityheader: Hosted x-originating-ip: [192.168.16.11] MIME-Version: 1.0 X-Rspamd-Queue-Id: 4DQ28R51Rlz3Jcp X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of Krasznai.Andras@mands.hu designates 93.189.114.146 as permitted sender) smtp.mailfrom=Krasznai.Andras@mands.hu X-Spamd-Result: default: False [-1.59 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[93.189.114.146:from]; HAS_XOIP(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+a]; MIME_GOOD(-0.10)[multipart/related,multipart/alternative,text/plain]; DMARC_NA(0.00)[mands.hu]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[93.189.114.146:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; R_MIXED_CHARSET(0.71)[subject]; ASN(0.00)[asn:47116, ipnet:93.189.112.0/21, country:HU]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:~,4:~]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset="iso-8859-2" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 09:52:26 -0000 Good morning! I regularly sync my FreeBSD source tree with the central repository using s= vn update. I use a one-lis script to synchonize, which sends the output of= svn to a file, and also copies to the console. This list contained - accor= ding to the 'svn help update' - one line for any item which was updated or = inserted, deleted etc and at the end it shows the (new) revision number of = the repository. Some time ago during december this changed: the svn output contained one li= ne only, which informed me the new revision number but I did not get listin= g of the updated items. If there are no updated items then why is the revis= ion number increasing, or if there are updates the why aren't they listed? A week ago I installed FreeBSD-12.2-RELEASE, and now I saw the same: svn up= date changes the revision number of the source tree, and the newly compiled= kernel has that revision number, but no listing of updates. svn checkout = listed the files as they were read from the central repository. Is this a change of svn while the help text remained the old one, or there= is a change in the svn repositories, or is this part of the move to git? =DCdv=F6zlettel Krasznai Andr=E1s rendszerm=E9rn=F6k [M&S_logo] 1136 Budapest, Pann=F3nia utca 11. Tel: +36 1 703 2923 Mobil: +36 30 703 2923 K=F6zpont: +36 1 703 2920 Fax: +36 1 703 2949 email: krasznai.andras@mands.hu From owner-freebsd-current@freebsd.org Tue Jan 26 10:37:08 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DCD9D4E85E3 for ; Tue, 26 Jan 2021 10:37:08 +0000 (UTC) (envelope-from se@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ3845lHxz3LwG; Tue, 26 Jan 2021 10:37:08 +0000 (UTC) (envelope-from se@freebsd.org) Received: from Stefans-MBP-449.fritz.box (p200300cd5f21fb00249b097784dcfa70.dip0.t-ipconnect.de [IPv6:2003:cd:5f21:fb00:249b:977:84dc:fa70]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) (Authenticated sender: se/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 3ADA089E5; Tue, 26 Jan 2021 10:37:08 +0000 (UTC) (envelope-from se@freebsd.org) To: monochrome , freebsd-current@freebsd.org, vbox@freebsd.org References: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> From: Stefan Esser Subject: Re: problem building virtualbox-ose-kmod Message-ID: Date: Tue, 26 Jan 2021 11:37:07 +0100 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.16; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="P7OaZggnK0c8QiOnbeAJJ10r7XHon264g" X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 10:37:08 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --P7OaZggnK0c8QiOnbeAJJ10r7XHon264g Content-Type: multipart/mixed; boundary="AjrSzzkctWH2XIyyZPMuxFXfrBOhsVZYV"; protected-headers="v1" From: Stefan Esser To: monochrome , freebsd-current@freebsd.org, vbox@freebsd.org Message-ID: Subject: Re: problem building virtualbox-ose-kmod References: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> In-Reply-To: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> --AjrSzzkctWH2XIyyZPMuxFXfrBOhsVZYV Content-Type: multipart/mixed; boundary="------------69E1665DBA71162CF8272AFF" Content-Language: de-DE This is a multi-part message in MIME format. --------------69E1665DBA71162CF8272AFF Content-Type: text/plain; charset=windows-1252; format=flowed Content-Transfer-Encoding: quoted-printable Am 26.01.21 um 07:34 schrieb monochrome: > having this issue building virtualbox-ose-kmod, its been like this for = a=20 > while but I deinstalled and forgot, for quite a while now, maybe over a= =20 > month. now that I've moved from 13-current to stable/13 I thought I=20 > would try to put it back, but it still wont build. I haven't seen anyon= e=20 > else with this problem, did I miss a memo? I have sent a patch to vbox@on 2020-01-16, but only received an automatic reply that it had to be accepted by the moderator of the list (and never got any further reply or reaction on it). The signature of vm_map_protect() has changed, but the port has not been updated. Here is the patch in case the attachment gets stripped (but probably with messed-up white-space): Index: files/patch-src_VBox_Runtime_r0drv_freebsd_memobj-r0drv-freebsd.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- files/patch-src_VBox_Runtime_r0drv_freebsd_memobj-r0drv-freebsd.c=20 (revision 561738) +++ files/patch-src_VBox_Runtime_r0drv_freebsd_memobj-r0drv-freebsd.c=20 (working copy) @@ -421,7 +421,8 @@ @@ -826,6 +885,7 @@ DECLHIDDEN(int) rtR0MemObjNativeProtect(PRTR0MEMOBJ= INT ProtectionFlags |=3D VM_PROT_EXECUTE; - int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd,=20 ProtectionFlags, FALSE); +- int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd,=20 ProtectionFlags, FALSE); ++ int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd,=20 ProtectionFlags, 0, VM_MAP_PROTECT_SET_PROT); + IPRT_FREEBSD_RESTORE_EFL_AC(); if (krc =3D=3D KERN_SUCCESS) return VINF_SUCCESS; Seems that __FreeBSD_version has been bumped to 1300135 less than 2 hours before 0659df6faddfb27ba54a2cae2a12552cf4f823a0 and thus the patch could be made to depend on that __FreeBSD_version value, but I did not bother to add the condition since all my systems have been updated to newer versions. Regards, STefan > --- memobj-r0drv-freebsd.o --- > /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/fre= ebsd.amd64/release/bin/src/vboxdrv/r0drv/freebsd/memobj-r0drv-freebsd.c:8= 87:80:=20 > error: too few arguments to function call, expected 6, have 5 > =A0=A0=A0 int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd,=20 > ProtectionFlags, FALSE); > =A0=A0=A0=A0=A0=A0=A0=A0=A0=A0=A0=A0=A0 ~~~~~~~~~~~~~~ =A0=A0=A0=A0=A0= =A0 ^ > /usr/src/sys/vm/vm_map.h:517:5: note: 'vm_map_protect' declared here > int vm_map_protect(vm_map_t map, vm_offset_t start, vm_offset_t end, > =A0=A0=A0 ^ > 1 error generated. > *** [memobj-r0drv-freebsd.o] Error code 1 --------------69E1665DBA71162CF8272AFF Content-Type: text/plain; charset=UTF-8; x-mac-type="0"; x-mac-creator="0"; name="vbox-ose-port.diff" Content-Transfer-Encoding: quoted-printable Content-Disposition: attachment; filename="vbox-ose-port.diff" Index: files/patch-src_VBox_Runtime_r0drv_freebsd_memobj-r0drv-freebsd.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- files/patch-src_VBox_Runtime_r0drv_freebsd_memobj-r0drv-freebsd.c (re= vision 561738) +++ files/patch-src_VBox_Runtime_r0drv_freebsd_memobj-r0drv-freebsd.c (wo= rking copy) @@ -421,7 +421,8 @@ @@ -826,6 +885,7 @@ DECLHIDDEN(int) rtR0MemObjNativeProtect(PRTR0MEMOBJI= NT ProtectionFlags |=3D VM_PROT_EXECUTE; =20 - int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd, ProtectionFl= ags, FALSE); +- int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd, ProtectionFl= ags, FALSE); ++ int krc =3D vm_map_protect(pVmMap, AddrStart, AddrEnd, ProtectionFl= ags, 0, VM_MAP_PROTECT_SET_PROT); + IPRT_FREEBSD_RESTORE_EFL_AC(); if (krc =3D=3D KERN_SUCCESS) return VINF_SUCCESS; --------------69E1665DBA71162CF8272AFF-- --AjrSzzkctWH2XIyyZPMuxFXfrBOhsVZYV-- --P7OaZggnK0c8QiOnbeAJJ10r7XHon264g Content-Type: application/pgp-signature; name="OpenPGP_signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="OpenPGP_signature" -----BEGIN PGP SIGNATURE----- wsB5BAABCAAjFiEEo3HqZZwL7MgrcVMTR+u171r99UQFAmAP8NMFAwAAAAAACgkQR+u171r99UTE zgf+N6f7Ac1o28WjqBoWVWudWny341LQODErfx3GspMs1R1CcYouSPawpkUsabCioW3plqc179RC T4PZdXWF+rHklNWMJLOEtKvqOg2+IxKtrYkI/oYfANgochZL10oQsIi07nTk1n5763BljQbBz5O5 RsHPCVSDRfFl52DWvFvIBk0lslc8dkB1myqNrD4QeP6BiBLNDHvNLJxzhV7SVmB5UAuF1JPrNvNr iA7o2Y+7m7JjcfMGqVP++gi+KyhXqDOL2JycYMXhoGS4LYT321I1xq99xZfeltDfHdGfttqspube ttKv45f1h5IEIbfSCrxSjpx76R/uFD1C3v/mpSKgJw== =iy7u -----END PGP SIGNATURE----- --P7OaZggnK0c8QiOnbeAJJ10r7XHon264g-- From owner-freebsd-current@freebsd.org Tue Jan 26 10:41:22 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3D14A4E927F for ; Tue, 26 Jan 2021 10:41:22 +0000 (UTC) (envelope-from mueller6722@twc.com) Received: from p-impout002.msg.pkvw.co.charter.net (p-impout002aa.msg.pkvw.co.charter.net [47.43.26.133]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ3Dx4qdXz3MPH for ; Tue, 26 Jan 2021 10:41:21 +0000 (UTC) (envelope-from mueller6722@twc.com) Received: from localhost ([96.28.177.163]) by cmsmtp with ESMTP id 4LfhlxrXTFRqF4Lfhl7q3M; Tue, 26 Jan 2021 10:34:05 +0000 X-Authority-Analysis: v=2.3 cv=cZSsUULM c=1 sm=1 tr=0 a=xqrt2BZAGHte7XHhrxJgbA==:117 a=xqrt2BZAGHte7XHhrxJgbA==:17 a=HpEJnUlJZJkA:10 a=LYbk0FB-sS0YxaFKligA:9 Date: Tue, 26 Jan 2021 10:32:44 +0000 From: "Thomas Mueller" To: freebsd-current Subject: Re: svnlite behaviour changed? References: <1a720adb5916423ca35396a23554c85f@MSEXCH13.mands.hu> X-CMAE-Envelope: MS4wfCMtKeDtbgXn3q9qCuVaZeQkQ0Qs60LEsPMZL+6q21b1My7cavCyoqkJrLZX9tn9ElpGrKg3g6EP3mm6Rbykl40Jak7/jHOSr8WDfY66Cq80E+xTI+y2 UsttQLowoc9FaOHzLFbFr3nWIEKojP/cjaV4cuIMCQTZ/VwNHyyQ2ST4 X-Rspamd-Queue-Id: 4DQ3Dx4qdXz3MPH X-Spamd-Bar: +++++++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mueller6722@twc.com designates 47.43.26.133 as permitted sender) smtp.mailfrom=mueller6722@twc.com X-Spamd-Result: default: False [9.68 / 15.00]; RWL_MAILSPIKE_GOOD(0.00)[47.43.26.133:from]; FREEMAIL_FROM(0.00)[twc.com]; R_SPF_ALLOW(-0.20)[+ip4:47.43.26.0/24]; TO_DN_ALL(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[96.28.177.163:received]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[twc.com]; ASN(0.00)[asn:40294, ipnet:47.43.24.0/21, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[47.43.26.133:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_SPAM_SHORT(0.98)[0.983]; R_BAD_CTE_7BIT(3.50)[7bit]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[twc.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[47.43.26.133:from:127.0.2.255]; MISSING_MID(2.50)[]; NEURAL_SPAM_LONG(1.00)[1.000]; RCVD_TLS_LAST(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,body]; MAILMAN_DEST(0.00)[freebsd-current] X-Spam: Yes X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 10:41:22 -0000 Good morning! > I regularly sync my FreeBSD source tree with the central repository using svn update. I use a one-lis script to synchonize, which sends the output of svn to a file, and also copies to the console. This list contained - according to the 'svn help update' - one line for any item which was updated or inserted, deleted etc and at the end it shows the (new) revision number of the repository. > Some time ago during december this changed: the svn output contained one line only, which informed me the new revision number but I did not get listing of the updated items. If there are no updated items then why is the revision number increasing, or if there are updates the why aren't they listed? > A week ago I installed FreeBSD-12.2-RELEASE, and now I saw the same: svn update changes the revision number of the source tree, and the newly compiled kernel has that revision number, but no listing of updates. svn checkout listed the files as they were read from the central repository. > Is this a change of svn while the help text remained the old one, or there is a change in the svn repositories, or is this part of the move to git? > Üdvözlettel > Krasznai András > rendszermérnök I believe this is part of the switch to git; svn repository is no longer updated for stable/13 or main (which is HEAD). I now no longer use svn on src or doc tree; am tracking stable/13 and main; not interested in stable/12 or anything < 12. Tom From owner-freebsd-current@freebsd.org Mon Jan 25 21:00:42 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 61B894F18B8 for ; Mon, 25 Jan 2021 21:00:42 +0000 (UTC) (envelope-from rizzo@server.i805.com.br) Received: from server.i805.com.br (server.i805.com.br [50.7.13.2]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "freebsd12.vm", Issuer "freebsd12.vm" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DPj210JMxz3L0Q for ; Mon, 25 Jan 2021 21:00:40 +0000 (UTC) (envelope-from rizzo@server.i805.com.br) Received: from server.i805.com.br (localhost [127.0.0.1]) by server.i805.com.br (8.16.1/8.16.1) with ESMTPS id 10PL0WjO047139 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Mon, 25 Jan 2021 18:00:33 -0300 (-03) (envelope-from rizzo@server.i805.com.br) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=i805.com.br; s=myselector; t=1611608433; bh=WEs1f+PJT/MmefibiolhahGEBtDed8d7JNa6Cjc9X5k=; h=From:Subject:To:Date:Cc:In-Reply-To; b=jhj9hrArbztvuLc81DyCgUfCuhK2tzpyNRYNgvT3/gaF5KJoMRdCoSoohr+G6hivQ hAMGEu9Tf++7Hu8i8w3lH0WlA+h3PzA7Vs7uKMooVUoJjwhFjov1zvsnf0VdiUBqO6 3cqUrFy9qJF3wR6HatXlcHKtoM8C635qKOmrJll+tgtuAILot5ZJveTOpe7bV6TXtJ TVsBbtrY2Lf4CgUyjbRnwmPhLEV76JOVlnfsMhDC7O+m+p2PrwDNZgkm1HqwGTNwES el1PUjSKEba+aFssC5wm9sAKCWozzGCQFpqmaObah8H1mgZbJYzU0dyA3HYr8/rkKs yDgOTcg9l/xTA== Received: (from rizzo@localhost) by server.i805.com.br (8.16.1/8.16.1/Submit) id 10PL0V5A047138; Mon, 25 Jan 2021 18:00:31 -0300 (-03) (envelope-from rizzo) From: Nilton Jose Rizzo Message-Id: <202101252100.10PL0V5A047138@server.i805.com.br> Subject: Re: fsck strange output To: phk@phk.freebsd.dk (Poul-Henning Kamp) Date: Mon, 25 Jan 2021 18:00:31 -0300 (-03) Cc: rozhuk.im@gmail.com (Rozhuk Ivan), freebsd-current@freebsd.org In-Reply-To: <68616.1611607910@critter.freebsd.dk> X-Mailer: ELM [version 2.5 PL8] MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Spam-Status: No, score=-1.0 required=5.0 tests=ALL_TRUSTED autolearn=unavailable autolearn_force=no version=3.4.4 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on server.i805.com.br X-Rspamd-Queue-Id: 4DPj210JMxz3L0Q X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=i805.com.br header.s=myselector header.b=jhj9hrAr; dmarc=none; spf=none (mx1.freebsd.org: domain of rizzo@server.i805.com.br has no SPF policy when checking 50.7.13.2) smtp.mailfrom=rizzo@server.i805.com.br X-Spamd-Result: default: False [-3.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[i805.com.br:s=myselector]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[i805.com.br]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[50.7.13.2:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[i805.com.br:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[50.7.13.2:from]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:174, ipnet:50.7.8.0/21, country:US]; MAILMAN_DEST(0.00)[freebsd-current]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org] X-Mailman-Approved-At: Tue, 26 Jan 2021 10:53:53 +0000 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 25 Jan 2021 21:00:42 -0000 > > -------- > Rozhuk Ivan writes: > > > Disk is 100% alive, got same on other HW. > > A disk can be alive and still have individually unreadable sectors, > that is, IMO, the most common failure mode. > > Try: > recoverdisk -v /dev/whatever > > That will attempt to read all sectors on the disk. > It's possible fisical crash. You can try a fsck -f And after try smarttools ( in ports ) to check a health of S.M.A.R.T IHMO. > -- > Poul-Henning Kamp | UNIX since Zilog Zeus 3.20 > phk@FreeBSD.ORG | TCP/IP since RFC 956 > FreeBSD committer | BSD since 4.3-tahoe > Never attribute to malice what can adequately be explained by incompetence. > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > From owner-freebsd-current@freebsd.org Tue Jan 26 11:55:55 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3F9454EAEEA for ; Tue, 26 Jan 2021 11:55:55 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ4ty39MXz3hYN for ; Tue, 26 Jan 2021 11:55:54 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.16.1/8.15.2) with ESMTP id 10QBtpAp026947; Tue, 26 Jan 2021 11:55:51 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.16.1/8.16.1/Submit) id 10QBtobx026946; Tue, 26 Jan 2021 03:55:50 -0800 (PST) (envelope-from david) Date: Tue, 26 Jan 2021 03:55:50 -0800 From: David Wolfskill To: M&S - Krasznai =?iso-8859-1?Q?Andr=E1s?= Cc: freebsd-current Subject: Re: svnlite behaviour changed? Message-ID: Reply-To: current@freebsd.org Mail-Followup-To: current@freebsd.org, M&S - Krasznai =?iso-8859-1?Q?Andr=E1s?= , freebsd-current References: <1a720adb5916423ca35396a23554c85f@MSEXCH13.mands.hu> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ivBoOv/g8gPc0ksi" Content-Disposition: inline In-Reply-To: <1a720adb5916423ca35396a23554c85f@MSEXCH13.mands.hu> X-Rspamd-Queue-Id: 4DQ4ty39MXz3hYN X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of david@catwhisker.org designates 107.204.234.170 as permitted sender) smtp.mailfrom=david@catwhisker.org X-Spamd-Result: default: False [-2.40 / 15.00]; ARC_NA(0.00)[]; HAS_REPLYTO(0.00)[current@freebsd.org]; FREEFALL_USER(0.00)[david]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[107.204.234.170:from]; R_SPF_ALLOW(-0.20)[+ip4:107.204.234.170:c]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; DMARC_NA(0.00)[catwhisker.org]; NEURAL_SPAM_SHORT(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[107.204.234.170:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_TLS_LAST(0.00)[]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 11:55:55 -0000 --ivBoOv/g8gPc0ksi Content-Type: text/plain; charset=iso-8859-1 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Tue, Jan 26, 2021 at 09:52:15AM +0000, M&S - Krasznai Andr=E1s wrote: > Good morning! >=20 > I regularly sync my FreeBSD source tree with the central repository using= svn update. I use a one-lis script to synchonize, which sends the output = of svn to a file, and also copies to the console. This list contained - acc= ording to the 'svn help update' - one line for any item which was updated o= r inserted, deleted etc and at the end it shows the (new) revision number o= f the repository. >=20 > Some time ago during december this changed: the svn output contained one = line only, which informed me the new revision number but I did not get list= ing of the updated items. If there are no updated items then why is the rev= ision number increasing, or if there are updates the why aren't they listed? >=20 > A week ago I installed FreeBSD-12.2-RELEASE, and now I saw the same: svn = update changes the revision number of the source tree, and the newly compil= ed kernel has that revision number, but no listing of updates. svn checkou= t listed the files as they were read from the central repository. >=20 > Is this a change of svn while the help text remained the old one, or the= re is a change in the svn repositories, or is this part of the move to git? > =DCdv=F6zlettel >=20 > Krasznai Andr=E1s > rendszerm=E9rn=F6k First, please note that this list is "freebsd-current@" -- by definition, a "release" (such as FreeBSD-12.2-RELEASE) is not "current." Second, the revision number at the end of "svn update" is the last revision for the entire repository -- which is NOT the same thing as "the last revision for the branch" (that you are using). Thus, if there are changes to other branches (but not the one you are tracking), the revision number reported will continue to go up, but there will be no changes to the files in your branch. Finally, please be aware that the svn repository is no longer the "Source of Truth" for FreeBSD. Rather, for (recent) stable branches (<=3D 12), committed changes to the Source of Truth are subsequently "replayed" into the subversion repository. As I understand it, there are no plans to provide this for stable/13 or subsequent branches (or for current). Peace, david --=20 David H. Wolfskill david@catwhisker.org Some "Republicans" seem bound and determined to turn the party known for touting "law and order" into one that supports mob rule and insurrection. See https://www.catwhisker.org/~david/publickey.gpg for my public key. --ivBoOv/g8gPc0ksi Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGTBAEBCgB9FiEE4owz2QxMJyaxAefyQLJg+bY2PckFAmAQA0VfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldEUy OEMzM0Q5MEM0QzI3MjZCMTAxRTdGMjQwQjI2MEY5QjYzNjNEQzkACgkQQLJg+bY2 Pcl3rgf/YzrShYMda4IBCpDvSRQM2szH71dDlhNQ9vuxhITGb5C8YqJTNS2t2+Xx 0h00NtsHnCYwN3MQyxa5cvTBFrMXx67MrRdf5Z/CZI8HJD1uebCOg/rQzlj60+sU inZgnRq4CCIC9VwTBU4aEtQQjBsr7MySs63O35lxQ7YPl6c6Emiv6wqTwwUxgp/Z nzguPPWwu3p9jFxF4ZltdfFtsRYStxP0yNxUcAuzwF82TjoePAA0vUgF8EYq+Vsi JBhzJmKxaRytc5mRSQO4V/itoSY+fn+hzmXJE5bv6r4CP5nz42L8lD4cG0havmgB DtyggHxideHiSMt3KGjmYIvxgf0EOQ== =7ha7 -----END PGP SIGNATURE----- --ivBoOv/g8gPc0ksi-- From owner-freebsd-current@freebsd.org Tue Jan 26 12:29:35 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 033ED4ECA33 for ; Tue, 26 Jan 2021 12:29:35 +0000 (UTC) (envelope-from fluffy@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ5dp6kV6z3lDn; Tue, 26 Jan 2021 12:29:34 +0000 (UTC) (envelope-from fluffy@FreeBSD.org) Received: from [192.168.1.6] (host.212-19-20-216.broadband.redcom.ru [212.19.20.216]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) (Authenticated sender: fluffy) by smtp.freebsd.org (Postfix) with ESMTPSA id 7040A9E89; Tue, 26 Jan 2021 12:29:33 +0000 (UTC) (envelope-from fluffy@FreeBSD.org) Date: Tue, 26 Jan 2021 22:29:29 +1000 From: Dima Panov To: Stefan Esser , monochrome , vbox@freebsd.org, freebsd-current@freebsd.org Message-ID: In-Reply-To: References: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> Subject: Re: problem building virtualbox-ose-kmod MIME-Version: 1.0 Content-Type: multipart/signed; boundary="60100b2a_46e87ccd_a665"; protocol="application/pgp-signature" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 12:29:35 -0000 --60100b2a_46e87ccd_a665 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Content-Disposition: inline Moin=21 Stefan, please add check for =5F=5F=46reeBSD=5Fversion and fill PR or com= mit it directly with ports-secteam approval. -- Dima. (desktop, kde, x11, office, ports-secteam)=40=46reeBSD team (fluffy=40=46reeBSD.org, https://t.me/dima=5Fpanov) > On Tuesday, Jan 26, 2021 at 8:37 PM, Stefan Esser wrote: > Am 26.01.21 um 07:34 schrieb monochrome: > > having this issue building virtualbox-ose-kmod, its been like this fo= r a > > while but I deinstalled and forgot, for quite a while now, maybe over= a > > month. now that I've moved from 13-current to stable/13 I thought I > > would try to put it back, but it still wont build. I haven't seen any= one > > else with this problem, did I miss a memo=3F > > I have sent a patch to vbox=40on 2020-01-16, but only received an > automatic reply that it had to be accepted by the moderator of the > list (and never got any further reply or reaction on it). > > The signature of vm=5Fmap=5Fprotect() has changed, but the port has not= > been updated. > > Here is the patch in case the attachment gets stripped (but probably > with messed-up white-space): > > Index: files/patch-src=5FVBox=5FRuntime=5Fr0drv=5Ffreebsd=5Fmemobj-r0dr= v-freebsd.c > =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D > --- files/patch-src=5FVBox=5FRuntime=5Fr0drv=5Ffreebsd=5Fmemobj-r0drv-f= reebsd.c > (revision 561738) > +++ files/patch-src=5FVBox=5FRuntime=5Fr0drv=5Ffreebsd=5Fmemobj-r0drv-f= reebsd.c > (working copy) > =40=40 -421,7 +421,8 =40=40 > =40=40 -826,6 +885,7 =40=40 DECLHIDDEN(int) rtR0MemObjNativeProtect(PRT= R0MEMOBJINT > Protection=46lags =7C=3D VM=5FPROT=5FEXECUTE; > > - int krc =3D vm=5Fmap=5Fprotect(pVmMap, AddrStart, AddrEnd, > Protection=46lags, =46ALSE); > +- int krc =3D vm=5Fmap=5Fprotect(pVmMap, AddrStart, AddrEnd, > Protection=46lags, =46ALSE); > ++ int krc =3D vm=5Fmap=5Fprotect(pVmMap, AddrStart, AddrEnd, > Protection=46lags, 0, VM=5FMAP=5FPROTECT=5FSET=5FPROT); > + IPRT=5F=46REEBSD=5FRESTORE=5FE=46L=5FAC(); > if (krc =3D=3D KERN=5FSUCCESS) > return VIN=46=5FSUCCESS; > > Seems that =5F=5F=46reeBSD=5Fversion has been bumped to 1300135 less th= an > 2 hours before 0659df6faddfb27ba54a2cae2a12552cf4f823a0 and thus > the patch could be made to depend on that =5F=5F=46reeBSD=5Fversion val= ue, > but I did not bother to add the condition since all my systems have > been updated to newer versions. > > Regards, STefan > > > --- memobj-r0drv-freebsd.o --- > > /usr/ports/emulators/virtualbox-ose-kmod/work/VirtualBox-5.2.44/out/f= reebsd.amd64/release/bin/src/vboxdrv/r0drv/freebsd/memobj-r0drv-freebsd.c= :887:80: > > error: too few arguments to function call, expected 6, have 5 > > int krc =3D vm=5Fmap=5Fprotect(pVmMap, AddrStart, AddrEnd, > > Protection=46lags, =46ALSE); > > =7E=7E=7E=7E=7E=7E=7E=7E=7E=7E=7E=7E=7E=7E =5E > > /usr/src/sys/vm/vm=5Fmap.h:517:5: note: 'vm=5Fmap=5Fprotect' declared= here > > int vm=5Fmap=5Fprotect(vm=5Fmap=5Ft map, vm=5Foffset=5Ft start, vm=5F= offset=5Ft end, > > =5E > > 1 error generated. > > *** =5Bmemobj-r0drv-freebsd.o=5D Error code 1 --60100b2a_46e87ccd_a665 Content-Type: application/pgp-signature Content-Disposition: attachment; filename="signature.asc" -----BEGIN PGP SIGNATURE----- Version: Canary PGP V3 iQJVBAABCgA/OBxEaW1hIFBhbm92IChGcmVlQlNELk9SRyBDb21taXR0ZXIpIDxm bHVmZnlARnJlZUJTRC5PUkc+BQJgEAspAAoJEPuLoJ3VOY8puFcQAKUHvvMXbGvL Io/p5PA1RFWB6CgU7Fo3RztoTI7rtUk1VmPtOBuaZnhMIdjwbahUG36yBBnc8kUh YdQDP2qyrSiCI0SUYBkJ+CDaQXjmfP/ftnS/1mnQmY3VG2JOEQPj1ZsGo7qsYHsK tqa2ZLFZ3hufGxi4y+wzTsK5BgY+ZVUaEDFaSIXENoJX6KmHzB2dL6YsGAXNPhbJ YApmdatABTHqwXtVETpZlYfcNpuLSuky1iIq3RP0vuraMtwrkWYd/wdqs8FpTGdq 1GTqbXbxoZdE0BhO88ZxpiIhyrusVHhM2nEIIuLXQpzx3O6WrZiZ/Y3BLcoju25e zxL93bx9FOvphBsCYhHanRySbH/JADZ0LbnpIMd/gMo5XgYxnAcINCNmHtQzJz+O rJjHtgJAFiAu+275uAJ54kLQBg+CB282ZR+s4SSTjbEK4oJOqntwcnudmPXtJ396 MCrgaYu8+XHNDio92dH978pb4rTcLaLNRFDc4+RWZZd8IPLtJHjAAhKSpwqkmHIH FtxikxmUv5ahGhha0hF3Ub02r4Wu8uOoPDVTDLQ9KSCPI0ns/jLp/Lic16sTLKCf c7/lAn5B9LZNlE49v42pI6LqSDOaaHNZykAklGzifhTKcbbzLgBztpY4NvUzd09x FIhy2Y7ysxUW8KjncAdrh4qXBY6GKe+H =f9BJ -----END PGP SIGNATURE----- --60100b2a_46e87ccd_a665-- From owner-freebsd-current@freebsd.org Tue Jan 26 12:42:49 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B5DF94ED207 for ; Tue, 26 Jan 2021 12:42:49 +0000 (UTC) (envelope-from manu@bidouilliste.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQ5x536g8z3m9x for ; Tue, 26 Jan 2021 12:42:49 +0000 (UTC) (envelope-from manu@bidouilliste.com) Received: by mailman.nyi.freebsd.org (Postfix) id 6AE374ED206; Tue, 26 Jan 2021 12:42:49 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6A9DB4ED194; Tue, 26 Jan 2021 12:42:49 +0000 (UTC) (envelope-from manu@bidouilliste.com) Received: from mx.blih.net (mx.blih.net [212.83.155.74]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx.blih.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ5x460qtz3mDK; Tue, 26 Jan 2021 12:42:48 +0000 (UTC) (envelope-from manu@bidouilliste.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bidouilliste.com; s=mx; t=1611664965; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=259mCduDEwD+bhch8giOY8Ouy9DH3rMokiU0UF9JGjQ=; b=REfcMCKEuBPB0dpoVoU/ncoVhrEaSGMGRA98V0x0t//zP4NRaZsXsHaV2ZWIjRQVjuYwJ/ w/6I4zhAqsVxe9Ucq1nBGaBS1aBmFVB/FJ0ecrO7WQ0+Bui0X+lqz8NPFB/d6BaYQoPV9L 2VyV9IWsFTsAn5GcNjCDGglpjRj9wFw= Received: from amy.home (lfbn-idf2-1-745-114.w86-247.abo.wanadoo.fr [86.247.192.114]) by mx.blih.net (OpenSMTPD) with ESMTPSA id ac828d50 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Tue, 26 Jan 2021 12:42:45 +0000 (UTC) Date: Tue, 26 Jan 2021 13:42:45 +0100 From: Emmanuel Vadot To: Alexey Dokuchaev Cc: Robert Huff , Niclas Zeising , current@freebsd.org, x11@freebsd.org, =?ISO-8859-1?Q?T=3Fl?= Coosemans Subject: Re: loading drm crashes system Message-Id: <20210126134245.e2aca7ed6061505ff4a3cedc@bidouilliste.com> In-Reply-To: <20210126070211.GB43439@FreeBSD.org> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQ5x460qtz3mDK X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[freebsd]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 12:42:49 -0000 On Tue, 26 Jan 2021 07:02:11 +0000 Alexey Dokuchaev wrote: > On Mon, Jan 25, 2021 at 10:21:16PM -0500, Robert Huff wrote: > > Niclas Zeising asks: > > > When did it stop working? > > > > September ... I _think_. > > Yeah, that sounds about right. > > There are known issues with Radeon cards, they were quite well supported > a year ago, then something got broken. I've promised to bisect this and > find the cause, but there were several syscall-related changes in -CURRENT > though the course of the last year, so bisecting just the kernel is not > enough (machine won't get to login prompt if the userland does not match), > which cripples the process. > > I still intend to take this quest, just not sure when. :( > > ./danfe So back in November I applied a few commits from tijl@ related to radeon and i386 (added to cc) : https://github.com/freebsd/drm-kmod/commits/5.4-lts?author=tijl@coosemans.org For me this fixed radeon so that gives some timeline if someone with non working hardware wants to bisect. I know that bisecting drm-kmod is somewhat hard as you always need matching kernel code when we update it to use some new functionality in base linuxkpi but there is nothing that I can do about it. It might work and be quicker to only bisect the kernel with a stable/12 userland (no need to recompile) so I would start by testing a kernel from early november and same date for drm-kmod. Tijl since you also reported a build failure a few days/weeks ago for radeon can you report if your radeon card works ? (And which one it is). Cheers, -- Emmanuel Vadot From owner-freebsd-current@freebsd.org Tue Jan 26 12:55:49 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 96EBB4ED0EC for ; Tue, 26 Jan 2021 12:55:49 +0000 (UTC) (envelope-from zarychtam@plan-b.pwste.edu.pl) Received: from plan-b.pwste.edu.pl (plan-b.pwste.edu.pl [IPv6:2001:678:618::40]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "plan-b.pwste.edu.pl", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ6D43zjqz3n1V for ; Tue, 26 Jan 2021 12:55:48 +0000 (UTC) (envelope-from zarychtam@plan-b.pwste.edu.pl) Received: from fomalhaut.potoki.eu (dom.potoki.eu [62.133.140.50]) (authenticated bits=0) by plan-b.pwste.edu.pl (8.16.1/8.16.1) with ESMTPSA id 10QCti28072173 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128 verify=NO); Tue, 26 Jan 2021 13:55:44 +0100 (CET) (envelope-from zarychtam@plan-b.pwste.edu.pl) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=plan-b.pwste.edu.pl; s=plan-b-mailer; t=1611665744; bh=LMYaK29Gz88hgUGmzYdpYt1j0EpPydlF4uXOQX4YW9o=; h=From:To:Cc:References:Subject:Date:In-Reply-To; b=Hz/kdox6ECYMtSwIkG5oyJ9bZ3V5oSzt4lFDie1P0OV320AfMdfsVnXqAVIZbBzRs 564WTX7UpMTO6DI1d14zXQg3RaXnSkg89iZXD6VqrprCXUBVT28fL0fqGn//E0Tr0T ggGoTC1FmqI5EE4RkR/bidb1OmecbmbY3FBhnb7pu77J0WAKjexd20jFdF4EYyVQOG KN+LaNA6mAiXOiwQsbZGGL9TO1yyqHVPJSDmypajTWwyDxKNIApt976QnG90KKAQRf lJYIMZn2JzycMa40vSGQODKzY3mS+FvJmLGYkfuNBTzFSe34/aV/bvEtiIojirbvEG k6rmCyEDqWZ2A== X-Authentication-Warning: plan-b.pwste.edu.pl: Host dom.potoki.eu [62.133.140.50] claimed to be fomalhaut.potoki.eu From: Marek Zarychta To: Toomas Soome Cc: Graham Perrin , freebsd-current@freebsd.org References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> <4933479c-b5a6-fa2e-09be-f5a0190d6f1b@plan-b.pwste.edu.pl> <5DFFA1C6-EBC3-4C22-B678-45BA48C9ECF1@me.com> Subject: Re: DRM and Radeon Message-ID: Date: Tue, 26 Jan 2021 13:55:38 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <5DFFA1C6-EBC3-4C22-B678-45BA48C9ECF1@me.com> Content-Language: en-US X-Rspamd-Queue-Id: 4DQ6D43zjqz3n1V X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=plan-b.pwste.edu.pl header.s=plan-b-mailer header.b=Hz/kdox6; dmarc=pass (policy=none) header.from=plan-b.pwste.edu.pl; spf=none (mx1.freebsd.org: domain of zarychtam@plan-b.pwste.edu.pl has no SPF policy when checking 2001:678:618::40) smtp.mailfrom=zarychtam@plan-b.pwste.edu.pl X-Spamd-Result: default: False [-5.79 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; HAS_XAW(0.00)[]; DKIM_TRACE(0.00)[plan-b.pwste.edu.pl:+]; DMARC_POLICY_ALLOW(-0.50)[plan-b.pwste.edu.pl,none]; NEURAL_HAM_SHORT(-0.99)[-0.994]; FREEMAIL_TO(0.00)[me.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:678:618::40:from]; ASN(0.00)[asn:206006, ipnet:2001:678:618::/48, country:PL]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[plan-b.pwste.edu.pl:s=plan-b-mailer]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; DWL_DNSWL_MED(-2.00)[pwste.edu.pl:dkim]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; SPAMHAUS_ZRD(0.00)[2001:678:618::40:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org] Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 12:55:49 -0000 W dniu 26.01.2021 o=C2=A010:15, Toomas Soome pisze: > > >> On 26. Jan 2021, at 10:18, Marek Zarychta=20 >> > > wrote: >> >> W dniu 26.01.2021 o=C2=A008:58, Graham Perrin pisze: >>> On 26/01/2021 07:02, Alexey Dokuchaev wrote: >>> > Re: loading drm crashes system >>> > =E2=80=A6 There are known issues with Radeon cards, they were quite= well >>> > supported a year ago, then something got broken. I've promised to >>> > bisect this and find the cause, but there were several >>> > syscall-related changes in -CURRENT though the course of the last >>> > year, so bisecting just the kernel is not enough (machine won't get= >>> > to login prompt if the userland does not match), which cripples the= >>> > process. >>> > >>> > I still intend to take this quest, just not sure when. :( >>> > >>> > ./danfe >>> Any cards in particular? >>> >> >=20 >>> =E2=80=93 whilst I didn't mention Radeon there, for me it _was_ the R= adeon=20 >>> story that seemed to improve a few months ago. >>> >> > AMD Thames= =20 >>> [Radeon HD 7550M/7570M/7650M] >> >> >> >> For example old RS880 [Radeon HD 4200]. After deprecation of=20 >> graphics/drm-fbsd12.0-kmod I found that it is still supported fine on = >> 12-STABLE with legacy /boot/kernel/radeonkms.ko from the base. While=20 >> trying the driver from graphics/drm-fbsd12.0-kmod I was not able to=20 >> use this card with gdm, only startx or x11/slim worked. On 13-ALPHA=20 >> this card still works fine with deprecated graphics/drm-legacy-kmod. >> >> > > Does X11 cliegdm start X in specific way? I mean, afaik, gdm is nt as=20 > any other, so the question would be, how does gdm get Xorg started,=20 > what is different compared to startx etc? Might it be about gdm user=20 > permissions to access drm devices? > > my 2cents.. > toomas Thanks for the clue, I added user gdm to the group video, but nothing=20 changed. Gdm starts, after some delay, but there is no visible username/ password = prompt or it's beyond the viewable area, on the other hand, the viewable = area seems to fit the screen correctly. To start gdm I have to wait a=20 while until something happens with the resolution of text in the=20 console. I have to mention that with this driver, the vty console=20 resolution changes a while after loading the driver and starting all=20 services (usually it lasts one minute or less after services startup)=20 and after this time the text on vty can be seen in a kind of window=20 covering: on first monitor 50% of the screen in left upper corner and on = the second monitor, the viewable area of text console exceeds screen=20 dimensions, but on both the text in console looks blurry. Please don't get it wrong it's nether=C2=A0 EFI nor boot loader problem s= ince=20 this is an old machine with BIOS only and I am booting FreeBSD on this=20 with GRUB2 (booting, not chainloading). With /boot/kernel/radeonkms.ko=20 or radeonks.ko from deprecated graphics/drm-legacy-kmod everything looks = fine on vty on both monitors and login and password prompt for gdm=20 appears correctly. So this is not only gdm issue. I have tested drm-current-kmod with fresh 14-CURRENT sources and indeed, = it panicked for me. I have installed deprecated drm-legacy-kmod and it=20 works fine with this old HW and 14-CURRENT. While writing this post I am using: FreeBSD 14.0-CURRENT #3 main-c256281-g25cdacf79b0 drm-legacy-kmod-g20200825 gpu-firmware-kmod-g20201213 --=20 Marek Zarychta From owner-freebsd-current@freebsd.org Tue Jan 26 13:01:08 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AA1DF4ED9E4 for ; Tue, 26 Jan 2021 13:01:08 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQ6LD3QJMz3ns5 for ; Tue, 26 Jan 2021 13:01:08 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 737B44EDD55; Tue, 26 Jan 2021 13:01:08 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7338F4EDD54 for ; Tue, 26 Jan 2021 13:01:08 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ6LD2KQcz3ngk for ; Tue, 26 Jan 2021 13:01:08 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1611666066; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=BJOGWzNNFCC7VJ5CXNaP7nGt/Bw=; b=XiAaHODIeEi2yN6tjljAN4AS92BzpanXKumSP9OoqO/twUVdWPKWUTA4ICml58vt DgtHEi8pOfrPElnqb1FiTs3DfAVomITuDc5s4E5QSqTmDK8Jm8JQvJjirsJpAgdz Hx1E+Y7QvKDs22tokbriKp9Ps2tgc9fsIs8Dpm5A3xb1pA0T3JO9M9wEPqRcZdEb KGeVOQBiFbgDm/WJFW66uh6XGRVCAP/JzghPcD8JaGFjmgOJ/gc589w3tE1BilPT El3hihDouVj8dzAXJoHhqiZXAopBpnAPnvU9vxrkG3RDpnwC5gdtL6iyvLhdGVIn mCIiYpYZPhMb1QEa79ot+A==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.3 cv=d5KLNirE c=1 sm=1 tr=0 cx=a_idp_x a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=EmqxpYm9HcoA:10 a=48faUk6PgeAA:10 a=YCuWtGvEc7MNLaRN3yIA:9 a=CjuIK1q_8ugA:10 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:23270] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id 79/68-41496-19210106; Tue, 26 Jan 2021 08:01:05 -0500 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24592.4752.944930.118483@jerusalem.litteratus.org> Date: Tue, 26 Jan 2021 08:01:04 -0500 From: Robert Huff To: Alexey Dokuchaev CC: Niclas Zeising , current@freebsd.org, x11@freebsd.org Subject: Re: loading drm crashes system In-Reply-To: <20210126070211.GB43439@FreeBSD.org> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verditct: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledrvdehgdegjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfujgfpteevqfftnfgvrghrnhhinhhgpdftvefppdfqfgfvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeggtgfgkfffhffvufgjfhfosehtjeertdertddvnecuhfhrohhmpeftohgsvghrthcujfhufhhfuceorhhosggvrhhthhhufhhfsehrtghnrdgtohhmqeenucggtffrrghtthgvrhhnpedttdelkeethfeggefgveelueegvdeludehueeuvdegjeeivdffiefffeethffgueenucfkphepvddtledriedrvdeftddrgeeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledriedrvdeftddrgeeknedpmhgrihhlfhhrohhmpehrohgsvghrthhhuhhffhesrhgtnhdrtghomhenpdhrtghpthhtohepuggrnhhfvgesfhhrvggvsghsugdrohhrghen X-Rspamd-Queue-Id: 4DQ6LD2KQcz3ngk X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[freebsd]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 13:01:08 -0000 Hello: > > Niclas Zeising asks: > > > When did it stop working? > > > > September ... I _think_. > > Yeah, that sounds about right. > > There are known issues with Radeon cards, they were quite well > supported a year ago, then something got broken. I've promised to > bisect this and find the cause, but there were several syscall-related > changes in -CURRENT though the course of the last year, so bisecting > just the kernel is not enough (machine won't get to login prompt if > the userland does not match), which cripples the process. > > I still intend to take this quest, just not sure when. :( Expanding on "September ... I think": Try September 26 as a reference date. Sometime close to then I a) updated world+kernel to the latest version of current, so also b) updated to the latest drm-current-kmod and gpu-firmware. Question: is there a way for the less sophisticated user to tell whether the cause is in the drm knod or the firmware kmod? Hope this helps, Robert Huff -- Hello ... my name is SARS-CoV-2. You are not wearing a mask? Prepare to die! From owner-freebsd-current@freebsd.org Tue Jan 26 14:01:55 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 18BB74EFB6F for ; Tue, 26 Jan 2021 14:01:55 +0000 (UTC) (envelope-from Krasznai.Andras@mands.hu) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQ7hL5Dqsz3tpN for ; Tue, 26 Jan 2021 14:01:54 +0000 (UTC) (envelope-from Krasznai.Andras@mands.hu) Received: by mailman.nyi.freebsd.org (Postfix) id B2ED34EF172; Tue, 26 Jan 2021 14:01:54 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B2A7F4EFBC1 for ; Tue, 26 Jan 2021 14:01:54 +0000 (UTC) (envelope-from Krasznai.Andras@mands.hu) Received: from mail2.mands.hu (mail2.mands.hu [93.189.114.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (Client CN "*.mands.hu", Issuer "e-Szigno SSL CA 2014" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ7hK20Z3z3tlg for ; Tue, 26 Jan 2021 14:01:52 +0000 (UTC) (envelope-from Krasznai.Andras@mands.hu) From: =?iso-8859-1?Q?M=26S_-_Krasznai_Andr=E1s?= To: "current@freebsd.org" Subject: Re: svnlite behaviour changed? Thread-Topic: svnlite behaviour changed? Thread-Index: AdbzxzXUn04Pu0w/ToOLjK8wgOp+4gACpkgAAAY1t2I= Date: Tue, 26 Jan 2021 14:01:49 +0000 Message-ID: <1611669709167.42612@mands.hu> References: <1a720adb5916423ca35396a23554c85f@MSEXCH13.mands.hu>, In-Reply-To: Accept-Language: en-US, hu-HU Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-ms-exchange-transport-fromentityheader: Hosted x-originating-ip: [192.168.16.11] Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-Rspamd-Queue-Id: 4DQ7hK20Z3z3tlg X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of Krasznai.Andras@mands.hu designates 93.189.114.146 as permitted sender) smtp.mailfrom=Krasznai.Andras@mands.hu X-Spamd-Result: default: False [-1.67 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[93.189.114.146:from]; HAS_XOIP(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; R_SPF_ALLOW(-0.20)[+a]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[93.189.114.146:from:127.0.2.255]; DMARC_NA(0.00)[mands.hu]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; TO_DN_EQ_ADDR_ALL(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; R_MIXED_CHARSET(0.62)[subject]; ASN(0.00)[asn:47116, ipnet:93.189.112.0/21, country:HU]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 14:01:55 -0000 Thanks!=0A= =0A= I did not make it very clear but the whole thing started when I used FreeBS= D-CURRENT - that is sometime in December I observed that although the revis= ion number is increased, there are no updates listed; the fact that the rev= ision number is the revision of the whole repository and not the revision o= f the branch I follow explains. There was some kind of source freeze of the= CURRENT branch if I recollect correctly the release schedule. A week ago I= installed FreeBSD-12.2-RELEASE, but its source changes rather rarely so I = again I got only increasing revision numbers.=0A= =0A= Thanks again!=0A= =0A= best regards=0A= =0A= Andr=E1s Krasznai=0A= =0A= =0A= =0A= ________________________________________=0A= From: David Wolfskill =0A= Sent: Tuesday, January 26, 2021 12:55 PM=0A= To: M&S - Krasznai Andr=E1s=0A= Cc: freebsd-current=0A= Subject: Re: svnlite behaviour changed?=0A= =0A= On Tue, Jan 26, 2021 at 09:52:15AM +0000, M&S - Krasznai Andr=E1s wrote:=0A= > Good morning!=0A= >=0A= > I regularly sync my FreeBSD source tree with the central repository using= svn update. I use a one-lis script to synchonize, which sends the output = of svn to a file, and also copies to the console. This list contained - acc= ording to the 'svn help update' - one line for any item which was updated o= r inserted, deleted etc and at the end it shows the (new) revision number o= f the repository.=0A= >=0A= > Some time ago during december this changed: the svn output contained one = line only, which informed me the new revision number but I did not get list= ing of the updated items. If there are no updated items then why is the rev= ision number increasing, or if there are updates the why aren't they listed= ?=0A= >=0A= > A week ago I installed FreeBSD-12.2-RELEASE, and now I saw the same: svn = update changes the revision number of the source tree, and the newly compil= ed kernel has that revision number, but no listing of updates. svn checkou= t listed the files as they were read from the central repository.=0A= >=0A= > Is this a change of svn while the help text remained the old one, or the= re is a change in the svn repositories, or is this part of the move to git?= =0A= > =DCdv=F6zlettel=0A= >=0A= > Krasznai Andr=E1s=0A= > rendszerm=E9rn=F6k=0A= =0A= First, please note that this list is "freebsd-current@" -- by=0A= definition, a "release" (such as FreeBSD-12.2-RELEASE) is not "current."=0A= =0A= Second, the revision number at the end of "svn update" is the last=0A= revision for the entire repository -- which is NOT the same thing as=0A= "the last revision for the branch" (that you are using).=0A= =0A= Thus, if there are changes to other branches (but not the one you are=0A= tracking), the revision number reported will continue to go up, but=0A= there will be no changes to the files in your branch.=0A= =0A= Finally, please be aware that the svn repository is no longer the=0A= "Source of Truth" for FreeBSD. Rather, for (recent) stable branches (<=3D= =0A= 12), committed changes to the Source of Truth are subsequently=0A= "replayed" into the subversion repository. As I understand it, there=0A= are no plans to provide this for stable/13 or subsequent branches (or=0A= for current).=0A= =0A= Peace,=0A= david=0A= --=0A= David H. Wolfskill david@catwhisker.org=0A= Some "Republicans" seem bound and determined to turn the party known for=0A= touting "law and order" into one that supports mob rule and insurrection.= =0A= =0A= See https://www.catwhisker.org/~david/publickey.gpg for my public key.=0A= From owner-freebsd-current@freebsd.org Tue Jan 26 14:08:46 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 925624F02EF for ; Tue, 26 Jan 2021 14:08:46 +0000 (UTC) (envelope-from rozhuk.im@gmail.com) Received: from mail-lj1-x233.google.com (mail-lj1-x233.google.com [IPv6:2a00:1450:4864:20::233]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ7rG0qQZz3w6g for ; Tue, 26 Jan 2021 14:08:45 +0000 (UTC) (envelope-from rozhuk.im@gmail.com) Received: by mail-lj1-x233.google.com with SMTP id l12so17163341ljc.3 for ; Tue, 26 Jan 2021 06:08:45 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:date:to:cc:subject:message-id:in-reply-to:references :mime-version:content-transfer-encoding; bh=Sg4hoWHgMLNr211kMM34661P6Ox4pDtPFMHYA6hHCKI=; b=ELmvWN4zNAlTAwf2tmePgXsOCYtZ3QE3CqwL44i8y808cnEURqBa6OkAow16+h7vya lgdrfyq6kKBn3V3n3KkCatCI/P0QF3EF8HuMnl/C68Ue9Li6uD241bH8gpyRqpr8zME8 fz/86qtf38CTcB58FzGqSjd0lSROC6kossfmiMNJk6rSqTFFMneRI4OgRh8es22t6XRH DWnBw3aHnPk0Jwk30Le3K5WWpNj9Lsbf9HLDK37KQ4zE6ij3KIvfOihXTPrAK4eYBa5S pJHXeokPVSTNeu1JDI1re6nEWJVQ2Umq1aIkLhdtaq2R9BG8aSWhS5uWz1HjzWJdTD1P 0YBw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:date:to:cc:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=Sg4hoWHgMLNr211kMM34661P6Ox4pDtPFMHYA6hHCKI=; b=NRcbPFagBsxFH40MuShGU1aBSH/apyJiXdmD9zi1Gi7vPCIo/OiCmsdSb4uBKjnNpu vdtSg2d46HKUKYatHmosLN5qwc7U+uUwCsY6efRhaB9n56DUrfYa/PPL+q0XsjcWCKY3 js88nQBzOvC/iSTRLxrr+JAIVtyae7bgv7hNmaz66dIyk7e8Z8KairWyZonClzou9dWO pPr3De1aUIVfJzPxrE05bpVpGWCOvJHlz9Bz1LqnMxe63p9WZ8tcbZ5MMNlD6yC6W2dQ 7WoDx8lsvKE5n6m/+Tb5AqTNBa3nvvn2/S8hVTUPLwS662TzUEx80r++MXf0ffJ9MPKl gvxQ== X-Gm-Message-State: AOAM532yf3kxZZeSMGEaVsBHqiu4B0y7SjQsZN4XrVuUxZnPUXuaWOAo GSmZj735Smk959F1bZemXkFdMAVBqTo= X-Google-Smtp-Source: ABdhPJxit4OjeWjp3bfMdIk+OlcIgpG527OkRyKqZnwEwzS/iWl6pW4XFc9LPx1mMm/qdL3FU0qKqA== X-Received: by 2002:a2e:9a4f:: with SMTP id k15mr2998954ljj.157.1611670123432; Tue, 26 Jan 2021 06:08:43 -0800 (PST) Received: from rimwks.local ([2001:470:1f15:3d8:7285:c2ff:fe37:5722]) by smtp.gmail.com with ESMTPSA id c16sm335292lfb.302.2021.01.26.06.08.42 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 26 Jan 2021 06:08:42 -0800 (PST) From: Rozhuk Ivan X-Google-Original-From: Rozhuk Ivan Date: Tue, 26 Jan 2021 17:08:41 +0300 To: Kirk McKusick Cc: freebsd-current@freebsd.org Subject: Re: fsck strange output Message-ID: <20210126170841.7efc58c4@rimwks.local> In-Reply-To: <202101252340.10PNeCR4068248@chez.mckusick.com> References: <20210125232933.1ad108d1@rimwks.local> <202101252340.10PNeCR4068248@chez.mckusick.com> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQ7rG0qQZz3w6g X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=ELmvWN4z; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of rozhukim@gmail.com designates 2a00:1450:4864:20::233 as permitted sender) smtp.mailfrom=rozhukim@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::233:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::233:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::233:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 14:08:46 -0000 On Mon, 25 Jan 2021 15:40:12 -0800 Kirk McKusick wrote: > Please try this patch to fsck_ffs and see if it fixes your problem. > > Kirk McKusick > > =-=-= > > *** sbin/fsck_ffs/inode.c.orig 2021-01-07 15:04:04.969086284 > -0800 --- sbin/fsck_ffs/inode.c 2021-01-25 15:29:06.404803358 > -0800 *************** > *** 611,618 **** > sizeof(struct ufs1_dinode) : sizeof(struct > ufs2_dinode)); readpercg = inosused / fullcnt; > partialcnt = inosused % fullcnt; > ! partialsize = partialcnt * ((sblock.fs_magic == > FS_UFS1_MAGIC) ? ! sizeof(struct ufs1_dinode) : > sizeof(struct ufs2_dinode)); if (partialcnt != 0) { > readpercg++; > } else { > --- 611,619 ---- > sizeof(struct ufs1_dinode) : sizeof(struct > ufs2_dinode)); readpercg = inosused / fullcnt; > partialcnt = inosused % fullcnt; > ! partialsize = fragroundup(&sblock, > ! partialcnt * ((sblock.fs_magic == FS_UFS1_MAGIC) ? > ! sizeof(struct ufs1_dinode) : sizeof(struct > ufs2_dinode))); if (partialcnt != 0) { > readpercg++; > } else { https://github.com/rozhuk-im/freebsd/commit/5e8bfa01830e2b6ecb88e572064c6fffe5a2df2d (if I apply correct :) ) With this patch - seems no errors, thanks! From owner-freebsd-current@freebsd.org Tue Jan 26 14:45:55 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 525FC4F13E4 for ; Tue, 26 Jan 2021 14:45:55 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail.madpilot.net (vogon.madpilot.net [159.69.1.99]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ8g713CPz4T7D; Tue, 26 Jan 2021 14:45:55 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail (mail [192.168.254.3]) by mail.madpilot.net (Postfix) with ESMTP id 4DQ8g54qZfz6drZ; Tue, 26 Jan 2021 15:45:53 +0100 (CET) Received: from mail.madpilot.net ([192.168.254.3]) by mail (mail.madpilot.net [192.168.254.3]) (amavisd-new, port 10026) with ESMTP id V5GCDwiIdhVy; Tue, 26 Jan 2021 15:45:51 +0100 (CET) Subject: Re: problem building virtualbox-ose-kmod To: Dima Panov , Stefan Esser , monochrome , vbox@freebsd.org, freebsd-current@freebsd.org References: <58f5f4d8-c722-35eb-a66e-225d799e4a89@twcny.rr.com> From: Guido Falsi Message-ID: <8e263f0d-65e1-c639-ea4d-16faa1cf628a@madpilot.net> Date: Tue, 26 Jan 2021 15:45:51 +0100 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQ8g713CPz4T7D X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 14:45:55 -0000 On 26/01/21 13:29, Dima Panov wrote: > Moin! > > Stefan, please add check for __FreeBSD_version and fill PR or commit it directly with ports-secteam approval. > There's a bug report for this: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=252675 And another one which is marked as a duplicate of this. In the duplicate I posted a patch including the __FreeBSD_version check. Since you just gave approval for that I'll go ahead and commit, it should also be merged to 2021Q1, since it affects 13. -- Guido Falsi From owner-freebsd-current@freebsd.org Tue Jan 26 15:21:45 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A19F54F2C9E for ; Tue, 26 Jan 2021 15:21:45 +0000 (UTC) (envelope-from tijl@freebsd.org) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQ9ST3dhVz4XMh for ; Tue, 26 Jan 2021 15:21:45 +0000 (UTC) (envelope-from tijl@freebsd.org) Received: by mailman.nyi.freebsd.org (Postfix) id 7CA3F4F2BAA; Tue, 26 Jan 2021 15:21:45 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7C5574F2AE4; Tue, 26 Jan 2021 15:21:45 +0000 (UTC) (envelope-from tijl@freebsd.org) Received: from mailrelay119.isp.belgacom.be (mailrelay119.isp.belgacom.be [195.238.20.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "relay.skynet.be", Issuer "GlobalSign RSA OV SSL CA 2018" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQ9ST00tTz4XHg; Tue, 26 Jan 2021 15:21:44 +0000 (UTC) (envelope-from tijl@freebsd.org) IronPort-SDR: E1vT9LhIQ+fGMTFy+iQ7QEN4jOtG1h2/8qxL5rHcAwRsOEO5oCPkH8xs5vV65XgSHqf7OVMKL0 eLsSOj9LwbJqF72x7wbbb+XOtu5AisyqF53+dTRNsjp2HBnc6eAcrj2L/U9+5oK3rJLpM0/Om9 mbsd9ZRvqPbqhqggjDSlFuPoI0Lbq+3Fn8Yr1etcrCpg41XqNTktM1tY0sCqSjOGRuE/BbdVNe mpRSgicE5qUVlv7BvqRNJ2GrBeXWDHwSC9c91PhpM/H6u4/dCBkek/lAvoTm2mjVuYvkHkRIvs aHM= X-Belgacom-Dynamic: yes IronPort-PHdr: =?us-ascii?q?9a23=3AyKi7axJ2NDEDZWF3HNmcpTZWNBhigK39O0sv0r?= =?us-ascii?q?FitYgXKv7yrarrMEGX3/hxlliBBdydt6sVzbCL+PywESxYuNDd6S9EKMQNHz?= =?us-ascii?q?Y+yuwu1zQ6B8CEDUCpZNXLVAcdWPp4aVl+4nugOlJUEsutL3fbo3m18CJAUk?= =?us-ascii?q?6nbVk9Kev6AJPdgNqq3O6u5ZLTfx9IhD2gar9uMRm6twrcutQSjId4NKo8yh?= =?us-ascii?q?TFr3RLdu9LwW9kOU+fkwzz68ut/pNv6Thct+4k+8VdTaj0YqM0QKBCAj87KW?= =?us-ascii?q?41/srrtRfCTQuL+HQRV3gdnwRLDQbY8hz0R4/9vSTmuOVz3imaJtD2QqsvWT?= =?us-ascii?q?u+9adrSQTnhzkBOjUk7WzYkM1wjKZcoBK8uxxyxpPfbY+JOPZieK7WYMgXTn?= =?us-ascii?q?RdUMlPSyNBA5u8b4oRAOoHIeZYtJT2q18XoRejGQWgGObjxzlVjXH0wKI6yf?= =?us-ascii?q?wsHw/G0gI+AtwAs3bbrNv6O6gOXu6417XIwDfNYv9KxTvx9JbEfxY8qv+MR7?= =?us-ascii?q?Jwds/RxFExGQHAilWbtJLoPzSS1uQWrWeb6vBvVeS0i2U6rAxxvjmvxsUoio?= =?us-ascii?q?TShowV0E7L+jtkzYgoK9O0Ukl7YcSrEJZJsSyRKoR5TN84TW5ypCY61qMJuY?= =?us-ascii?q?S9fCUSzJkqxhrSZ+GFfoSV/x7uVeecLDRliX9rer+xiRm8/VS9xuPzSMS60F?= =?us-ascii?q?hHoCpYn9fDsn0A0xzd5tWDR/Zy/0qs2jCC3B3d5OFDJEA7j6vbK5g5z74/l5?= =?us-ascii?q?oTrUTDHjLtl0nskKCWcUAk9+614OrkerXrvpyRO5Juhg3gPakihNazDfk6Pw?= =?us-ascii?q?QQRWSW9uKx36D580LjWrVFlPg2n7HcsJDdOMsUuLa0AxRQ0oY/8xa/CCqm0M?= =?us-ascii?q?gAkXkHMl1FfBWHgpDqO17UJPD4DPK/jEq2kDds3fzGIrzhApfJLnTZjLjher?= =?us-ascii?q?F961VCxwo2199f4YlUBqsGIPLpVU/9rN3YDhknPAyo2+vqC8hx2pkAVW+AHK?= =?us-ascii?q?OVKr7evF2W6u41LOSAfIoVtyz8K/gh6f7ul3g5mVoFcKm13JsXanS4E+9oI0?= =?us-ascii?q?WDf3XjnMwOEXwXsQYkS+zqklKCXSZJZ3muR6I8+i07CIW+AIbMW4yhnaeM3C?= =?us-ascii?q?mhHpJIeG9JEUuMHmrye4WDQfcMZzqYItV9nTwcSbihV4gh2Amyuw/n0bpnNP?= =?us-ascii?q?Tb+isEtZ/42th1/fPcmg8p+jxvEsuRyWaNT3t7nmkQXT85wLh/oVBhyleEya?= =?us-ascii?q?V3nuZXFdpd5/xXSQo6O4TcwPJkBN/pQQLOY82FSFG8QtWpUnkNSYccxtoHZV?= =?us-ascii?q?twH52chxzEw2L+BrYTipSBBZAz76PY23nqO8s7wHHDgvoPlV4jF/eoMSWNga?= =?us-ascii?q?lk+g3aAZWBx1mYlaKCW74R0QT22CGE12XY7xIQaxJ5TaiQBSNXXUDRt9msox?= =?us-ascii?q?qaF7I=3D?= X-IronPort-Anti-Spam-Filtered: true X-IronPort-Anti-Spam-Result: =?us-ascii?q?A2ANAAD7MhBg/wSs8lFiGQEBAQEBAQE?= =?us-ascii?q?BAQEBAQEBAQEBARIBAQEBAQEBAQEBAQFAB4E3AQEBAQEBCwGDCxVXAWGNRIY?= =?us-ascii?q?9AYIWAziKZZEkCwEBAQEBAQEBAS4KBAEBhEoCgXkmNwYOAgMBAQEDAgUBAQY?= =?us-ascii?q?BAQEBAQEFBAGGGDkMgjgpAYMSAQU6PxALDgoWARdXBhODJ4MKC7IfgTSJUYE?= =?us-ascii?q?CBoE4AY07AkGCAIQqPoF6YwICF4IOAoUvBII3AUpHNiKBKYEnm3ecMoMBiTC?= =?us-ascii?q?MC4YlMYMrn02WJYkYmEyBe00wCIMkUBkNji0Xg06KWUADMAI1AgYKAQEDCYl?= =?us-ascii?q?RD4I1AQE?= X-IPAS-Result: =?us-ascii?q?A2ANAAD7MhBg/wSs8lFiGQEBAQEBAQEBAQEBAQEBAQEBA?= =?us-ascii?q?RIBAQEBAQEBAQEBAQFAB4E3AQEBAQEBCwGDCxVXAWGNRIY9AYIWAziKZZEkC?= =?us-ascii?q?wEBAQEBAQEBAS4KBAEBhEoCgXkmNwYOAgMBAQEDAgUBAQYBAQEBAQEFBAGGG?= =?us-ascii?q?DkMgjgpAYMSAQU6PxALDgoWARdXBhODJ4MKC7IfgTSJUYECBoE4AY07AkGCA?= =?us-ascii?q?IQqPoF6YwICF4IOAoUvBII3AUpHNiKBKYEnm3ecMoMBiTCMC4YlMYMrn02WJ?= =?us-ascii?q?YkYmEyBe00wCIMkUBkNji0Xg06KWUADMAI1AgYKAQEDCYlRD4I1AQE?= Received: from 4.172-242-81.adsl-dyn.isp.belgacom.be (HELO kalimero.tijl.coosemans.org) ([81.242.172.4]) by relay.skynet.be with ESMTP; 26 Jan 2021 16:21:42 +0100 Received: from localhost (localhost [127.0.0.1]) by kalimero.tijl.coosemans.org (8.16.1/8.16.1) with ESMTP id 10QFLeBf029481; Tue, 26 Jan 2021 16:21:40 +0100 (CET) (envelope-from tijl@FreeBSD.org) Date: Tue, 26 Jan 2021 16:21:38 +0100 From: =?UTF-8?B?VMSzbA==?= Coosemans To: Emmanuel Vadot Cc: Alexey Dokuchaev , Robert Huff , Niclas Zeising , current@freebsd.org, x11@freebsd.org Subject: Re: loading drm crashes system Message-ID: <20210126162138.25885562@FreeBSD.org> In-Reply-To: <20210126134245.e2aca7ed6061505ff4a3cedc@bidouilliste.com> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> <20210126134245.e2aca7ed6061505ff4a3cedc@bidouilliste.com> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQ9ST00tTz4XHg X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[freebsd]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 15:21:45 -0000 On Tue, 26 Jan 2021 13:42:45 +0100 Emmanuel Vadot wrote: > On Tue, 26 Jan 2021 07:02:11 +0000 > Alexey Dokuchaev wrote: >> On Mon, Jan 25, 2021 at 10:21:16PM -0500, Robert Huff wrote: >>> Niclas Zeising asks: >>>> When did it stop working? >>> >>> September ... I _think_. >> >> Yeah, that sounds about right. >> >> There are known issues with Radeon cards, they were quite well supported >> a year ago, then something got broken. I've promised to bisect this and >> find the cause, but there were several syscall-related changes in -CURRENT >> though the course of the last year, so bisecting just the kernel is not >> enough (machine won't get to login prompt if the userland does not match), >> which cripples the process. >> >> I still intend to take this quest, just not sure when. :( > > So back in November I applied a few commits from tijl@ related to > radeon and i386 (added to cc) : > https://github.com/freebsd/drm-kmod/commits/5.4-lts?author=tijl@coosemans.org > > For me this fixed radeon so that gives some timeline if someone with > non working hardware wants to bisect. > I know that bisecting drm-kmod is somewhat hard as you always need > matching kernel code when we update it to use some new functionality in > base linuxkpi but there is nothing that I can do about it. > It might work and be quicker to only bisect the kernel with a > stable/12 userland (no need to recompile) so I would start by testing a > kernel from early november and same date for drm-kmod. > > Tijl since you also reported a build failure a few days/weeks ago for > radeon can you report if your radeon card works ? (And which one it is). My card works (14.0-CURRENT from last Sunday) but it is an old radeon 9700 from 2004 so it doesn't have any fancy modern features and uses only a small part of the radeon driver. From owner-freebsd-current@freebsd.org Tue Jan 26 16:03:10 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 558B64F4446 for ; Tue, 26 Jan 2021 16:03:10 +0000 (UTC) (envelope-from tijl@freebsd.org) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQBNG1Qlgz4bgD for ; Tue, 26 Jan 2021 16:03:10 +0000 (UTC) (envelope-from tijl@freebsd.org) Received: by mailman.nyi.freebsd.org (Postfix) id 30E284F40D4; Tue, 26 Jan 2021 16:03:10 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3098A4F4194; Tue, 26 Jan 2021 16:03:10 +0000 (UTC) (envelope-from tijl@freebsd.org) Received: from mailrelay119.isp.belgacom.be (mailrelay119.isp.belgacom.be [195.238.20.146]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "relay.skynet.be", Issuer "GlobalSign RSA OV SSL CA 2018" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQBNF51yzz4bp3; Tue, 26 Jan 2021 16:03:09 +0000 (UTC) (envelope-from tijl@freebsd.org) IronPort-SDR: 5Xd0REeXFJSMQUD+xJlPfVgFOpLmDDUit92ix0ukpA+9Rx4CjSREzVT7jFXWL7YrqYEU9KkvX3 s39Pv3J4wL5kQAwJwod535LIgDsb+su38/0ffqFA0tdbK5rleXP4S/zfPA6nHPFl4AjyHDcK3n MSn5/+r1k762w56nAxp7BVVFqD6fjCnEeinA68Tpyb0wFa/YMTYcf2f3vJzMuRKF2ihDcWWpac V4pJQ/grjGpRr+xAYhbNui7T4wrNOvqW7H0qA2osYsaeiduVpMMyjyjpbYwf0jPZ2ZZL0gJMGY 66E= X-Belgacom-Dynamic: yes IronPort-PHdr: =?us-ascii?q?9a23=3AtFZL+hJCFp6+1x3vVtmcpTZWNBhigK39O0sv0r?= =?us-ascii?q?FitYgfLfnxwZ3uMQTl6Ol3ixeRBMOHsqMC0bSd6fioGTRZp8rY7zZaKN0Efi?= =?us-ascii?q?RGoP1epxYnDs+BBB+zB9/RRAt+Iv5/UkR49WqwK0lfFZW2TVTTpnqv8WxaQU?= =?us-ascii?q?2nZkJ6KevvB4Hdkdm82fys9J3PeQVIgye2ba9vIBmsogjdq80bjZF8JqswxR?= =?us-ascii?q?fFvGdEcPlSyW90OF6fhRnx6tqy8ZJ57yhcp/ct/NNcXKvneKg1UaZWByk8PW?= =?us-ascii?q?Av483ruxjDTQ+R6XYZT24bjBlGDRXb4R/jRpv+vTf0ueR72CmBIM35Vqs0Vi?= =?us-ascii?q?i476dqUxDnliEKPCMk/W7Ni8xwiKVboA+9pxF63oXZbp2ZOOZ4c6jAZt4RW3?= =?us-ascii?q?ZPUdhNWCxAGoO8bpUAD+wdPeZDsoLxo0ICoQaiCQWwAe/izCJDiH3r0q0gy+?= =?us-ascii?q?kvHwHI0hI9EdwNsnvUotr6O7sdX+2u0KnFzy/OY+9K1Tvh9oTFdA0qr/GWXb?= =?us-ascii?q?J3dMrc0VchFQbBjl6Nt4HlODSV1v8TvGie9eVgU/mvgHMgpgFtozivxMMsh5?= =?us-ascii?q?LJiIIP1F/L6zh0zps7K9GiT057e9GkHYJWuiqHOIR4XtksTHt0uCYm1LIGo5?= =?us-ascii?q?i7cTAUxZkj2hPSZfiKfpSL7x/tSOudPyl1iXF4db6hgxu/9Umtx/DhW8Sq3l?= =?us-ascii?q?hHoSRIn93DuH0QyxDd5cmKR+Z880mv3zuEyg7d6uZBIU8ulKrbLYYswrAqlp?= =?us-ascii?q?UNr0vMBTT2l1jsgK+RbEUk9e6l4PnkbLX+vpKRNJJ4hhvgPqkhhMCzG/k0Pw?= =?us-ascii?q?oQU2SB9umx0qDo81fjT7VQlPI2l7HUsJXdJcsGuKG0GxRV0oM/6xanCDemzc?= =?us-ascii?q?gYkWEHLF1bfBKHiJDkO1LUL/D8DPe/hkqjkC1sx/zcIr3hA5fNLnzZnLj9er?= =?us-ascii?q?Z97FVcxxQ2zd9F4ZJUEasNIPXpWk/+rNDYDxk5PBKow+v/C9hxy5kSVXyAD6?= =?us-ascii?q?OHKq/erF2F6vw1L+SDfIMVvSzyK/kh5/7gl385nlodcLG13ZsWanC4Gu9rI0?= =?us-ascii?q?uDYXXynNgOCnwKsRckQOztkl2CXiZfZ2yuUKIk+jE7FIWmAJ/MR4ywnbCMxy?= =?us-ascii?q?m7HodIaW9YEV+MCmrne5+DW/cWZyKYOtVhnSAcVbi9V48h0gmjuxPny7p9NO?= =?us-ascii?q?rb5CsYtY742dh7/e3ciw89+idvD8uAyW2NSHt0nmxbDwMxiZp4q0Fn1h+jzK?= =?us-ascii?q?Z2y6hCEtZe/e9JTwk0HYTXyapxDNWkCSzbedLcdLGiCv6hBio8S9s32Jdaf0?= =?us-ascii?q?d/H/2MlB3O9RGGRbgPmOrYV9QP7qvA0i2pdI5GwHHc2fxk1gF+Tw=3D=3D?= X-IronPort-Anti-Spam-Filtered: true X-IronPort-Anti-Spam-Result: =?us-ascii?q?A2BPAABBPBBg/wSs8lFiGgEBAQEBAQE?= =?us-ascii?q?BAQEDAQEBARIBAQEBAgIBAQEBQAeBSIMMFVcBYY1Ehj0Bghk4imWRJAsBAQE?= =?us-ascii?q?BAQEBAQEuCgQBAYRKAoF5JjgTAgMBAQEDAgUBAQYBAQEBAQEFBAGGGDkMgjg?= =?us-ascii?q?pAYMSAQU6PxALGC5XBhODJ4MKC7IcgTSFWYN4gQIGgTiNPAJBggCEKj6Beog?= =?us-ascii?q?9BIMCdQiBe3ebd5wygwGJMJIwMaJ4nz2YTYF6TTAIgyRQGQ2OLReIYoVFQAM?= =?us-ascii?q?wNwIGCgEBAwmMFQEB?= X-IPAS-Result: =?us-ascii?q?A2BPAABBPBBg/wSs8lFiGgEBAQEBAQEBAQEDAQEBARIBA?= =?us-ascii?q?QEBAgIBAQEBQAeBSIMMFVcBYY1Ehj0Bghk4imWRJAsBAQEBAQEBAQEuCgQBA?= =?us-ascii?q?YRKAoF5JjgTAgMBAQEDAgUBAQYBAQEBAQEFBAGGGDkMgjgpAYMSAQU6PxALG?= =?us-ascii?q?C5XBhODJ4MKC7IcgTSFWYN4gQIGgTiNPAJBggCEKj6Beog9BIMCdQiBe3ebd?= =?us-ascii?q?5wygwGJMJIwMaJ4nz2YTYF6TTAIgyRQGQ2OLReIYoVFQAMwNwIGCgEBAwmMF?= =?us-ascii?q?QEB?= Received: from 4.172-242-81.adsl-dyn.isp.belgacom.be (HELO kalimero.tijl.coosemans.org) ([81.242.172.4]) by relay.skynet.be with ESMTP; 26 Jan 2021 17:03:08 +0100 Received: from localhost (localhost [127.0.0.1]) by kalimero.tijl.coosemans.org (8.16.1/8.16.1) with ESMTP id 10QG37gC029572; Tue, 26 Jan 2021 17:03:07 +0100 (CET) (envelope-from tijl@FreeBSD.org) Date: Tue, 26 Jan 2021 17:03:07 +0100 From: =?UTF-8?B?VMSzbA==?= Coosemans To: Robert Huff Cc: Niclas Zeising , current@freebsd.org, x11@freebsd.org Subject: Re: loading drm crashes system Message-ID: <20210126170307.28c0f82f@FreeBSD.org> In-Reply-To: <24591.35500.33066.12845@jerusalem.litteratus.org> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQBNF51yzz4bp3 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[freebsd]; REPLY(-4.00)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 16:03:10 -0000 On Mon, 25 Jan 2021 22:21:16 -0500 Robert Huff wrote: > Niclas Zeising asks: > > > Which version of drm-current-kmod? > > 5.4.62.g20210118 > > > Can you try to remove it and build it directly from an updated ports > > tree, without using PORTS_MODULES=, and see if that helps? > > It does not. > > > > The GPU is a Radeon HD 3300, and at one point this used to work. > > > > When did it stop working? > > September ... I _think_. > After the switch from sc to vt+drm, things worked for a while > ... then they didn't for several months ... then - September??? - they > worked for about two weeks ... then they didn't again. September 10 is when drm-current-kmod was updated from 4.16 to 5.4: https://svnweb.freebsd.org/ports/head/graphics/drm-current-kmod/Makefile There haven't been that many updates since then so you could test ports r548210 with base system from the same date. If that works try r548601, r551266 and r554720. From owner-freebsd-current@freebsd.org Tue Jan 26 19:02:13 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C4BBB4FC76A for ; Tue, 26 Jan 2021 19:02:13 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQGLs4kJgz3nkx for ; Tue, 26 Jan 2021 19:02:13 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id A22B44FC8A7; Tue, 26 Jan 2021 19:02:13 +0000 (UTC) Delivered-To: current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A1F234FC57E for ; Tue, 26 Jan 2021 19:02:13 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQGLs38Tqz3p6W for ; Tue, 26 Jan 2021 19:02:13 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1611687730; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=JYKKTp/NMguNrYTG+w9wXqDa2I0=; b=SpNJajhDi9QHTdYTSS0jVfKwv6JltWOTJQHgSNVG+5ORkjcf3DfhRGjseaM7Itmd HjEXVv2nCFAx7Q6TsWHmLAXwxWxvPNuaNn0S3QmQ9fKdtNS5RcZISymHq78qcYRg XCnWcAMaO+Mlp8KWw/ZB5SRXAEsNs/fZN87GFsgTRYf4/RRxwBHsMJtvlBo7OqCn UWIbgjHRkpfbnLA1PB7FC5HMuESL3UYdNNtPbXhxVDp9PUluzzegVr71e4aj9y0A ZQleQ/oVf/C53biB+XQdutFcJ1LaIHc27f83iFqqgHRy6prO39FB1ULtJbps+tPA y0UCqRRN8pEYN/mK1oPV3w==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.3 cv=d5KLNirE c=1 sm=1 tr=0 cx=a_idp_x a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=EmqxpYm9HcoA:10 a=48faUk6PgeAA:10 a=3W6zGAXYFKMF0R4Txp8A:9 a=CjuIK1q_8ugA:10 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:63461] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id 0E/EC-41496-23760106; Tue, 26 Jan 2021 14:02:10 -0500 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24592.26418.49794.487207@jerusalem.litteratus.org> Date: Tue, 26 Jan 2021 14:02:10 -0500 From: Robert Huff To: current@freebsd.org, x11@freebsd.org Subject: Re: loading drm crashes system In-Reply-To: <24592.23847.97129.874848@jerusalem.litteratus.org> References: <24590.137.690675.515036@jerusalem.litteratus.org> <68acb1a8-fcf8-a065-70d5-061669e2f70b@daemonic.se> <24591.35500.33066.12845@jerusalem.litteratus.org> <20210126070211.GB43439@FreeBSD.org> <24592.4752.944930.118483@jerusalem.litteratus.org> <24592.23847.97129.874848@jerusalem.litteratus.org> X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verditct: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledrvdeigdehkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfujgfpteevqfftnfgvrghrnhhinhhgpdftvefppdfqfgfvnecuuegrihhlohhuthemuceftddunecunecujfgurhepgggtgffkfffhvffujghfofesthejredtredtvdenucfhrhhomheptfhosggvrhhtucfjuhhffhcuoehrohgsvghrthhhuhhffhesrhgtnhdrtghomheqnecuggftrfgrthhtvghrnheptddtleektefhgeeggfevleeugedvleduheeuuedvgeejiedvffeiffeftefhgfeunecukfhppedvtdelrdeirddvfedtrdegkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdeirddvfedtrdegkeenpdhmrghilhhfrhhomheprhhosggvrhhthhhufhhfsehrtghnrdgtohhmnedprhgtphhtthhopegtuhhrrhgvnhhtsehfrhgvvggsshgurdhorhhgne X-Rspamd-Queue-Id: 4DQGLs38Tqz3p6W X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=SpNJajhD; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-5.05 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24:c]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[rcn.com:dkim]; RWL_MAILSPIKE_POSSIBLE(0.00)[69.168.97.78:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; SPAMHAUS_ZRD(0.00)[69.168.97.78:from:127.0.2.255]; DKIM_TRACE(0.00)[rcn.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; NEURAL_HAM_SHORT(-0.95)[-0.948]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[69.168.97.78:from]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[current]; RCVD_IN_DNSWL_LOW(-0.10)[69.168.97.78:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 19:02:13 -0000 Me: > Try September 26 as a reference date. s/September 26/September 6/ ; src = r365372 Respectfully, Robert "Gotcha, ya little bugger!" Huff From owner-freebsd-current@freebsd.org Tue Jan 26 19:58:28 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 873D64FE829 for ; Tue, 26 Jan 2021 19:58:28 +0000 (UTC) (envelope-from mckusick@mckusick.com) Received: from chez.mckusick.com (chez.mckusick.com [70.36.157.235]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQHbl3F4Nz3tTG for ; Tue, 26 Jan 2021 19:58:27 +0000 (UTC) (envelope-from mckusick@mckusick.com) Received: from chez.mckusick.com (localhost [IPv6:::1]) by chez.mckusick.com (8.15.2/8.15.2) with ESMTP id 10QK1dhq088562; Tue, 26 Jan 2021 12:01:39 -0800 (PST) (envelope-from mckusick@mckusick.com) Message-Id: <202101262001.10QK1dhq088562@chez.mckusick.com> From: Kirk McKusick To: Rozhuk Ivan Subject: Re: fsck strange output cc: freebsd-current@freebsd.org X-URL: http://WWW.McKusick.COM/ Reply-To: Kirk McKusick In-reply-to: <20210126170841.7efc58c4@rimwks.local> Comments: In-reply-to Rozhuk Ivan message dated "Tue, 26 Jan 2021 17:08:41 +0300." MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <88560.1611691299.1@chez.mckusick.com> Content-Transfer-Encoding: quoted-printable Date: Tue, 26 Jan 2021 12:01:39 -0800 X-Spam-Status: No, score=-1.4 required=5.0 tests=BAYES_00,MISSING_MID, UNPARSEABLE_RELAY autolearn=no autolearn_force=no version=3.4.1 X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on chez.mckusick.com X-Rspamd-Queue-Id: 4DQHbl3F4Nz3tTG X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of mckusick@mckusick.com has no SPF policy when checking 70.36.157.235) smtp.mailfrom=mckusick@mckusick.com X-Spamd-Result: default: False [-2.10 / 15.00]; HAS_REPLYTO(0.00)[mckusick@mckusick.com]; TO_DN_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[70.36.157.235:from]; ASN(0.00)[asn:46375, ipnet:70.36.128.0/19, country:US]; R_DKIM_NA(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; FREEFALL_USER(0.00)[mckusick]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[mckusick.com]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[70.36.157.235:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 26 Jan 2021 19:58:28 -0000 > From: Rozhuk Ivan > Date: Tue, 26 Jan 2021 17:08:41 +0300 > To: Kirk McKusick > Cc: freebsd-current@freebsd.org > Subject: Re: fsck strange output > = > On Mon, 25 Jan 2021 15:40:12 -0800 > Kirk McKusick wrote: > = > = >> Please try this patch to fsck_ffs and see if it fixes your problem. >> = >> Kirk McKusick >> = >> =3D-=3D-=3D >> = >> *** sbin/fsck_ffs/inode.c.orig 2021-01-07 15:04:04.969086284 >> -0800 --- sbin/fsck_ffs/inode.c 2021-01-25 15:29:06.404803358 >> -0800 *************** >> *** 611,618 **** >> sizeof(struct ufs1_dinode) : sizeof(struct >> ufs2_dinode)); readpercg =3D inosused / fullcnt; >> partialcnt =3D inosused % fullcnt; >> ! partialsize =3D partialcnt * ((sblock.fs_magic =3D=3D >> FS_UFS1_MAGIC) ? ! sizeof(struct ufs1_dinode) : >> sizeof(struct ufs2_dinode)); if (partialcnt !=3D 0) { >> readpercg++; >> } else { >> --- 611,619 ---- >> sizeof(struct ufs1_dinode) : sizeof(struct >> ufs2_dinode)); readpercg =3D inosused / fullcnt; >> partialcnt =3D inosused % fullcnt; >> ! partialsize =3D fragroundup(&sblock, >> ! partialcnt * ((sblock.fs_magic =3D=3D FS_UFS1_MAGIC) ? >> ! sizeof(struct ufs1_dinode) : sizeof(struct >> ufs2_dinode))); if (partialcnt !=3D 0) { >> readpercg++; >> } else { > = > = > https://github.com/rozhuk-im/freebsd/commit/5e8bfa01830e2b6ecb88e572064c= 6fffe5a2df2d > (if I apply correct :) ) > = > With this patch - seems no errors, thanks! Thanks for your testing. It has also corrected the same problem in Peter Holm's test suite. So, I am committed it as 8c22cf9. I will also ensure that it gets MFC'ed into 13.0. Kirk McKusick From owner-freebsd-current@freebsd.org Wed Jan 27 00:00:16 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id CE3C14E4CE3 for ; Wed, 27 Jan 2021 00:00:16 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic311-25.consmr.mail.gq1.yahoo.com (sonic311-25.consmr.mail.gq1.yahoo.com [98.137.65.206]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQNyl5HCMz4fRn for ; Wed, 27 Jan 2021 00:00:15 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611705613; bh=cV+HUTwUN2qGJw7S+LbyWkMkhPxHXu6LyDdabAjbD0A=; h=From:Subject:Date:To:From:Subject:Reply-To; b=kl95TQIm8U+gh77zNdaK59ia+UtyXvCs6DenNMSOtZY+CRk9CRuZprc23JABj7/yKJDzixUua16/DdHmqAhiEIaxNe8FP9oEtHWKz9+PN6tRjYfrf7Iv7eN8OxlzxwYFbWHRfKgttJeQ1oUy+6fDTb/t26CNgfx03euHGkF0oZEgxyi6yGcBMdoowFsqoGnGLzT1BYwqiLn0wyyIG80S7aSMGODAEs2+8DNEaN/Cs9VckQ0/izdYbDXIeFWF6JuoiP7a8qHOGSfZlVxkyk4Demrx2XXmTQ2ZJnqIZm/FXoXs1kXOinW2DZWcMX1Z7IEMpvsxkRCI6rbEaEo3se0Qxw== X-YMail-OSG: WQmz9kcVM1nHCCkH.udMJaX2an6322QJpCMcoZ5JP4KV4L5FfWKV2x.Oo5OHf56 4Z1B5BDjDHcFCoN2dBtVyt35ZcqilCXlSZPMvxLYMl9Uh1bcP6rmviGiNRbVL2d_lGG6.ludET7g 0WXVhrpnnuMaiThEfCycWwIrhT2_KZSl7ofzHinWgOnBAHhM.GXFOq8qxw8rWbrZik9I0d3XtC4K npdXWP3I5Dy9aP6JymZkrqZJwy3aLZUi6VD5GcS9.qA8g71.UtOLaK40BBo65jD2i9WtX.OOiUmi oujR1AuXJKP8kz1CQtZtIWzUEs0RZm8S2JLdPNJsp8VstQqD8doZWpooT2AVs8AWTLrcCPQqrNur L2HecG0RBmEW.zGxsxMZl2pqDdlid76lzDGC8H5dS.j3hMugaMObFxH2rcbsS3qqhKMokF1cuGI3 J2b4qHHVSSmJ4oVrzWzWx4phLDLrfIXznspgI5wYpCbDr0A51PUvfGPY82byqi2YXJ7ltmp2sysh ZRVpmH48EdM7_Nk4vjmG6X6YdytxSjxgNsY5_XS0tDjrODTncFz_b6xAwLoVTx2mGipSv4icg6l9 .551jP_DCDyIq2OyWS_KeP6IXxr6dhar1m5PRWGACJE8UsZY_0ddR4LaOwFtECWexQkd4.cFUo0B 0_j3UZvTJQtDof.KOtd._mP.1Yf1w6B0oISvotbuKTOPBo81qBjFOsV40GrY237A0nKsQcWipuV9 yGoZcW09BlyCVFa_k1Mim3uvJTDMYvtpSFjdjd2TyYKhAgaZ12l_5aTiM3ZUwrMzEUmMqOX4_GCP uEnnLBgJLo6JgU1bHlPOpofxztFx.yGUwulLxvfzdwHvMYZC6N_oVpheXBHWU7rL0pVOoynD1fdd OkqW22Ra_LLENY4wHe6zRMH8XFJK3T3bf066Bk6bJ4LLQ2LatVeVDH3Y8GsDk7IWLwGeu1Q0pkwK y6kzbOSMYs0kf1aEQhfKFfTiCcva.d4YMoJUAgOkAiO7sqIx.jWgM1cWPp0ps.7ooTFP3WFNpPS3 ZQhttb5azmBTA3HTgo59yHBMrtYX4781DBK43oM0C9FnMLw9y.Du2Scpqf87cdbYYBmGaRpNk_kd KXX4G4C1ESo_swSHfbsQoHHeeWlgtt6Xc6UShZ8XCXl99WFnd_PYnGYsTPrnh0Gh5S7LmjvWyDfe VhYMKAqWryCJNWOA7i6XuMa5MmX4Oj2JN8G1sL82ZBU4GpwF1grMIkv0VFj4bPek3xTqE7OnF4Nx Eo.bCep2gj1s8lOAF4rwPx2U4eMtaokl_LmCx8Vvm3UtIzokNLL4XoyGdcEWvVErNbGFL_g_2pL3 WzWv.cPEVyW_OeJjXWj5qT2Yw69tzLdDwE6hAyrXwvFsBAt06Q65OWB60RyWkIuNbwBhOs7HknCc mKmFXRiKpkCaI5Myh55OCtTsVXW80AWlO5cnNFOk7J3Ct8.sZkJav0dxg_2.9I4vY2zVHyBeoGqa zTCSMsykGiQ3JdRzGAEHgHzqrRlhtn.2SBNUP1nqN5sMXHbpLyuXMc9YggPgp7aMFLgbUfuM9epq BB3viHY2KdDA0V56BVss13GlskiMNaJpqHLEBqtrkkKM1gNxMn.vjRaoHzkaHkXk_H8seKZKUD.H MNLkHVxnLQuTBd9.ePlUxyVNHVeOTFXle0bEwpTeaB7fotYoEasvjwvIxZ_gKyQ5aW3dCBZyRUCX rQr1JlVcJb_8Q.oLjaqYPuXNKu1hYwBFd_Sls6cfA0wavcO5v0qeo2YW.mUTNRplRZTxGG83Bmdo tYsUORFpcd868.hy.jmNSknI7xHlFuLDYpxbBrorb.DbQ0phi9v.fFLCusVLx_N6ZmWO4K4b8CBT NiW0TBr.r7KsVGnRa1Vdf4n7K3mqJ.hS7h0DjjDFrPjOiubLy74QTFqe.uEMH.u7IAvtz0mSF2Rw .bI.B0oPs0FVJxZFwPdBdZmGGRJpriAjAPs9vvt967poCfSORXiQ1d8GEeRwRKPDDMpMB4wQsZ80 hylST90aLSiskN3T3KmrLjcCd0qKFcNiXGuscUWSOprTp0XvLnFskbuoHet4W3Y9U5eWCQmbPijb tpntdWaCNBUXZk.ScUk4DPS.r5miov_bAAapMyHxdbgaO4aeOKNShyVO0_anycbs_A3TWOGKncqB 6MBDHVlMvtGE2gXs2M4Uhtoh5Cu6LVtHKbndZYBkHZgdzJp1UZT6Ra6EmoNtLFMO9GJavlkrIcXB LxsLo_B0RWtxpLvMlxTllK.ogXaMBIv9jbK4z5yzoHL69YSM9dfuG2_WPd7oc.FnkMN15rudZvaK oZN35zemPWS9wT1qCnlHZgJm2AC4VwzYQqycnGk3Uer85nguaTUYB45qbJRxDRvpIIEHkxf4OEmQ 9eNqsGoPNx1jGTynE.1tdNk6JjelIsRuf5oorUxSpN0MGJ4aRvkD4O7S9Lz83IvWEeFRuGjXjT4J BkwILdl6t9U3xaT5xMFu.v4PT_YLwEGHH3iIT8H1KksHSbitpzL8_qcCtKxxJ2zlgBBB5QorO Received: from sonic.gate.mail.ne1.yahoo.com by sonic311.consmr.mail.gq1.yahoo.com with HTTP; Wed, 27 Jan 2021 00:00:13 +0000 Received: by smtp424.mail.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 90b742bef35f4a48d5177cf92a0c99d6; Wed, 27 Jan 2021 00:00:08 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: FYI: Why META_MODE rebuilds so much for building again after installworld (no source changes) Date: Tue, 26 Jan 2021 16:00:05 -0800 References: <3345EBA5-A09C-4E3F-B94D-39F57F56BDBB@yahoo.com> To: Bryan Drewery , Current FreeBSD In-Reply-To: <3345EBA5-A09C-4E3F-B94D-39F57F56BDBB@yahoo.com> Message-Id: X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Rspamd-Queue-Id: 4DQNyl5HCMz4fRn X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.65.206:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.65.206:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.65.206:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.65.206:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 00:00:16 -0000 On 2021-Jan-23, at 21:37, Mark Millard wrote: > On 2021-Jan-22, at 01:45, Mark Millard wrote: >=20 >> Given an already built, installed and booted system version, I've >> noted a big difference for META_MODE in 2 rebuild contexts (no >> source updates involved): >>=20 >> *) Prior buildworld buildkernel, installkernel, installworld, boot >> presumed before (A) and before (B) below. >>=20 >> A) make . . . buildworld buildkernel >> make . . . buildworld buildkernel >> (the 2nd buildworld buildkernel in (A) builds far less than the = first) >> (that means that the first built more than I would have guessed) >>=20 >> vs. >>=20 >> B) make . . . buildworld buildkernel >> make . . . installworld >> make . . . buildworld buildkernel >> (the 2nd buildworld buildkernel in (B) builds far more than it did = in (A)) >> (so, more like the 1st buildworld buildkernel in (A) and (B), given >> the specified prior context) >>=20 >> So I used make -dM for the commented buildworld buildkernel lines, = logging >> the build output and later diff'ing them. >>=20 >> Result that I noticed? Lots of lines uniquely from (B)'s case, ending = with >> one of: >>=20 >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/awk' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/cap_mkdb' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/cat' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/cp' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/crunchgen' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/crunchide' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/dd' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/egrep' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/env' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/file2c' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/gencat' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/grep' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/gzip' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/jot' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/lex' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/ln' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/m4' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/mv' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/patch' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/rm' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/sed' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/sh' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/touch' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/truncate' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/uudecode' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/uuencode' is newer than the target... >> file = '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/u= sr/sbin/xargs' is newer than the target... >>=20 >> The lines with these lead to more files being updated and so causing = more >> indirect rebuild activity (that cascades). >>=20 >> Many/most/all(?) of these seem to me to be unlikely to actually need = to >> contribute to what needs to be rebuilt (just based on being newer). = So >> the option to ignore (some of?) them could be useful in making = META_MODE >> builds quicker. >=20 > The following from one of the .meta files makes the point that rm use > in the example is unlikely to be important to needing to rebuild, > despite it actually causing a file rebuild. Nor is the specific echo > command listed relevant. Only the "ar" command is: >=20 > # Meta data file = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/lib/libc++/li= bc++.a.meta > CMD @echo building static c++ library > CMD @rm -f libc++.a > CMD ar -crsD libc++.a algorithm.o any.o atomic.o barrier.o bind.o = charconv.o chrono.o condition_variable.o condition_variable_destructor.o = debug.o exception.o filesystem/directory_iterator.o filesyste > m/int128_builtins.o filesystem/operations.o functional.o future.o = hash.o ios.o iostream.o locale.o memory.o mutex.o mutex_destructor.o = new.o optional.o random.o random_shuffle.o regex.o shared_mutex.o > stdexcept.o string.o strstream.o system_error.o thread.o typeinfo.o = utility.o valarray.o variant.o vector.o cxxrt_auxhelper.o = cxxrt_dynamic_cast.o cxxrt_exception.o cxxrt_guard.o = cxxrt_libelftc_dem_g > nu3.o cxxrt_memory.o cxxrt_stdexcept.o cxxrt_terminate.o = cxxrt_typeinfo.o > CWD = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/lib/libc++ > TARGET libc++.a > -- command output -- > building static c++ library >=20 > -- filemon acquired metadata -- > # filemon version 5 > # Target pid 22471 > # Start 1611359217.214996 > V 5 > E 22961 /bin/sh > R 22961 /etc/libmap.conf > R 22961 /var/run/ld-elf.so.hints > R 22961 /lib/libedit.so.7 > R 22961 /lib/libc.so.7 > R 22961 /lib/libncursesw.so.9 > R 22961 /usr/share/locale/C.UTF-8/LC_CTYPE > F 22961 22962 > E 22962 = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/us= r/sbin/rm > R 22962 /etc/libmap.conf > R 22962 /var/run/ld-elf.so.hints > R 22962 /lib/libc.so.7 > R 22962 /usr/share/locale/C.UTF-8/LC_CTYPE > D 22962 libc++.a > X 22962 0 0 > . . . >=20 > The timestamp on . . ./tmp/legacy/usr/sbin/rm is not > actually relevant to if libc++.a needs to be rebuilt. >=20 > Of course, the structure also point out the judgment > is specific to understanding the sequence of CMD's > listed above. Only a hack of ignoring, not recording, > or commenting out the filemon lines ending in > /tmp/legacy/usr/sbin/rm would seem to avoid the @rm > handling issue. Such might well have its own risks. >=20 > Some other /tmp/legacy/usr/sbin/* filemon line endings > likely would have a similar status of being a reference > to a file that could(/should?) have its timestamp > relationship not checked. Just for reference for more about the sequencing involved: Looks like in my example various . . ./tmp/legacy/. . ./*bin/ actually are links to files in: = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/bi= n/ and the later after-install buildworld "Rebuilding the temporary build tree" step leads to the updated dates for files in that area, updated via the code that reports: Linking host tools into = /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/bi= n So the prior installworld leaves updated dates and the linking to those installed files makes . . ./tmp/legacy/. . ./*bin/* have the newer dates show up for the legacy paths as well. In turn the dependency tracking via META_MODE uses the new dates on . . ./tmp/legacy/. . ./*bin/* files to cause rebuilds of more materials than if installworld had not been done. It is not obvious if Bryan D. would find the effort to avoid this worthwhile for the contexts that drive FreeBSD's build environment choices. =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Wed Jan 27 00:40:36 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7E55C4E7B1A for ; Wed, 27 Jan 2021 00:40:36 +0000 (UTC) (envelope-from kiri@truefc.org) Received: from kx.truefc.org (1.212.52.36.ap.yournet.ne.jp [36.52.212.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp", Issuer "smtp" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQPsH1xyZz4jQ3 for ; Wed, 27 Jan 2021 00:40:34 +0000 (UTC) (envelope-from kiri@truefc.org) Received: from kx.truefc.org (kx.truefc.org [36.52.212.1]) by kx.truefc.org (8.16.1/8.16.1) with ESMTP id 10R0eO0D071142; Wed, 27 Jan 2021 09:40:24 +0900 (JST) (envelope-from kiri@kx.truefc.org) Message-Id: <202101270040.10R0eO0D071142@kx.truefc.org> Date: Wed, 27 Jan 2021 09:40:24 +0900 From: KIRIYAMA Kazuhiko To: freebsd-current@freebsd.org Cc: kiri@truefc.org Subject: Can't fetch https://www.freebsd.org/releng/index.html User-Agent: Wanderlust/2.15.9 (Almost Unreal) SEMI/1.14.6 (Maruoka) FLIM/1.14.9 (=?ISO-8859-4?Q?Goj=F2?=) APEL/10.8 MULE XEmacs/21.4 (patch 24) (Standard C) (amd64--freebsd) MIME-Version: 1.0 (generated by SEMI 1.14.6 - "Maruoka") Content-Type: text/plain; charset=US-ASCII X-Rspamd-Queue-Id: 4DQPsH1xyZz4jQ3 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of kiri@truefc.org has no SPF policy when checking 36.52.212.1) smtp.mailfrom=kiri@truefc.org X-Spamd-Result: default: False [-0.90 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[36.52.212.1:from]; URL_IN_SUBJECT(1.00)[www.freebsd.org]; FREEFALL_USER(0.00)[kiri]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[truefc.org]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[36.52.212.1:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; RCVD_COUNT_ONE(0.00)[1]; R_SPF_NA(0.00)[no SPF record]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:10013, ipnet:36.52.208.0/21, country:JP]; MAILMAN_DEST(0.00)[freebsd-current]; ONCE_RECEIVED(0.10)[] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 00:40:36 -0000 Hi all, I've been used https://www.freebsd.org/releng/index.html to know about latest FreeBSD updateing status for my many applications. I found that index.html can't fetch yesterday. Is there anyone to tell me how to get latest FreeBSD updateing status information with source file ? --- Kazuhiko Kiriyama From owner-freebsd-current@freebsd.org Wed Jan 27 00:55:48 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 60F754E828D for ; Wed, 27 Jan 2021 00:55:48 +0000 (UTC) (envelope-from lev@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQQBr2Hkgz4kgn; Wed, 27 Jan 2021 00:55:48 +0000 (UTC) (envelope-from lev@FreeBSD.org) Received: from onlyone.not-for.work (onlyone.not-for.work [148.251.9.81]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) (Authenticated sender: lev/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 27ADBF7CC; Wed, 27 Jan 2021 00:55:48 +0000 (UTC) (envelope-from lev@FreeBSD.org) Received: from [IPv6:2001:470:923f:1:cc6e:9abe:2d72:ad45] (unknown [IPv6:2001:470:923f:1:cc6e:9abe:2d72:ad45]) (Authenticated sender: lev@serebryakov.spb.ru) by onlyone.not-for.work (Postfix) with ESMTPSA id EA636A0BD; Wed, 27 Jan 2021 03:55:45 +0300 (MSK) Reply-To: lev@FreeBSD.org Subject: Re: Can't fetch https://www.freebsd.org/releng/index.html To: KIRIYAMA Kazuhiko , freebsd-current@freebsd.org References: <202101270040.10R0eO0D071142@kx.truefc.org> From: Lev Serebryakov Organization: FreeBSD Message-ID: <410e79bd-06ed-a698-ed7a-9c780b8dfd7a@FreeBSD.org> Date: Wed, 27 Jan 2021 03:55:45 +0300 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <202101270040.10R0eO0D071142@kx.truefc.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 00:55:48 -0000 On 27.01.2021 3:40, KIRIYAMA Kazuhiko wrote: > I've been used https://www.freebsd.org/releng/index.html to know about > latest FreeBSD updateing status for my many applications. I found that > index.html can't fetch yesterday. > > Is there anyone to tell me how to get latest FreeBSD updateing status > information with source file ? https://www.freebsd.org/releng/ ? But I'm disappointed, that new page doesn't conttain dates of all old releases in one neat table. I've used this table a lot :) -- // Lev Serebryakov From owner-freebsd-current@freebsd.org Wed Jan 27 07:55:20 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2AA984F02A5 for ; Wed, 27 Jan 2021 07:55:20 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic306-19.consmr.mail.gq1.yahoo.com (sonic306-19.consmr.mail.gq1.yahoo.com [98.137.68.82]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQbVv1jdYz3MFj for ; Wed, 27 Jan 2021 07:55:18 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1611734116; bh=bTuqHkWwa6U4GdUjXWqrnHxRDHXmLTV6IbpDCLLTBTX=; h=From:Subject:Date:To:From:Subject:Reply-To; b=rIq6eV1SUNkPLBad5RZSM3Hs3mRRLEcC5z9iGjLDRuXW6wlqQ7mEMaDFZJa0yN16ZkfGrzbb3vlgt3DpYoZVlMYrvzZX25I9lVJpqEC6fW6KXdsjhz2oXGhWVq+JsLjah3Fc9C0xM93bxI5PZmwflWObjm28RzNrfaNlCcXPV0RgXxgGeXoXJVN0DiBvVui3FMvgUHt01cHbmKKKxzqhZwnWWFMyJfCOgrxj8DjwmnLWE6BM0UVUGR2/17y9oR25qdsBJ9dbyBL23s7nUBowCFTJdX906VnY5Bml04s3jEzhxvn0pY7wY0Usod2PN9v3+5fOrTtXpPOwh3mNK1Y0GQ== X-YMail-OSG: .zyMY8MVM1mx4QMii9B9jxsrrRUdoEbaH4tzzIjITqCDTDtu021IePIu9u3k6dc UwiKzVvt0LoWpNSAxl._2ey1xqRCiiItFZNEHNyddStJsdK1eWTpD_Tkui5t_alFBpjZZGt3OGdk 2C1372kcNKU06Zs4ddlpJvKMsoIrrkK8FIIiP1JAc_vcS6svHpoSQAtlIseq2KlrzV8g8NTXHfr7 REPVpg4yA9evYFO6r0SiaUafEuCo8nQeZCUeiOlCgZkZQ2vt3brwPU11OIvdZbXgjYlskQ1h0FOm ZzMkdXQetDNbPYkobAmolNU4cTN1LSgVa8xPx_teUEt6ChA90prCZLWFVdXJP_.AcQ0W6Oc7snPH RYylUX8DnwzjywHBPjdHWg2O6XO2E9gtXMRhepCf616FqGccYFln8OL0BM.kt8z49yzRJCQunEEo OAT7CEEpD9Vo4NPHhvisrwJ0xalpttZUNLsfNi7aby1ytZYAMvEC9LptLQOYzlDM6srdtSD5ls1H ei4UEddZd8Zl0FGWt4Wir8VSM1Y93TrS8F2B3Uhaytv4_RWL9qydmHV0LvgSqaKxYJhfyvtUvqN5 vs.TCbrixxGDC1Yq.cZsRpfzhN2SwIvizqMCHS53LF3lhFamTP_wbNRQOxjiPIYrPsZ8vuS.5jI0 vKABB7EisIg5NCXtoHGQrsxziPmQ2tRPackvSaiGOqqpRAe.vj2DO2v3eketlKq7PrNf_GG0FWkS HZXp.x91u.JBOOf7MT9.T5UJ2.geWG2MVovd7CJxMXmsl1WxZ3RzRCcAyluaoHQQ.Afed80s3S7C jxeOjBjVYZnCxAEU7kWWbfqbH7uH6J5ZRBLKHkvgtOUEJ8rLmTEyz7OD7QPjnImJjf_QoG1UCBl. ._3EX42J5cek4EFmCZYytxYf3jsmY_1zc4PVRh9aRMJnjL0YfkRqMUqEkYrYrYdleaikXYC85AET RADjpGcx1bkrYep9Yf.YNXh4A065hcOpBoOecLLJ3C0gT.Iu1RN7.0L51HPxtsasFcyVMS27jGJX uait.ic.jZtsvpP.qpoqp7WGXIWWyTcMLBJVQTyB9WNwmsRgPV49mHbA8polVjTRyXlG3Y_rVhIX dj0tdGn6TgstQckth7DgTsI9RdrC0yrKWEm9cwrI2drGlpB0LXmEd9RCeYuNMGdyd4abIpyTrcFl nYXKlAyVCPG.6uKKJj6zwMi5p0fB0bB0GcdWELIcMUriFSB5Hbgr4ntreY4HBg8MBm5cmLUwWxfY TwDNkzicM_y9KsVkTd02jTd0M5rlazheEfl9FW5ZCxJTO9XIefaa5FhDrWPdPcLs6Pob3v73taba O1JrgXUC2vzWsOGOt4UXPJ4iV87n2ls40qaC6BOHAHPScqTsNMi_jsfACOXIR7D3Kcu1QskW6ctU FulFVZiZ07bnibl4svHVo7z2CloOvfPd4zsV5Lhc0CDiT2bbnTg0Z4AL38uoTaiaGpTR85s0SEHs XFQ6PgbFww152NEmgjZVZcEErlIQG64MdiP6YMWpmFQxtnLjbBljcQ1jAj2mDHG.zAkm2hEbk8bI 2_8mOXJD33ql1s49UnwxknYEda.apmT2zzoFyONLrl1HsrIHbc9sELA3AMGDabfIcf334YsHM0aN T_VlslnMMzbEI1SJI11I73NGh6nH5m5H3zCPr8z87l4b_wcqSl0kUoL5zX6kjMyqKsWQrQ3e_8NJ kUOA85crv65A0NN4caqibvb6QA.t33wrncASF2Efbuzw7VPLavjjYk5vEmXANwokIOpKmdWdUckE UOXxWdFewGG0OzNYOSumK.jRdMdAqY6hI0onahzG6tKHn00tVimbeFKL.ZdlRJWi26BQ6jMxNy5m f__ylM5fWQXuOLb7ObLOCbqlfBPIuq9Viy_1nha4qMPNafzgmblPmUSmB_J6xM9RhOy6cLztz6CR tK2OTcvZgKCU1_HSS9y0qjDzQfnKVcG_y6584CSwJEaD1dRBWp84eS2OImTy38H83UPcgaAdFsoF nOIhb8fVJvTGoPLASFzeleIyS_PxHFE8cTRHZbPPj6p5lXpkZV43O9ncWvCyfQVUKyhZAZ2VH85c 7X9Kr9PRjs6F4BqJTNEnC.QjKsTi_fj30B7qlA3xpnhXnyWRfqeoDJIAlakmAjuh433_WQ480uh5 JMvHoyOYnFe7mAKjunnDvJysMimX8BCoA8zXzFCdzS.mS1Q0.fTIbRXLP1F.uKmN6Zcxa1tnxrhz N26maWbQ2sp1sBDI9.kvlg4Lbztm1D8bw9ucYVL3w6.PBkpqxoWCaFTvYQU3s12cgSO5fFDYMJnc 1I5zjxKl_P_OTX4qAbow5P59sYs6u4zlPH4PHyiKcHLu_i0bieoYdxosbStts_rJrlZ22GzgqsxB qzvlNkp0d.ZnYLXcSO9GeZWpEyi4KgyRKJhDLd4Bc_XtkTIWA8fBnz.z2CLytXEPd0NmcldOaYuO Pugmbqbqh8LkFKEeZ00tCHmT_Pby.p731cB2slCwKpZnbq8g58NdtBHF6ugtcKT0b4b6QPaQ- Received: from sonic.gate.mail.ne1.yahoo.com by sonic306.consmr.mail.gq1.yahoo.com with HTTP; Wed, 27 Jan 2021 07:55:16 +0000 Received: by smtp411.mail.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 9581c2b9bd9137c0f10e3508603d2807; Wed, 27 Jan 2021 07:55:14 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: FreeBSD-provided .vhd with VirtualBox: gpart I/O errors after resizing the virtual hard disk Message-Id: <44C0BC2F-6C15-405E-B8D7-99AEDA96E44E@yahoo.com> Date: Tue, 26 Jan 2021 23:55:11 -0800 To: grahamperrin@gmail.com, Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: <44C0BC2F-6C15-405E-B8D7-99AEDA96E44E.ref@yahoo.com> X-Rspamd-Queue-Id: 4DQbVv1jdYz3MFj X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.50 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com,freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.68.82:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.68.82:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.68.82:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.68.82:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 07:55:20 -0000 Graham Perrin grahamperrin at gmail.com wrote on Mon Jan 25 22:08:53 UTC 2021 : . . . omitted material, including steps 01..13 . . . Your steps 01..13 make no mention of involving growfs as indicated in "man 8 growfs". I'd guess that the growfs step would be after step 8 (recover) and before 10 (show). (FYI: There is also a "man 7 growfs".) > With FreeBSD-provided 'FreeBSD-12.1-RELEASE-amd64.vhd', things seem even > worse. Please see, for example, this screen recording: > > > > What's going wrong? > > Is it necessary to boot first from something _other_ than the resized > disk, for things such as gpart recover to proceed without I/O error for > the resized disk? I looked at the screen recording's playback and . . . You have made no mention of the cylinder checksum failure notices or at what stage they first occurred. That might be important. I've no clue if they might be an initial cause of issues vs. them being an effect that might also contribute to later issues when the checksums fail. Unfortunately, it does not look like "man fsck_ffs" covers its cylinder checksum failure handling: ** Phase 5 - Check Cyl groups (At least I presume that phase is related to what the failure notices are reporting.) I'm afraid I'm of no general help but it looked like some extra information might be appropriate --or the man 8 or 7 growfs related activity being involved might avoid later getting cylinder checksum failure notices. I hope this proves of some help, but, if it is not, I'm unlikely to have more information, sorry. === Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar) From owner-freebsd-current@freebsd.org Wed Jan 27 08:10:05 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9AFDD4F1013 for ; Wed, 27 Jan 2021 08:10:05 +0000 (UTC) (envelope-from ish@amail.plala.or.jp) Received: from msc12.plala.or.jp (msc12.plala.or.jp [IPv6:2400:7800:0:502e::22]) by mx1.freebsd.org (Postfix) with ESMTP id 4DQbqv3R5vz3NGb for ; Wed, 27 Jan 2021 08:10:02 +0000 (UTC) (envelope-from ish@amail.plala.or.jp) Received: from localhost ([2400:4050:9320:7a00::8]) by msc12.plala.or.jp with ESMTP id <20210127080952.BKIC19593.msc12.plala.or.jp@localhost> for ; Wed, 27 Jan 2021 17:09:52 +0900 Date: Wed, 27 Jan 2021 17:09:46 +0900 (JST) Message-Id: <20210127.170946.2174410803376570566.ish@amail.plala.or.jp> To: freebsd-current@freebsd.org Subject: Re: pkg for 14-current From: Masachika ISHIZUKA In-Reply-To: <321CEDCC-51FA-4876-936B-624558020A1C@freebsd.org> References: <321CEDCC-51FA-4876-936B-624558020A1C@freebsd.org> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-VirusScan: Outbound; mvir-ac12; Wed, 27 Jan 2021 17:09:52 +0900 X-Rspamd-Queue-Id: 4DQbqv3R5vz3NGb X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of ish@amail.plala.or.jp designates 2400:7800:0:502e::22 as permitted sender) smtp.mailfrom=ish@amail.plala.or.jp X-Spamd-Result: default: False [-1.19 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2400:7800:0:502e::22:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; MV_CASE(0.50)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2400:7800:0:502e::22:from:127.0.2.255]; DMARC_NA(0.00)[plala.or.jp]; R_SPF_ALLOW(-0.20)[+ip6:2400:7800:0:502e::/60]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.49)[-0.491]; MID_CONTAINS_FROM(1.00)[]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:4713, ipnet:2400:7800::/32, country:JP]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 08:10:05 -0000 >>> The first package build for 14-CURRENT is visible on the mirrors now >>> (as of a couple of minutes ago). > > I've not updated the index.html pages on the mirrors yet. (Actually, > I did update them, but I forgot to commit the change - I'll go and do > that now.) Thank you very much. I'm happy to be able to pkg upgrade on 14-current. -- Masachika ISHIZUKA From owner-freebsd-current@freebsd.org Wed Jan 27 13:19:54 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EEE4C4F910B for ; Wed, 27 Jan 2021 13:19:54 +0000 (UTC) (envelope-from ronald-lists@klop.ws) Received: from smtp-relay-int.realworks.nl (smtp-relay-int.realworks.nl [194.109.157.24]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQkjQ0TsCz4VNQ for ; Wed, 27 Jan 2021 13:19:53 +0000 (UTC) (envelope-from ronald-lists@klop.ws) Date: Wed, 27 Jan 2021 14:19:50 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=klop.ws; s=rw2; t=1611753591; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=UxEj8cKSRsBpc2BaTy0NzbVQMXVhFs+Z/4NmRgRqgU0=; b=NpdzcAimkQ1mQkyPn2wHfdhY9IBdN8NvttwZiCNkRPayHkMDd4F6DQzY5KtEMYvpaDk4yt jiucoFqBTLrTBbEK6TpNuY+mrQ+PisFdfJ8ldG3wiWDvg/AWMRWvxqI7BqzMsiD0oGvn0d m/PQtNh+Ol1GtNxQqai5ZbNN4J+VvODfkVWPY88qdNzCNnMluWwDG+rZQyV59jMC/qcJ8X /F7uzcOiy0I4sD0H2fAEnxequDUkKJxYCQ2RqGAcFiD/xXo1E53xmZZ6uSWT973+ZPtj21 onh0CnlNAf78HoQ6MTDKZL1Ru3kg4aAYzAu25RgXUv04/+RTbM/sxXXb9b8AUg== From: Ronald Klop To: Masachika ISHIZUKA Cc: freebsd-current@freebsd.org Message-ID: <108232521.1.1611753590535@localhost> In-Reply-To: <20210127.170946.2174410803376570566.ish@amail.plala.or.jp> References: <321CEDCC-51FA-4876-936B-624558020A1C@freebsd.org> <20210127.170946.2174410803376570566.ish@amail.plala.or.jp> Subject: Re: pkg for 14-current MIME-Version: 1.0 X-Mailer: Realworks (545.306.f09a52ba01e) Importance: Normal X-Priority: 3 (Normal) X-Rspamd-Queue-Id: 4DQkjQ0TsCz4VNQ X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=klop.ws header.s=rw2 header.b=NpdzcAim; dmarc=pass (policy=none) header.from=klop.ws; spf=pass (mx1.freebsd.org: domain of ronald-lists@klop.ws designates 194.109.157.24 as permitted sender) smtp.mailfrom=ronald-lists@klop.ws X-Spamd-Result: default: False [-3.50 / 15.00]; ARC_NA(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[194.109.157.24:from]; R_DKIM_ALLOW(-0.20)[klop.ws:s=rw2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:194.109.157.0/24]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[klop.ws:+]; RCPT_COUNT_TWO(0.00)[2]; HAS_X_PRIO_THREE(0.00)[3]; RCVD_IN_DNSWL_NONE(0.00)[194.109.157.24:from]; DMARC_POLICY_ALLOW(-0.50)[klop.ws,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; MID_RHS_NOT_FQDN(0.50)[]; ASN(0.00)[asn:3265, ipnet:194.109.0.0/16, country:NL]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=us-ascii; format=flowed Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 13:19:55 -0000 Van: Masachika ISHIZUKA Datum: woensdag, 27 januari 2021 09:09 Aan: freebsd-current@freebsd.org Onderwerp: Re: pkg for 14-current > > >>> The first package build for 14-CURRENT is visible on the mirrors now > >>> (as of a couple of minutes ago). > > > > I've not updated the index.html pages on the mirrors yet. (Actually, > > I did update them, but I forgot to commit the change - I'll go and do > > that now.) > > Thank you very much. > I'm happy to be able to pkg upgrade on 14-current. > -- > Masachika ISHIZUKA > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to "freebsd-current-unsubscribe@freebsd.org" > > > Is this about http://pkg.freebsd.org/ ? May I hijack this thread to say that "FreeBSD:11:aarch64 (only quarterly is updated)" is not updated anymore. I don't know about the future plans of this. I don't need FreeBSD:11:aarch64 myself and am (unfortunately) not involved in the pkg build cluster. Regards, Ronald. From owner-freebsd-current@freebsd.org Wed Jan 27 14:25:35 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6EF804FAA30 for ; Wed, 27 Jan 2021 14:25:35 +0000 (UTC) (envelope-from freebsd@grem.de) Received: from mail.evolve.de (mail.evolve.de [213.239.217.29]) (using TLSv1.3 with cipher TLS_CHACHA20_POLY1305_SHA256 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA512 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mail.evolve.de", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQm9B2pR9z4ZTw for ; Wed, 27 Jan 2021 14:25:34 +0000 (UTC) (envelope-from freebsd@grem.de) Received: by mail.evolve.de (OpenSMTPD) with ESMTP id 27a4d1de; Wed, 27 Jan 2021 14:25:25 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha1; c=relaxed; d=grem.de; h=date:from:to:cc :subject:message-id:in-reply-to:references:mime-version :content-type:content-transfer-encoding; s=20180501; bh=VdYcxGHI WfDzJK3u1xGqy+Shfrc=; b=WL108DVOuWpbjT2zyHQpnldTp945X1zJc8Yt+162 cjHD4Hw1EOK+wQHFtLH11SxSODNY/qc5DlicwaXlWJiErI+v30ZdeAPrCYQbdshU /6uqfgA1uOz1B83OmdR0TDPXNETE//HJCp+5wIVQV7wg452sa56i+YXHGdj3fqyW /wl3B/HreZpSMDQocoNKKU+dR637EpXP7wjJXfIMIFndSf48FUftLsxZrKENkCjI WUYEFIhY4K14sTjnhPr7ko0vxfwoQ8FB/0nx/zT0uONaeHk5340fssd0RCOZA+kQ qKfAOFR8rKxs2wRoQAjrAPDpsXYAneyPqjBdV6VG3j127A== DomainKey-Signature: a=rsa-sha1; c=nofws; d=grem.de; h=date:from:to:cc :subject:message-id:in-reply-to:references:mime-version :content-type:content-transfer-encoding; q=dns; s=20180501; b=m9 mR34a0BppLaJ8vRS2D6vNe/d1YkaAi6KVn1r41+4kmas3KFPLM5Bp8aX12N+aQ2I jpzAv89+ruT72kOU0ikkT9JpVmwvNxqltez+vVWW8aBB1QE55hmjyZ0mBDo59eJA ahc8LZrr8jfvR6bVRIuYKzxVpYfpz34lZ7sb+PHt+X8XYar2joKZ3eIRSS3Rdm7Q eFEhQYt2WE+zZh1TmQuN+Y2dAgpbqhmJBQOhfZsTEq2N7zrKCSa8bsuFjj61pwXi lm95veHauLWdqvxu7EKFd4Nh9Z1HtUUv4mTd+QR928mPkQC3zqieysvM4xBkUGEI Bjv8Y269xFut6o7igsyA== Received: by mail.evolve.de (OpenSMTPD) with ESMTPSA id ac28a7e0 (TLSv1.3:AEAD-CHACHA20-POLY1305-SHA256:256:NO); Wed, 27 Jan 2021 14:25:23 +0000 (UTC) Date: Wed, 27 Jan 2021 15:24:25 +0100 From: Michael Gmelin To: KIRIYAMA Kazuhiko Cc: freebsd-current@freebsd.org Subject: Re: Can't fetch https://www.freebsd.org/releng/index.html Message-ID: <20210127152425.12b83c07@bsd64.grem.de> In-Reply-To: <202101270040.10R0eO0D071142@kx.truefc.org> References: <202101270040.10R0eO0D071142@kx.truefc.org> X-Face: $wrgCtfdVw_H9WAY?S&9+/F"!41z'L$uo*WzT8miX?kZ~W~Lr5W7v?j0Sde\mwB&/ypo^}> +a'4xMc^^KroE~+v^&^#[B">soBo1y6(TW6#UZiC]o>C6`ej+i Face: iVBORw0KGgoAAAANSUhEUgAAADAAAAAwBAMAAAClLOS0AAAAJFBMVEWJBwe5BQDl LASZU0/LTEWEfHbyj0Txi32+sKrp1Mv944X8/fm1rS+cAAAACXBIWXMAAAsTAAAL EwEAmpwYAAAAB3RJTUUH3wESCxwC7OBhbgAAACFpVFh0Q29tbWVudAAAAAAAQ3Jl YXRlZCB3aXRoIFRoZSBHSU1QbbCXAAAAAghJREFUOMu11DFvEzEUAGCfEhBVFzuq AKkLd0O6VrIQsLXVSZXoWE5N1K3DobBBA9fQpRWc8OkWouaIjedWKiyREOKs+3PY fvalCNjgLVHeF7/3bMtBzV8C/VsQ8tecEgCcDgrzjekwKZ7TwsJZd/ywEKwwP+ZM 8P3drTsAwWn2mpWuDDuYiK1bFs6De0KUUFw0tWxm+D4AIhuuvZqtyWYeO7jQ4Aea 7jUqI+ixhQoHex4WshEvSXdood7stlv4oSuFOC4tqGcr0NjEqXgV4mMJO38nld4+ xKNxRDon7khyKVqY7YR4d+Cg0OMrkWXZOM7YDkEfKiilCn1qYv4mighZiynuHHOA Wq9QJq+BIES7lMFUtcikMnkDGHUoncA+uHgrP0ctIEqfwLHzeSo+eUA66AqzwN6n 2ZHJhw6Qh/PoyC/QENyEyC/AyNjq74Bs+3UH0xYwzDUC4B97HgLocg1QLYgDDO1v f3UX9Y307Ew4AHh67YAFFsxEpkXwpXY3eIgMhAAE3R19L919nNnuD2wlPcDE3UeT L2ytEICQib9BXgS2fU8PrD82ToYO1OEmMSnYTjSqSv9wdC0tPYC+rQRQD9ESnldF CyqfmiYW+tlALt8gH2xrMdC/youbjzPXEun+/ReXsMCDyve3dZc09fn2Oas8oXGc Jj6/fOeK5UmSMPmf/jL+GD8BEj0k/Fn6IO4AAAAASUVORK5CYII= MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQm9B2pR9z4ZTw X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=grem.de header.s=20180501 header.b=WL108DVO; dmarc=none; spf=pass (mx1.freebsd.org: domain of freebsd@grem.de designates 213.239.217.29 as permitted sender) smtp.mailfrom=freebsd@grem.de X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; URL_IN_SUBJECT(1.00)[www.freebsd.org]; R_DKIM_ALLOW(-0.20)[grem.de:s=20180501]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:213.239.217.29/32]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[grem.de]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[213.239.217.29:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[grem.de:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-0.996]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[213.239.217.29:from]; ASN(0.00)[asn:24940, ipnet:213.239.192.0/18, country:DE]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 14:25:35 -0000 On Wed, 27 Jan 2021 09:40:24 +0900 KIRIYAMA Kazuhiko wrote: > Hi all, > > I've been used https://www.freebsd.org/releng/index.html to know about > latest FreeBSD updateing status for my many applications. I found that > index.html can't fetch yesterday. > > Is there anyone to tell me how to get latest FreeBSD updateing status > information with source file ? It's there, but redirecting to the new url: requesting https://www.freebsd.org/releng/index.html 301 redirect to http://www.freebsd.org/releng/ -m > --- > Kazuhiko Kiriyama > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to > "freebsd-current-unsubscribe@freebsd.org" -- Michael Gmelin From owner-freebsd-current@freebsd.org Wed Jan 27 19:04:41 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B05F74E641D for ; Wed, 27 Jan 2021 19:04:41 +0000 (UTC) (envelope-from markjdb@gmail.com) Received: from mail-qv1-xf33.google.com (mail-qv1-xf33.google.com [IPv6:2607:f8b0:4864:20::f33]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQtMD5WKyz3D8R; Wed, 27 Jan 2021 19:04:40 +0000 (UTC) (envelope-from markjdb@gmail.com) Received: by mail-qv1-xf33.google.com with SMTP id l14so1610683qvp.2; Wed, 27 Jan 2021 11:04:40 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=sender:date:from:to:cc:subject:message-id:references:mime-version :content-disposition:in-reply-to; bh=XaKV1ORqVijFMDGzwfCiQhF9xKv4UYP1qECIwXix1Gk=; b=TV2jSmvARAmxBKx98YkTyV1Hc7s8RKQlWs3bSaBtqHGip6nkfrPSNRBGYA2xQD2SA4 2IlyhEAchKoheKLSduWxysRrqRKrQQFQj/FSKnTf5azK5LMmRnIFhqLbFxjBNJPARz9W f1uXuCYVrG2P7hzcICLPq3o0WknOx1pJCZxbqnAFJor8UIAhG5893kqeTZFeDNyyh4/F 1XETolAGy5UXE+n2UjSKzQQWRjutLAzHNHnNOXkj0FJWj7CLe2hwJBH8dq/WUOzQZG5e WrxXQcmXbZAtjwFxpFHLtjBymNuzP3opit9idtO5Pyp2TlWhc2C1qkJHgYMh5x/YkY3H /5Qw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:sender:date:from:to:cc:subject:message-id :references:mime-version:content-disposition:in-reply-to; bh=XaKV1ORqVijFMDGzwfCiQhF9xKv4UYP1qECIwXix1Gk=; b=qUukDsK/X/tKaMx6kBeyQGoIr/tCK6ZaruAhO53eCvDyucLkrCYqxiVtRrqxdAc/Q/ Pi4PWD7nblquzSBPtsi2O4iVAE1xIa5ck5E691gNEbuQxY0RBA+LUTMduaoE87Dz9k3O YcoD3aWOLiA5rk2EhMRAWlteTvzJtPU1oN2E3zHpMVexwbD9fmDyc6amn4upITdeJcby SP59MOIx1cM/CqDQ13IKVV5WrdKdfpk2mhSEyV9Y++0EaIOcbbU7BqaIgGz7YX3+ykFf OYs1W7Fn44yrkRnJgA0iBc+2tjaU4CBMeVObW3vILykLC4SlBrZ9v2XcdeO23JRTk7mt orFg== X-Gm-Message-State: AOAM530RABU1dpk7KxJQ3uq3s9CjYFGFg+qO2lYY0E+Uv/twg22H4y9h oLAyDwzCIFaeBrejWOUJcgg= X-Google-Smtp-Source: ABdhPJw8KlGt9QjBx9TYMNIvUahYx57nwenQptRGtFgpReysuSUNcf2Bh52/ZTHLhdJdqqVzbaHhPQ== X-Received: by 2002:a0c:a525:: with SMTP id y34mr11709480qvy.37.1611774279705; Wed, 27 Jan 2021 11:04:39 -0800 (PST) Received: from raichu ([142.126.164.150]) by smtp.gmail.com with ESMTPSA id l22sm1900311qtl.96.2021.01.27.11.04.38 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Wed, 27 Jan 2021 11:04:38 -0800 (PST) Sender: Mark Johnston Date: Wed, 27 Jan 2021 14:04:36 -0500 From: Mark Johnston To: Rick Macklem Cc: Ronald Klop , "freebsd-current@freebsd.org" , Neel Chauhan Subject: Re: Can In-Kernel TLS (kTLS) work with any OpenSSL Application? Message-ID: References: MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4DQtMD5WKyz3D8R X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=TV2jSmvA; dmarc=none; spf=pass (mx1.freebsd.org: domain of markjdb@gmail.com designates 2607:f8b0:4864:20::f33 as permitted sender) smtp.mailfrom=markjdb@gmail.com X-Spamd-Result: default: False [-1.70 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[markj@freebsd.org,markjdb@gmail.com]; SUBJECT_ENDS_QUESTION(1.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[markj@freebsd.org,markjdb@gmail.com]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f33:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f33:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f33:from]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 19:04:41 -0000 On Sat, Jan 23, 2021 at 03:25:59PM +0000, Rick Macklem wrote: > Ronald Klop wrote: > >On Wed, 20 Jan 2021 21:21:15 +0100, Neel Chauhan wrote: > > > >> Hi freebsd-current@, > >> > >> I know that In-Kernel TLS was merged into the FreeBSD HEAD tree a while > >> back. > >> > >> With 13.0-RELEASE around the corner, I'm thinking about upgrading my > >> home server, well if I can accelerate any SSL application. > >> > >> I'm asking because I have a home server on a symmetrical Gigabit > >> connection (Google Fiber/Webpass), and that server runs a Tor relay. If > >> you're interested in how Tor works, the EFF has a writeup: > >> https://www.eff.org/pages/what-tor-relay > >> > >> But the main point for you all is: more-or-less Tor relays deal with > >> 1000s TLS connections going into and out of the server. > >> > >> Would In-Kernel TLS help with an application like Tor (or even load > >> balancers/TLS termination), or is it more for things like web servers > >> sending static files via sendfile() (e.g. CDN used by Netflix). > >> > >> My server could also work with Intel's QuickAssist (since it has an > >> Intel Xeon "Scalable" CPU). Would QuickAssist SSL be more helpful here? > There is now qat(4), which KTLS should be able to use, but I do > not think it has been tested for this. I also have no idea > if it can be used effectively for userland encryption? KTLS requires support for separate output buffers and AAD buffers, which I hadn't implemented in the committed driver. I have a working patch which adds that, so when that's committed qat(4) could in principle be used with KTLS. So far I only tested with /dev/crypto and a couple of debug sysctls used to toggle between the different cryptop buffer layouts, not with KTLS proper. qat(4) can be used by userspace via cryptodev(4). This comes with a fair bit of overhead since it involves a round-trip through the kernel and some extra copying. AFAIK we don't have any framework for exposing crypto devices directly to userspace, akin to DPDK's polling mode drivers or netmap. I've seen a few questions about the comparative (dis)advantages of QAT and AES-NI so I'll sidetrack a bit and try to characterize qat(4)'s performance here based on some microbenchmarking I did this week. This was all done in the kernel and so might need some qualification if you're interested in using qat(4) from userspace. Numbers below are gleaned from an Atom C3558 at 2.2GHz with an integrated QAT device. I mostly tested AES-CBC-256 and AES-GCM-256. The high-level tradeoffs are: - qat(4) introduces a lot of latency. For a single synchronous operation it can take between 2x and 100x more time than aesni(4) to complete. aesni takes 1000-2000 cycles to handle a request plus 3-5 cycles per byte depending on the algorithm. qat takes at least ~150,000 cycles between calling crypto_dispatch() and the cryptop completion callback, plus 5-8 cycles per byte. qat dispatch itself is quite cheap, typically 1000-2000 cycles depending on the size of the buffer. Handling a completion interrupt involves a context switch to the driver ithread but this is also a small cost relative to the entire operation. So, for anything where latency is crucial QAT is probably not a great bet. - qat can save a correspondingly large number of CPU cycles. It takes qat roughly twice as long as aesni to complete encryption of a 32KB buffer using AES-CBC-256 (more with GCM), but with qat the CPU is idle much of the time. Dispatching the request to firmware takes less than 1% of the total time elapsed between request dispatch and completion, even with small buffers. OTOH with really small buffers aesni can complete a request in the time that it takes qat just to dispatch the request to the device, so at best qat will give comparable throughput and CPU usage and worse latency. - qat can handle multiple requests in parallel. This can improve throughput dramatically if the producer can keep qat busy. Empirically, the maximum throughput improvement is a function of the request size. For example, counting the number of cycles required to encrypt 100,000 buffers using AES-GCM-256: max # in flight 1 16 64 128 aesni, 16B 206M n/a n/a n/a aesni, 4KB 1.52B n/a n/a n/a aesni, 32KB 10.8B n/a n/a n/a qat, 16B 17.1B 1.11B 219M 184M qat, 4KB 20.9B 1.68B 710M 694M qat, 32KB 38.2B 8.37B 4.25B 4.23B As a side note, OpenCrypto supports async dispatch for software crypto drivers, in which crypto_dispatch() hands work off to other threads. This is enabled by net.inet.ipsec.async_crypto, for example. Of course, the maximum parallelism is limited by the number of CPUs in the system, but this can improve throughput significantly as well if you're willing to spend the corresponding CPU cycles. To summarize, QAT can be beneficial when some or all of the following apply: 1. You have large requests. qat can give comparable throughput for small requests if the producer can exploit parallelism in qat, though OpenCrypto's backpressure mechanism is really primitive (arguably non-existent) and performance will tank if things get to a point where qat can't keep up. 2. You're able to dispatch requests in parallel. But see point 1. 3. CPU cycles are precious and the extra latency is tolerable. 3b. aesni doesn't implement some transform that you care about, but qat does. Some (most?) Xeons don't implement the SHA extensions for instance. I don't have a sense for how the plain cryptosoft driver performs relative to aesni though. From owner-freebsd-current@freebsd.org Wed Jan 27 20:03:04 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B9E6C4E82A9 for ; Wed, 27 Jan 2021 20:03:04 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DQvfb4QKHz3JFt for ; Wed, 27 Jan 2021 20:03:03 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id CB62F1284C for ; Thu, 28 Jan 2021 05:02:59 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611777779; bh=NE4mKrN+P/4VEEgEEaK7FywDpUe+9n3zjY2epagpaMc=; h=Date:To:Subject:From:In-Reply-To:References; b=SygIwddrt2BBqi++vIhcojiLBJHWAe7vIyBhzWYMhGHCv2vFXotROAx41ucbFPrTM NlngoQ4cM/S78bpzYQMynh2gyCglb0wHCQk1iHLdni4gLWZhB+T+3eGBzdqJ7TEgp6 iQzb6xosdP6z1pFpZUyV1JT7aC2OOlHppubfmmAlYhr+rbFvHldaTUvXHwHA3CrPFN Ub7rc2qrCUxcO+6ion/FalTR6o4x/Tdj1GVn1vmxszwjTWR/FMKeM0RvXGsi49Jpsg 4eL10jQed6Ep8ZpP8fxqgGvSa+wrsndBK+dKyrgs/3sz6Ns3CBL9oAx3sfPOgqmG5r xagRhKVjdlr+g== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id D32F91C30E; Thu, 28 Jan 2021 05:02:58 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Thu, 28 Jan 2021 05:02:42 +0900 (JST) Message-Id: <20210128.050242.1986722766748729591.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: Waiting for bufdaemon From: Yasuhiro Kimura In-Reply-To: <20210116.040323.136067379540977557.yasu@utahime.org> References: <7c4da243-52ff-c5ee-3d56-1ae651286e0e@alvermark.net> <20210115.201030.1395690536446474720.yasu@utahime.org> <20210116.040323.136067379540977557.yasu@utahime.org> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DQvfb4QKHz3JFt X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=SygIwddr; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [-0.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-1.00)[-0.997]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[utahime.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 20:03:04 -0000 From: Yasuhiro Kimura Subject: Re: Waiting for bufdaemon Date: Sat, 16 Jan 2021 04:03:23 +0900 (JST) > From: Yasuhiro Kimura > Subject: Re: Waiting for bufdaemon > Date: Fri, 15 Jan 2021 20:10:30 +0900 (JST) > >> I have been experiencing same problem with my 13-CURRENT amd64 >> VirtualBox VM for about a month. The conditions that the problem >> happens are unclear and all what I can say is >> >> * It happens only after I login in the VM and do something for a >> while. If I boot the VM and shut it down immediately, it never >> happens. >> * When the problem happens, one or more unkillable processes seem to >> be left. > > CPU of my host is not AMD but Intel. According to the > /var/run/dmesg.boot of VM, information of CPU is as following. > > CPU: Intel(R) Core(TM) i7-9700 CPU @ 3.00GHz (3000.09-MHz K8-class CPU) > Origin="GenuineIntel" Id=0x906ed Family=0x6 Model=0x9e Stepping=13 > Features=0x1783fbff > Features2=0x5eda2203 > AMD Features=0x28100800 > AMD Features2=0x121 > Structured Extended Features=0x842421 > Structured Extended Features3=0x30000400 > IA32_ARCH_CAPS=0x29 > TSC: P-state invariant > > Just FYI. It took for a while to investigate, but according to the result of bisect following commit is the source of problem in my case. ---------------------------------------------------------------------- commit 84eaf2ccc6a Author: Konstantin Belousov Date: Mon Dec 21 19:02:31 2020 +0200 x86: stop punishing VMs with low priority for TSC timecounter I suspect that virtualization techniques improved from the time when we have to effectively disable TSC use in VM. For instance, it was reported (complained) in https://github.com/JuliaLang/julia/issues/38877 that FreeBSD is groundlessly slow on AWS with some loads. Remove the check and start watching for complaints. Reviewed by: emaste, grehan Discussed with: cperciva Sponsored by: The FreeBSD Foundation Differential Revision: https://reviews.freebsd.org/D27629 ---------------------------------------------------------------------- I confirmed the problem still happens with 5c325977b11 but reverting above commit fixes it. --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Wed Jan 27 23:35:58 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 24BF24ED9A0 for ; Wed, 27 Jan 2021 23:35:58 +0000 (UTC) (envelope-from jsm@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DR0NC5Jmxz3myh for ; Wed, 27 Jan 2021 23:35:55 +0000 (UTC) (envelope-from jsm@FreeBSD.org) Received: from freebsd2.freebsd.lan (mail.northatlanticmusicsupplies.com [212.237.182.202]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) (Authenticated sender: jsm) by smtp.freebsd.org (Postfix) with ESMTPSA id 5F1952A0A6 for ; Wed, 27 Jan 2021 23:35:54 +0000 (UTC) (envelope-from jsm@FreeBSD.org) To: freebsd-current@freebsd.org From: Jesper Schmitz Mouridsen Subject: vidcontrol < /dev/console -i active ioctl error Message-ID: Date: Thu, 28 Jan 2021 00:35:36 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-US X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 Jan 2021 23:35:58 -0000 FreeBSD build.freebsd.lan 13.0-ALPHA1 FreeBSD 13.0-ALPHA1 #0 main-c255938-g7ae27c2d6c4: Thu Jan 14 06:29:55 UTC 2021 root@releng1.nyi.freebsd.org:/usr/obj/usr/src/amd64.amd64/sys/GENERIC amd64 jesper@build:~ $ su Password: root@build:~ # vidcontrol < /dev/console -i active vidcontrol: getting active vty: Inappropriate ioctl for device build is virtualized in bhyve, it happens as well on my pinebook pro. This is annoying to sysutils/consolekit2 on 12.2 it works (not tested on same HW) From owner-freebsd-current@freebsd.org Thu Jan 28 01:33:11 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B91C54F0DEB for ; Thu, 28 Jan 2021 01:33:11 +0000 (UTC) (envelope-from sjg@juniper.net) Received: from mx0a-00273201.pphosted.com (mx0a-00273201.pphosted.com [208.84.65.16]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.pphosted.com", Issuer "Thawte RSA CA 2018" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DR2zV0Fglz3tcm; Thu, 28 Jan 2021 01:33:09 +0000 (UTC) (envelope-from sjg@juniper.net) Received: from pps.filterd (m0108156.ppops.net [127.0.0.1]) by mx0a-00273201.pphosted.com (8.16.0.43/8.16.0.43) with SMTP id 10S1P9xr007203; Wed, 27 Jan 2021 17:33:07 -0800 Received: from nam12-bn8-obe.outbound.protection.outlook.com (mail-bn8nam12lp2170.outbound.protection.outlook.com [104.47.55.170]) by mx0a-00273201.pphosted.com with ESMTP id 36a8y1cd7d-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT); Wed, 27 Jan 2021 17:33:07 -0800 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=MIP/Eaeyye/u7A2kc1nMIzngQu9GgIbMo84NSisp9qqbTmX6xjCvfR5SvC1GxOK4kp+RwoEq5sqjDo8tj0ng0VI/vJbVO20afTU8ZJgqrkkdeaF1dMcCB9gj/Qm+t9/CZkkHE/YNBC2TJfgYx8EV5XhzImm0KzW0EHJY3Znzo9FBI5bvFZ0BjRjUC1n27UCL1wKynyYDcJnqb1nuY4nds95BHXfgRtj/ZDTtgqVGEMjKh38LD+luxMAtzQ1R/+gDuKaM2sb6Y6pcSby8AEH440W0YVt1g/Rswje1Ys5gYL1ueUDQFAPJSWbOAMZSAyPciKrksJeexQbDhImKiyn6Ig== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=9yybdvoslTOkJvZQBM28RVauHGhXPj3iwu2OjaRluno=; b=R1nEh9F07rI/AnZSmhg7Z40W6Tvv72P0mAVJhsNRmi/RQLUiImyNnbT0GqA2KGNO7wmYyymdq989GNeMC0vE/S8DvJfCCz0s3r7a6P9OJYnJWzaSOV4oPu2r47KOTymM2Ar3jymp16vXChyvoeGcUcg3iFDiarEskjvnNFE0bfn+q9k5/CS7P4X2ScB+3xRnOulPTA+SBuyDWGm2SQjysqoEHLIWw57vomaNPIxvshNCO0Lb+wuHv0uPRZImjLPcTpwFDnTcQUL+HDQopdeLk8E1zmFiq3PQW0nCnoRPHM4/TD0+Cy4tzKyEVEfvqqvf13DPc6REkjBzdkMC+2NiXA== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=softfail (sender ip is 66.129.239.12) smtp.rcpttodomain=yahoo.com smtp.mailfrom=juniper.net; dmarc=fail (p=reject sp=reject pct=100) action=oreject header.from=juniper.net; dkim=none (message not signed); arc=none Received: from BN8PR15CA0035.namprd15.prod.outlook.com (2603:10b6:408:c0::48) by SN6PR05MB5215.namprd05.prod.outlook.com (2603:10b6:805:ef::21) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3805.5; Thu, 28 Jan 2021 01:33:04 +0000 Received: from BN8NAM12FT005.eop-nam12.prod.protection.outlook.com (2603:10b6:408:c0:cafe::51) by BN8PR15CA0035.outlook.office365.com (2603:10b6:408:c0::48) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3805.16 via Frontend Transport; Thu, 28 Jan 2021 01:33:04 +0000 X-MS-Exchange-Authentication-Results: spf=softfail (sender IP is 66.129.239.12) smtp.mailfrom=juniper.net; yahoo.com; dkim=none (message not signed) header.d=none;yahoo.com; dmarc=fail action=oreject header.from=juniper.net; Received-SPF: SoftFail (protection.outlook.com: domain of transitioning juniper.net discourages use of 66.129.239.12 as permitted sender) Received: from P-EXFEND-EQX-01.jnpr.net (66.129.239.12) by BN8NAM12FT005.mail.protection.outlook.com (10.13.182.167) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.3805.6 via Frontend Transport; Thu, 28 Jan 2021 01:33:04 +0000 Received: from P-EXBEND-EQX-03.jnpr.net (10.104.8.56) by P-EXFEND-EQX-01.jnpr.net (10.104.8.54) with Microsoft SMTP Server (TLS) id 15.0.1497.2; Wed, 27 Jan 2021 17:33:03 -0800 Received: from P-EXBEND-EQX-01.jnpr.net (10.104.8.52) by P-EXBEND-EQX-03.jnpr.net (10.104.8.56) with Microsoft SMTP Server (TLS) id 15.0.1497.2; Wed, 27 Jan 2021 17:33:03 -0800 Received: from p-mailhub01.juniper.net (10.104.20.6) by P-EXBEND-EQX-01.jnpr.net (10.104.8.52) with Microsoft SMTP Server (TLS) id 15.0.1497.2 via Frontend Transport; Wed, 27 Jan 2021 17:33:03 -0800 Received: from kaos.jnpr.net (kaos.jnpr.net [172.23.255.201]) by p-mailhub01.juniper.net (8.14.4/8.11.3) with ESMTP id 10S1X1J3011052; Wed, 27 Jan 2021 17:33:02 -0800 (envelope-from sjg@juniper.net) Received: by kaos.jnpr.net (Postfix, from userid 1377) id 2FF5728A71; Wed, 27 Jan 2021 17:33:02 -0800 (PST) Received: from kaos.jnpr.net (localhost [127.0.0.1]) by kaos.jnpr.net (Postfix) with ESMTP id 2E7B228B4E; Wed, 27 Jan 2021 17:33:02 -0800 (PST) To: Mark Millard CC: Bryan Drewery , Current FreeBSD , Subject: Re: FYI: Why META_MODE rebuilds so much for building again after installworld (no source changes) In-Reply-To: References: <3345EBA5-A09C-4E3F-B94D-39F57F56BDBB@yahoo.com> Comments: In-reply-to: Mark Millard via freebsd-current message dated "Tue, 26 Jan 2021 16:00:05 -0800." From: "Simon J. Gerraty" X-Mailer: MH-E 8.6+git; nmh 1.7.1; GNU Emacs 27.1 MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <72122.1611797582.1@kaos.jnpr.net> Content-Transfer-Encoding: quoted-printable Date: Wed, 27 Jan 2021 17:33:02 -0800 Message-ID: <73088.1611797582@kaos.jnpr.net> X-EXCLAIMER-MD-CONFIG: e3cb0ff2-54e7-4646-8a04-0dae4ac7b136 X-EOPAttributedMessage: 0 X-MS-Office365-Filtering-HT: Tenant X-MS-PublicTrafficType: Email X-MS-Office365-Filtering-Correlation-Id: ef48cbfd-b43c-4685-5d2c-08d8c32ca880 X-MS-TrafficTypeDiagnostic: SN6PR05MB5215: X-Microsoft-Antispam-PRVS: X-MS-Oob-TLC-OOBClassifiers: OLM:8882; X-MS-Exchange-SenderADCheck: 1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: tzM37lhUlRQ1IsrhDMYnP3m9Bqk6JICyYbpUm9XLLkiZhmQara4pLa3eP958HgNnv6q/+IMzuBsP5CHCGf1ZPH/F5nnJNyRNe2w3eCKqgQVkEDn3fLEoMhcMIDnHviXJQqqWvi/BCXyraSAVXROoF1tFFxxye3G50ETZvfYunVh2NNjjwpIAlGM21ZGkA0d1XnnGe9RGq+pyAj16yrEiVcn7bg+p92XMjXgJJYL0JdequI+SgRmCvZPnWOpcxjf9uadA08OKkbVxVb1d3SNug+9AVZCJRCZbYK6NFtOXGxf03UKxdmHxHFK7uau+KdBVcH34MWju205h+mbguVI47q+Ed8ZrC1SewaYUSIT2FCoJwKYjhQxAR8pYRGEzVt1Lo0mJVkzwKV3okwVSwerFS6bKslzxW7Ctt+XjNhre7Yw7Pmxc4TnQ+E3pbVkn+SXgnQkE2SUx5HxxdnXHiWNTLHsSD73Ch26LqfflvxSO1p7yd4zs/7V8FsvWMpKk9XHvd/taMuD5lgkWJ4GiS+V/tACHorZA1wWdFPCRi6ALGmT4DE+iZVKW26pGsoUIVpPfJs0QUcsRkLCdvitEJNL0pdAQH7/rBu26Rpe2UKR8lnHjyt415fRWCiZ4XW7HsGlx X-Forefront-Antispam-Report: CIP:66.129.239.12; CTRY:US; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:P-EXFEND-EQX-01.jnpr.net; PTR:InfoDomainNonexistent; CAT:NONE; SFS:(4636009)(136003)(346002)(39860400002)(376002)(396003)(46966006)(7696005)(82310400003)(6916009)(107886003)(82740400003)(186003)(7126003)(8676002)(26005)(47076005)(6266002)(4326008)(86362001)(356005)(5660300002)(2906002)(336012)(478600001)(316002)(70586007)(55016002)(9686003)(8936002)(70206006)(81166007)(54906003)(83380400001)(36610700001); DIR:OUT; SFP:1102; X-OriginatorOrg: juniper.net X-MS-Exchange-CrossTenant-OriginalArrivalTime: 28 Jan 2021 01:33:04.4358 (UTC) X-MS-Exchange-CrossTenant-Network-Message-Id: ef48cbfd-b43c-4685-5d2c-08d8c32ca880 X-MS-Exchange-CrossTenant-Id: bea78b3c-4cdb-4130-854a-1d193232e5f4 X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=bea78b3c-4cdb-4130-854a-1d193232e5f4; Ip=[66.129.239.12]; Helo=[P-EXFEND-EQX-01.jnpr.net] X-MS-Exchange-CrossTenant-AuthSource: BN8NAM12FT005.eop-nam12.prod.protection.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Anonymous X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem X-MS-Exchange-Transport-CrossTenantHeadersStamped: SN6PR05MB5215 X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-27_10:2021-01-27, 2021-01-27 signatures=0 X-Proofpoint-Spam-Details: rule=outbound_spam_notspam policy=outbound_spam score=0 priorityscore=1501 malwarescore=0 suspectscore=0 phishscore=0 impostorscore=0 adultscore=0 clxscore=1011 mlxlogscore=999 lowpriorityscore=0 spamscore=0 mlxscore=0 bulkscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2009150000 definitions=main-2101280005 X-Rspamd-Queue-Id: 4DR2zV0Fglz3tcm X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.10 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RBL_DBL_DONT_QUERY_IPS(0.00)[208.84.65.16:from]; R_DKIM_ALLOW(-0.20)[juniper.net:s=PPS1017,juniper.net:s=selector1]; FREEFALL_USER(0.00)[sjg]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:208.84.65.16]; MIME_GOOD(-0.10)[text/plain]; NEURAL_HAM_LONG(-1.00)[-1.000]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; SPAMHAUS_ZRD(0.00)[208.84.65.16:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[juniper.net:+]; DMARC_POLICY_ALLOW(-0.50)[juniper.net,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[yahoo.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:26211, ipnet:208.84.65.0/24, country:US]; RCVD_COUNT_SEVEN(0.00)[11]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_IN_DNSWL_LOW(-0.10)[208.84.65.16:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 01:33:11 -0000 Mark Millard via freebsd-current wrote: > >> Given an already built, installed and booted system version, I've > >> noted a big difference for META_MODE in 2 rebuild contexts (no > >> source updates involved): > >> > >> *) Prior buildworld buildkernel, installkernel, installworld, boot > >> presumed before (A) and before (B) below. Yes installworld is going to cause problems unless you tell meta mode to ignore everything outside of the src/obj tree. But even that isn't enough as you note below. > >> So I used make -dM for the commented buildworld buildkernel lines, lo= gging > >> the build output and later diff'ing them. > >> > >> Result that I noticed? Lots of lines uniquely from (B)'s case, ending= with > >> one of: > >> > >> file '/usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tm= p/legacy/usr/sbin/awk' is newer than the target... Yes. That would be expected. I think Bryan added some knobs to mitigate some of this. grep -n META.*IGNORE share/mk/*mk might be instructive. > >> Many/most/all(?) of these seem to me to be unlikely to actually need = to > >> contribute to what needs to be rebuilt (just based on being newer). S= o > >> the option to ignore (some of?) them could be useful in making META_M= ODE > >> builds quicker. Yes on all counts. That's why bmake provides a number of knobs to ignore such things. They are listed in the man page in increasing order of expense. One of the risks of the sort of introspection meta mode does, is delving too deep (like the dwarfs ;-) The .MAKE.META.IGNORE_* and .MAKE.META.BAILIWICK variables help to contain the potential insanity. > > The following from one of the .meta files makes the point that rm use > > in the example is unlikely to be important to needing to rebuild, > > despite it actually causing a file rebuild. Nor is the specific echo > > command listed relevant. Only the "ar" command is: > > > > # Meta data file /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd6= 4.amd64/lib/libc++/libc++.a.meta > > CMD @echo building static c++ library > > CMD @rm -f libc++.a > > CMD ar -crsD libc++.a algorithm.o any.o atomic.o barrier.o bind.o > > -- filemon acquired metadata -- > > # filemon version 5 > > # Target pid 22471 > > # Start 1611359217.214996 > > V 5 > > E 22961 /bin/sh > > R 22961 /etc/libmap.conf > > R 22961 /var/run/ld-elf.so.hints > > R 22961 /lib/libedit.so.7 > > R 22961 /lib/libc.so.7 > > R 22961 /lib/libncursesw.so.9 > > R 22961 /usr/share/locale/C.UTF-8/LC_CTYPE > > F 22961 22962 > > E 22962 /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/t= mp/legacy/usr/sbin/rm > > The timestamp on . . ./tmp/legacy/usr/sbin/rm is not > > actually relevant to if libc++.a needs to be rebuilt. True. = If there is nothing under .../tmp/legacy that should be counted you can just: .MAKE.META_IGNORE_PATHS +=3D that path which would be the cheapest option. If however there are things that should be considered you'd have to use a much more specific list of .MAKE.META_IGNORE_PATHS or perhaps something like: .MAKE.META.IGNORE_PATTERNS +=3D */rm would ignore an rm binary regardless of where found. worst case you might need something like: # realpath .MAKE.META.IGNORE_FILTER +=3D tA # ignore anything here .MAKE.META.IGNORE_FILTER +=3D N*/tmp/legacy/usr/bin/* Unlike .MAKE.META.IGNORE_PATTERNS which is a list of patterns to match the goal with .MAKE.META.IGNORE_FILTER is to reduced to an empty string paths to be ignored. > > Of course, the structure also point out the judgment > > is specific to understanding the sequence of CMD's > > listed above. Only a hack of ignoring, not recording, > > or commenting out the filemon lines ending in > > /tmp/legacy/usr/sbin/rm would seem to avoid the @rm > > handling issue. Such might well have its own risks. No hacking needed, there are a range of knobs to help. > Just for reference for more about the sequencing involved: > = > Looks like in my example various . . ./tmp/legacy/. . ./*bin/ > actually are links to files in: > = > /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src/amd64.amd64/tmp/legacy/= bin/ > = > and the later after-install buildworld "Rebuilding the > temporary build tree" step leads to the updated dates for > files in that area, updated via the code that reports: > = > Linking host tools into /usr/obj/amd64_clang/amd64.amd64/usr/fbsd/mm-src= /amd64.amd64/tmp/legacy/bin > > So the prior installworld leaves updated dates and the > linking to those installed files makes > . . ./tmp/legacy/. . ./*bin/* have the newer dates show > up for the legacy paths as well. > = > In turn the dependency tracking via META_MODE uses the new > dates on . . ./tmp/legacy/. . ./*bin/* files to cause > rebuilds of more materials than if installworld had not > been done. > = > It is not obvious if Bryan D. would find the effort to avoid > this worthwhile for the contexts that drive FreeBSD's build > environment choices. For people that use installworld and also want META_MODE it would seem some additional IGNORE work may be beneficial. --sjg From owner-freebsd-current@freebsd.org Thu Jan 28 07:33:57 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 92E6D4FAE5A for ; Thu, 28 Jan 2021 07:33:57 +0000 (UTC) (envelope-from tsoome@me.com) Received: from pv50p00im-tydg10021701.me.com (pv50p00im-tydg10021701.me.com [17.58.6.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRBzn3CTGz4jW4 for ; Thu, 28 Jan 2021 07:33:57 +0000 (UTC) (envelope-from tsoome@me.com) Received: from nazgul.lan (148-52-235-80.sta.estpak.ee [80.235.52.148]) by pv50p00im-tydg10021701.me.com (Postfix) with ESMTPSA id 0A1938407AE; Thu, 28 Jan 2021 07:33:54 +0000 (UTC) From: Toomas Soome Message-Id: Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: vidcontrol < /dev/console -i active ioctl error Date: Thu, 28 Jan 2021 09:33:52 +0200 In-Reply-To: Cc: freebsd-current@freebsd.org To: Jesper Schmitz Mouridsen References: X-Mailer: Apple Mail (2.3654.40.0.2.32) X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2021-01-28_02:2021-01-27, 2021-01-28 signatures=0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 malwarescore=0 phishscore=0 bulkscore=0 spamscore=0 clxscore=1011 mlxscore=0 mlxlogscore=999 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.0.1-2006250000 definitions=main-2101280036 X-Rspamd-Queue-Id: 4DRBzn3CTGz4jW4 X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 07:33:57 -0000 > On 28. Jan 2021, at 01:35, Jesper Schmitz Mouridsen = wrote: >=20 > FreeBSD build.freebsd.lan 13.0-ALPHA1 FreeBSD 13.0-ALPHA1 #0 = main-c255938-g7ae27c2d6c4: Thu Jan 14 06:29:55 UTC 2021 = root@releng1.nyi.freebsd.org:/usr/obj/usr/src/amd64.amd64/sys/GENERIC = amd64 > jesper@build:~ $ su > Password: > root@build:~ # vidcontrol < /dev/console -i active > vidcontrol: getting active vty: Inappropriate ioctl for device >=20 > build is virtualized in bhyve, it happens as well on my pinebook pro. >=20 > This is annoying to sysutils/consolekit2 >=20 > on 12.2 it works (not tested on same HW) >=20 it should work for local console: root@freebsd:/usr/src # vidcontrol -i active < /dev/console 1 may it be your =E2=80=9Cprimary=E2=80=9D is actually serial console? rgds, toomas From owner-freebsd-current@freebsd.org Thu Jan 28 11:41:57 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DDAF6521B70 for ; Thu, 28 Jan 2021 11:41:57 +0000 (UTC) (envelope-from jsm@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRJTx61j2z3FgV; Thu, 28 Jan 2021 11:41:57 +0000 (UTC) (envelope-from jsm@FreeBSD.org) Received: from freebsd2.freebsd.lan (mail.northatlanticmusicsupplies.com [212.237.182.202]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) (Authenticated sender: jsm) by smtp.freebsd.org (Postfix) with ESMTPSA id 5BC5B2FCB0; Thu, 28 Jan 2021 11:41:57 +0000 (UTC) (envelope-from jsm@FreeBSD.org) Subject: Re: vidcontrol < /dev/console -i active ioctl error To: Toomas Soome Cc: freebsd-current@freebsd.org References: From: Jesper Schmitz Mouridsen Message-ID: <7c9aad3d-99fe-860c-3c6f-22086cb31bd1@FreeBSD.org> Date: Thu, 28 Jan 2021 12:41:42 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Language: en-US Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 11:41:57 -0000 On 28.01.2021 08.33, Toomas Soome wrote: > > >> On 28. Jan 2021, at 01:35, Jesper Schmitz Mouridsen > > wrote: >> >> FreeBSD build.freebsd.lan 13.0-ALPHA1 FreeBSD 13.0-ALPHA1 #0 >> main-c255938-g7ae27c2d6c4: Thu Jan 14 06:29:55 UTC 2021 >> root@releng1.nyi.freebsd.org >> :/usr/obj/usr/src/amd64.amd64/sys/GENERIC >> amd64 >> jesper@build:~ $ su >> Password: >> root@build:~ # vidcontrol < /dev/console -i active >> vidcontrol: getting active vty: Inappropriate ioctl for device >> >> build is virtualized in bhyve, it happens as well on my pinebook pro. >> >> This is annoying to sysutils/consolekit2 >> >> on 12.2 it works (not tested on same HW) >> > > it should work for local console: > > root@freebsd:/usr/src #vidcontrol -i active < /dev/console > 1 > > may it be your “primary” is actually serial console? > > rgds, > toomas > Oh that makes sense, I added console="vidconsole,comconsole" to my /boot/loader.conf on the Pinebook Pro and consolekit2 works. Thanks /Jsm From owner-freebsd-current@freebsd.org Thu Jan 28 13:03:26 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8CC06524C87; Thu, 28 Jan 2021 13:03:26 +0000 (UTC) (envelope-from ronald-lists@klop.ws) Received: from smarthost1.greenhost.nl (smarthost1.greenhost.nl [195.190.28.88]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRLHx2KnBz3Lkp; Thu, 28 Jan 2021 13:03:24 +0000 (UTC) (envelope-from ronald-lists@klop.ws) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=klop.ws; s=mail; h=In-Reply-To:Message-ID:From:Content-Transfer-Encoding:MIME-Version: Date:References:Subject:To:Content-Type:Sender:Reply-To:Cc:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:List-Id:List-Help:List-Unsubscribe:List-Subscribe: List-Post:List-Owner:List-Archive; bh=ZAqg86u4qneEFrvfKpMnDysGq1aKJ/pkoSR0TtzjUd0=; b=lPAkgnd5c4RPVTEGD+wvx16K76 nkLQXeEjNi1Qsd4yG520K0bilF+A2xnvArTY+akUgffs5vBZ0Hm6KlfSYAumh6UNDOxfBzaGXqmuj Yvg6LpZuhrm2obVdOSdYAUt5XFHuJUZ5j3axQpAgip0++58tXVXlj6jHXPEY+A7rolsY=; Content-Type: text/plain; charset=iso-8859-15; format=flowed; delsp=yes To: freebsd-stable@freebsd.org, freebsd-current@freebsd.org, "Thomas Legg" Subject: Re: Poudriere failed to build pkg in 13-stable jail under 12-stable References: Date: Thu, 28 Jan 2021 14:03:00 +0100 MIME-Version: 1.0 Content-Transfer-Encoding: 7bit From: "Ronald Klop" Message-ID: In-Reply-To: User-Agent: Opera Mail/1.0 (Win32) X-Authenticated-As-Hash: bdb49c4ff80bd276e321aade33e76e02752072e2 X-Virus-Scanned: by clamav at smarthost1.greenhost.nl X-Scan-Signature: 4b95630a2805109a2fafe329e7ec4fd6 X-Rspamd-Queue-Id: 4DRLHx2KnBz3Lkp X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=klop.ws header.s=mail header.b=lPAkgnd5; dmarc=pass (policy=none) header.from=klop.ws; spf=pass (mx1.freebsd.org: domain of ronald-lists@klop.ws designates 195.190.28.88 as permitted sender) smtp.mailfrom=ronald-lists@klop.ws X-Spamd-Result: default: False [-3.50 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[195.190.28.88:from]; R_DKIM_ALLOW(-0.20)[klop.ws:s=mail]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:195.190.28.64/27]; MIME_GOOD(-0.10)[text/plain]; NEURAL_HAM_LONG(-1.00)[-1.000]; RWL_MAILSPIKE_GOOD(0.00)[195.190.28.88:from]; SPAMHAUS_ZRD(0.00)[195.190.28.88:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[klop.ws:+]; DMARC_POLICY_ALLOW(-0.50)[klop.ws,none]; RCVD_IN_DNSWL_NONE(0.00)[195.190.28.88:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[freebsd.org,gmail.com]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; MID_RHS_NOT_FQDN(0.50)[]; ASN(0.00)[asn:47172, ipnet:195.190.28.0/24, country:NL]; MAILMAN_DEST(0.00)[freebsd-stable,freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 13:03:26 -0000 On Mon, 25 Jan 2021 05:46:43 +0100, Thomas Legg wrote: > The build of a 13-stable source and kernel were a success under 12-stable > (though with some issues on freeze-ups and hard reboots that I suspect > might be related to the bufdaemon issue and my 0x15 gen AMD cpu). > > Created a 13-stable poudriere jail with the knowledge that there may be > issues with builds under a 12-stable r369076 kernel. I didn't expect this > failure on packaging pkg. > > ====> Compressing man pages (compress-man) > ===> Installing ldconfig configuration file > =========================================================================== > ======================= >============================ > ===> Building package for pkg-1.16.2 > cp: /wrkdirs/usr/ports/ports-mgmt/pkg/work/pkg/pkg-1.16.2.txz: Function > not > implemented > *** Error code 1 cp in 13-stable uses the system call copy_file_range which is not in the 12-stable kernel. In general running newer code (13) on older kernel (12) is unsupported. Version 12 is not forwards compatible. Regards, Ronald. > > Stop. > make[1]: stopped in /usr/ports/ports-mgmt/pkg > *** Error code 1 > > Stop. > make: stopped in /usr/ports/ports-mgmt/pkg > =>> Cleaning up wrkdir > ===> Cleaning for pkg-1.16.2 > build of ports-mgmt/pkg | pkg-1.16.2 ended at Mon Jan 25 12:16:12 HKT > 2021 > build time: 00:02:01 > !!! build failure encountered !!! > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to > "freebsd-current-unsubscribe@freebsd.org" From owner-freebsd-current@freebsd.org Thu Jan 28 19:00:36 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D257F4E70F2; Thu, 28 Jan 2021 19:00:36 +0000 (UTC) (envelope-from pi@freebsd.org) Received: from home.opsec.eu (home.opsec.eu [IPv6:2001:14f8:200::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRVD44C43z4WT3; Thu, 28 Jan 2021 19:00:36 +0000 (UTC) (envelope-from pi@freebsd.org) Received: from pi by home.opsec.eu with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1l5CWm-000HFo-Ux; Thu, 28 Jan 2021 20:00:24 +0100 Date: Thu, 28 Jan 2021 20:00:24 +0100 From: Kurt Jaeger To: freebsd-current@freebsd.org, freebsd-fs@freebsd.org Subject: zpool upgrade to draid feature: does it require updated zfs boot code ? Message-ID: MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline X-Rspamd-Queue-Id: 4DRVD44C43z4WT3 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; ASN(0.00)[asn:12502, ipnet:2001:14f8::/32, country:DE]; local_wl_from(0.00)[freebsd.org] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 19:00:36 -0000 Hi! Short question: Does a zpool upgrade on 14.0 (current) for the draid feature require a boot code update ? Long version of the same question: I've upgraded my testbox to FreeBSD 14.0-CURRENT #0 main-c256294-g2cf84258922f and the system listed the zfs-feature draid as available if I do an zpool upgrade. The pool resides on two nvme drives: mirror-0 ONLINE 0 0 0 nvd0p4 ONLINE 0 0 0 nvd1p4 ONLINE 0 0 0 Normally, when I do the zpool upgrade for the pool, and the zpool upgrade also requires an upgrade to the bootcode, some message is displayed, reminding me to do so. With the draid update, no message was displayed. Does it require the bootcode update anyway or, if not, why not ? gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 1 nvd0 gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 1 nvd1 -- pi@opsec.eu +49 171 3101372 Now what ? From owner-freebsd-current@freebsd.org Thu Jan 28 19:15:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8DDC94E7DB7; Thu, 28 Jan 2021 19:15:23 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRVY64sBYz4Xdf; Thu, 28 Jan 2021 19:15:22 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10SJFAK5096614 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Thu, 28 Jan 2021 11:15:10 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10SJFAk4096613; Thu, 28 Jan 2021 11:15:10 -0800 (PST) (envelope-from sgk) Date: Thu, 28 Jan 2021 11:15:10 -0800 From: Steve Kargl To: freebsd-x11@freebsd.org, freebsd-current@freebsd.org Subject: i915kms and chip resets on rsc0? Message-ID: <20210128191510.GA96585@troutmask.apl.washington.edu> References: <20200710192736.GA69592@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20200710192736.GA69592@troutmask.apl.washington.edu> X-Rspamd-Queue-Id: 4DRVY64sBYz4Xdf X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-2.00 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM,none]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-x11,freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 19:15:23 -0000 All, I have finally gotten my old laptop somewhat back to it 2 Dec 2020 working state. The kernel/world/drm-current-kmod from 2 Dec 2020 worked wonderfully. Sadly, the two week recover from a failed update has one final hurdle. With nearly top-of-tree src/ and ports/ % cd /usr/src % git log | more commit 0e01ea872ee475d7aef11d21588504e2ef4eb32c Author: Cy Schubert Date: Wed Jan 27 21:52:08 2021 -0800 % pkg info | grep kmod drm-current-kmod-5.4.62.g20210128 DRM modules for the linuxkpi-based KMS components gpu-firmware-kmod-g20201213 Firmware modules for the linuxkpi-based KMS components when I start x11, the screen flickers for 15-30 seconds where apparently the i915kms modules is resetting the GPU. This is a new previously unseen behavior. Eventually, the X server comes up and I can my normal desktop. I've trimmed dmesg output to include info about the system. -- D 14.0-CURRENT #4 main-c256341-g0e01ea872ee-dirty: Wed Jan 27 17:11:57 PST 2021 root@mobile:/usr/obj/usr/src/i386.i386/sys/MOBILE i386 FreeBSD clang version 11.0.1 (git@github.com:llvm/llvm-project.git llvmorg-11.0.1-0-g43ff75f2c3fe) VT(vga): resolution 640x480 CPU: Intel(R) Core(TM)2 Duo CPU T7250 @ 2.00GHz (1995.04-MHz 686-class CPU) Origin="GenuineIntel" Id=0x6fd Family=0x6 Model=0xf Stepping=13 Features=0xbfebfbff Features2=0xe3bd AMD Features=0x20100000 AMD Features2=0x1 VT-x: (disabled in BIOS) HLT,PAUSE TSC: P-state invariant, performance statistics real memory = 4294967296 (4096 MB) avail memory = 4178866176 (3985 MB) vgapci0: port 0xeff8-0xefff mem 0xfea00000-0xfeafffff,0xe0000000-0xefffffff irq 16 at device 2.0 on pci0 agp0: on vgapci0 WARNING: Device "agp" is Giant locked and may be deleted before FreeBSD 13.0. agp0: aperture size is 256M, detected 7676k stolen memory vgapci0: Boot video device vgapci1: mem 0xfeb00000-0xfebfffff at device 2.1 on pci0 atkbdc0: port 0x60,0x64,0x62,0x66 irq 1 on acpi0 atkbd0: irq 1 on atkbdc0 kbd0 at atkbd0 atkbd0: [GIANT-LOCKED] psm0: irq 12 on atkbdc0 psm0: [GIANT-LOCKED] WARNING: Device "psm" is Giant locked and may be deleted before FreeBSD 13.0. psm0: model GlidePoint, device ID 0 orm0: at iomem 0xc0000-0xcefff,0xcf000-0xcffff pnpid ORM0000 on isa0 ugen4.2: at usbus4 ukbd0 on uhub2 ukbd0: on usbus4 kbd2 at ukbd0 ums0 on uhub2 ums0: on usbus4 ums0: 16 buttons and [XYZT] coordinates ID=2 uhid0 on uhub2 uhid0: on usbus4 drmn0: on vgapci0 vgapci0: child drmn0 requested pci_enable_io vgapci0: child drmn0 requested pci_enable_io [drm] Unable to create a private tmpfs mount, hugepage support will be disabled(-19). Successfully added WC MTRR for [0xe0000000-0xefffffff]: 0; [drm] Got stolen memory base 0x0, size 0x0 [drm] Supports vblank timestamp caching Rev 2 (21.10.2013). [drm] Driver supports precise vblank timestamp query. [drm] Connector LVDS-1: get mode from tunables: [drm] - kern.vt.fb.modes.LVDS-1 [drm] - kern.vt.fb.default_mode [drm] Connector VGA-1: get mode from tunables: [drm] - kern.vt.fb.modes.VGA-1 [drm] - kern.vt.fb.default_mode [drm] Connector DVI-D-1: get mode from tunables: [drm] - kern.vt.fb.modes.DVI-D-1 [drm] - kern.vt.fb.default_mode [drm] Connector SVIDEO-1: get mode from tunables: [drm] - kern.vt.fb.modes.SVIDEO-1 [drm] - kern.vt.fb.default_mode [drm] RC6 disabled, disabling runtime PM support [drm] Initialized overlay support. sysctl_warn_reuse: can't re-use a leaf (hw.dri.debug)! [drm] Initialized i915 1.6.0 20190822 for drmn0 on minor 0 WARNING: Device "fb" is Giant locked and may be deleted before FreeBSD 13.0. VT: Replacing driver "vga" with new "fb". start FB_INFO: type=11 height=1050 width=1400 depth=32 cmsize=16 size=5914624 pbase=0xe0020000 vbase=0x24e20000 name=drmn0 flags=0x0 stride=5632 bpp=32 cmap[0]=0 cmap[1]=7f0000 cmap[2]=7f00 cmap[3]=c4a000 end FB_INFO drmn0: fb0: i915drmfb frame buffer device drmn0: GPU HANG: ecode 4:1:0x8b9192dd, in MainThread [100156], hang on rcs0 drmn0: Resetting chip for hang on rcs0 drmn0: Resetting chip for hang on rcs0 drmn0: Resetting chip for hang on rcs0 drmn0: Resetting chip for hang on rcs0 drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) tun0: link state changed to UP drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: Resetting chip for hang on rcs0 Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) drmn0: GPU recovery timed out, cancelling all in-flight rendering. drmn0: Resetting chip for hang on rcs0 From owner-freebsd-current@freebsd.org Thu Jan 28 19:48:11 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DFBCA4EAFE2; Thu, 28 Jan 2021 19:48:11 +0000 (UTC) (envelope-from manu@bidouilliste.com) Received: from mx.blih.net (mx.blih.net [212.83.155.74]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx.blih.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRWGy6K5Xz4bnc; Thu, 28 Jan 2021 19:48:10 +0000 (UTC) (envelope-from manu@bidouilliste.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bidouilliste.com; s=mx; t=1611863287; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=2NuGkNhKO3acsG6JaFSQ8W+pCD5pKQi9OukL2db6YgU=; b=AeIwpLBrxfEgKfSl0x5Vh4u2ig7tHml0E889wTyxRCgT6xwrWa0oynQH01CyUc2IFrANdJ +LXE03UgOROO5NNtBC4vSMhjOaq0+AD0/S68u5u2xsXz4Xj36pfyzr2NZNwrbAjW2afb9L hzvu+Ppn2nKJ/sb+UP8L2DbpGf/rB3Y= Received: from amy.home (lfbn-idf2-1-745-114.w86-247.abo.wanadoo.fr [86.247.192.114]) by mx.blih.net (OpenSMTPD) with ESMTPSA id 302f3c71 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Thu, 28 Jan 2021 19:48:07 +0000 (UTC) Date: Thu, 28 Jan 2021 20:48:06 +0100 From: Emmanuel Vadot To: Steve Kargl Cc: freebsd-x11@freebsd.org, freebsd-current@freebsd.org Subject: Re: i915kms and chip resets on rsc0? Message-Id: <20210128204806.77d1e676a592ec638a82d5be@bidouilliste.com> In-Reply-To: <20210128191510.GA96585@troutmask.apl.washington.edu> References: <20200710192736.GA69592@troutmask.apl.washington.edu> <20210128191510.GA96585@troutmask.apl.washington.edu> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DRWGy6K5Xz4bnc X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bidouilliste.com header.s=mx header.b=AeIwpLBr; dmarc=pass (policy=none) header.from=bidouilliste.com; spf=pass (mx1.freebsd.org: domain of manu@bidouilliste.com designates 212.83.155.74 as permitted sender) smtp.mailfrom=manu@bidouilliste.com X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+mx]; DKIM_TRACE(0.00)[bidouilliste.com:+]; DMARC_POLICY_ALLOW(-0.50)[bidouilliste.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.83.155.74:from]; ASN(0.00)[asn:12876, ipnet:212.83.128.0/19, country:FR]; MID_RHS_MATCH_FROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[bidouilliste.com:s=mx]; FREEFALL_USER(0.00)[manu]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[212.83.155.74:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current,freebsd-x11] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 19:48:11 -0000 On Thu, 28 Jan 2021 11:15:10 -0800 Steve Kargl wrote: > All, > > I have finally gotten my old laptop somewhat back to it > 2 Dec 2020 working state. The kernel/world/drm-current-kmod > from 2 Dec 2020 worked wonderfully. Sadly, the two week > recover from a failed update has one final hurdle. > > With nearly top-of-tree src/ and ports/ > > % cd /usr/src > % git log | more > commit 0e01ea872ee475d7aef11d21588504e2ef4eb32c > Author: Cy Schubert > Date: Wed Jan 27 21:52:08 2021 -0800 > > % pkg info | grep kmod > drm-current-kmod-5.4.62.g20210128 DRM modules for the linuxkpi-based KMS components > gpu-firmware-kmod-g20201213 Firmware modules for the linuxkpi-based KMS components > > when I start x11, the screen flickers for 15-30 seconds > where apparently the i915kms modules is resetting the > GPU. This is a new previously unseen behavior. Eventually, > the X server comes up and I can my normal desktop. I've > trimmed dmesg output to include info about the system. > > > -- > D 14.0-CURRENT #4 main-c256341-g0e01ea872ee-dirty: Wed Jan 27 17:11:57 PST 2021 > root@mobile:/usr/obj/usr/src/i386.i386/sys/MOBILE i386 > FreeBSD clang version 11.0.1 (git@github.com:llvm/llvm-project.git llvmorg-11.0.1-0-g43ff75f2c3fe) > VT(vga): resolution 640x480 > CPU: Intel(R) Core(TM)2 Duo CPU T7250 @ 2.00GHz (1995.04-MHz 686-class CPU) > Origin="GenuineIntel" Id=0x6fd Family=0x6 Model=0xf Stepping=13 > Features=0xbfebfbff > Features2=0xe3bd > AMD Features=0x20100000 > AMD Features2=0x1 > VT-x: (disabled in BIOS) HLT,PAUSE > TSC: P-state invariant, performance statistics > real memory = 4294967296 (4096 MB) > avail memory = 4178866176 (3985 MB) > > > vgapci0: port 0xeff8-0xefff mem 0xfea00000-0xfeafffff,0xe0000000-0xefffffff irq 16 at device 2.0 on pci0 > agp0: on vgapci0 > WARNING: Device "agp" is Giant locked and may be deleted before FreeBSD 13.0. > agp0: aperture size is 256M, detected 7676k stolen memory > vgapci0: Boot video device > vgapci1: mem 0xfeb00000-0xfebfffff at device 2.1 on pci0 > > atkbdc0: port 0x60,0x64,0x62,0x66 irq 1 on acpi0 > atkbd0: irq 1 on atkbdc0 > kbd0 at atkbd0 > atkbd0: [GIANT-LOCKED] > psm0: irq 12 on atkbdc0 > psm0: [GIANT-LOCKED] > WARNING: Device "psm" is Giant locked and may be deleted before FreeBSD 13.0. > psm0: model GlidePoint, device ID 0 > orm0: at iomem 0xc0000-0xcefff,0xcf000-0xcffff pnpid ORM0000 on isa0 > > > ugen4.2: at usbus4 > ukbd0 on uhub2 > ukbd0: on usbus4 > kbd2 at ukbd0 > ums0 on uhub2 > ums0: on usbus4 > ums0: 16 buttons and [XYZT] coordinates ID=2 > uhid0 on uhub2 > uhid0: on usbus4 > drmn0: on vgapci0 > vgapci0: child drmn0 requested pci_enable_io > vgapci0: child drmn0 requested pci_enable_io > [drm] Unable to create a private tmpfs mount, hugepage support will be disabled(-19). > Successfully added WC MTRR for [0xe0000000-0xefffffff]: 0; > [drm] Got stolen memory base 0x0, size 0x0 > [drm] Supports vblank timestamp caching Rev 2 (21.10.2013). > [drm] Driver supports precise vblank timestamp query. > [drm] Connector LVDS-1: get mode from tunables: > [drm] - kern.vt.fb.modes.LVDS-1 > [drm] - kern.vt.fb.default_mode > [drm] Connector VGA-1: get mode from tunables: > [drm] - kern.vt.fb.modes.VGA-1 > [drm] - kern.vt.fb.default_mode > [drm] Connector DVI-D-1: get mode from tunables: > [drm] - kern.vt.fb.modes.DVI-D-1 > [drm] - kern.vt.fb.default_mode > [drm] Connector SVIDEO-1: get mode from tunables: > [drm] - kern.vt.fb.modes.SVIDEO-1 > [drm] - kern.vt.fb.default_mode > [drm] RC6 disabled, disabling runtime PM support > [drm] Initialized overlay support. > sysctl_warn_reuse: can't re-use a leaf (hw.dri.debug)! > [drm] Initialized i915 1.6.0 20190822 for drmn0 on minor 0 > WARNING: Device "fb" is Giant locked and may be deleted before FreeBSD 13.0. > VT: Replacing driver "vga" with new "fb". > start FB_INFO: > type=11 height=1050 width=1400 depth=32 > cmsize=16 size=5914624 > pbase=0xe0020000 vbase=0x24e20000 > name=drmn0 flags=0x0 stride=5632 bpp=32 > cmap[0]=0 cmap[1]=7f0000 cmap[2]=7f00 cmap[3]=c4a000 > end FB_INFO > drmn0: fb0: i915drmfb frame buffer device > drmn0: GPU HANG: ecode 4:1:0x8b9192dd, in MainThread [100156], hang on rcs0 > drmn0: Resetting chip for hang on rcs0 > drmn0: Resetting chip for hang on rcs0 > drmn0: Resetting chip for hang on rcs0 > drmn0: Resetting chip for hang on rcs0 > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > tun0: link state changed to UP > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: Resetting chip for hang on rcs0 > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > drmn0: GPU recovery timed out, cancelling all in-flight rendering. > drmn0: Resetting chip for hang on rcs0 > > > > _______________________________________________ > freebsd-x11@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-x11 > To unsubscribe, send any mail to "freebsd-x11-unsubscribe@freebsd.org" Does 5.4.62.g20210118 works ? If so I suggest you clone the 5.4-lts branch from https://github.com/freebsd/drm-kmod/ and bisect between tags drm_v5.4.62_9 and drm_v5.4.92_1. Cheers, -- Emmanuel Vadot From owner-freebsd-current@freebsd.org Thu Jan 28 20:03:04 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0ABDE4EBB66; Thu, 28 Jan 2021 20:03:04 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRWc703qrz4d82; Thu, 28 Jan 2021 20:03:02 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10SK2tH9096971 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Thu, 28 Jan 2021 12:02:55 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10SK2tVk096970; Thu, 28 Jan 2021 12:02:55 -0800 (PST) (envelope-from sgk) Date: Thu, 28 Jan 2021 12:02:55 -0800 From: Steve Kargl To: Emmanuel Vadot Cc: freebsd-x11@freebsd.org, freebsd-current@freebsd.org Subject: Re: i915kms and chip resets on rsc0? Message-ID: <20210128200255.GA96914@troutmask.apl.washington.edu> References: <20200710192736.GA69592@troutmask.apl.washington.edu> <20210128191510.GA96585@troutmask.apl.washington.edu> <20210128204806.77d1e676a592ec638a82d5be@bidouilliste.com> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20210128204806.77d1e676a592ec638a82d5be@bidouilliste.com> X-Rspamd-Queue-Id: 4DRWc703qrz4d82 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-2.00 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; MAILMAN_DEST(0.00)[freebsd-x11,freebsd-current]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM, none] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 20:03:04 -0000 On Thu, Jan 28, 2021 at 08:48:06PM +0100, Emmanuel Vadot wrote: > On Thu, 28 Jan 2021 11:15:10 -0800 > Steve Kargl wrote: > > > All, > > > > I have finally gotten my old laptop somewhat back to it > > 2 Dec 2020 working state. The kernel/world/drm-current-kmod > > from 2 Dec 2020 worked wonderfully. Sadly, the two week > > recover from a failed update has one final hurdle. > > > > With nearly top-of-tree src/ and ports/ > > > > % cd /usr/src > > % git log | more > > commit 0e01ea872ee475d7aef11d21588504e2ef4eb32c > > Author: Cy Schubert > > Date: Wed Jan 27 21:52:08 2021 -0800 > > > > % pkg info | grep kmod > > drm-current-kmod-5.4.62.g20210128 DRM modules for the linuxkpi-based KMS components > > gpu-firmware-kmod-g20201213 Firmware modules for the linuxkpi-based KMS components > > (snip) > > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > > drmn0: GPU recovery timed out, cancelling all in-flight rendering. > > drmn0: Resetting chip for hang on rcs0 > > > > Does 5.4.62.g20210118 works ? It works to the extent that the X server loads and the fvwm2 window manager comes up with my normal desktop. In fact, I'm typing this in a xterm at that moment. What I don't know is if the X server is ignoring the GPU. It is unclear to me if the last "drmn0: Resetting chip for hang on rcs0" is disabling some functionality. xwininfo reports % xwininfo xwininfo: Window id: 0xef (the root window) (has no name) Absolute upper-left X: 0 Absolute upper-left Y: 0 Relative upper-left X: 0 Relative upper-left Y: 0 Width: 1400 Height: 1050 Depth: 24 Visual: 0x21 Visual Class: TrueColor Border width: 0 Class: InputOutput Colormap: 0x20 (installed) Bit Gravity State: ForgetGravity Window Gravity State: NorthWestGravity Backing Store State: NotUseful Save Under State: no Map State: IsViewable Override Redirect State: no Corners: +0+0 -0+0 -0-0 +0-0 -geometry 1400x1050+0+0 which looks like what I expect for 'startx -- -depth 24'. -- Steve From owner-freebsd-current@freebsd.org Thu Jan 28 20:22:16 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 57B6F4EC90D; Thu, 28 Jan 2021 20:22:16 +0000 (UTC) (envelope-from manu@bidouilliste.com) Received: from mx.blih.net (mx.blih.net [212.83.155.74]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx.blih.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRX2H2ZtVz4fWB; Thu, 28 Jan 2021 20:22:14 +0000 (UTC) (envelope-from manu@bidouilliste.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bidouilliste.com; s=mx; t=1611865333; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=wyCDmrBDlFFbyeHPfSYk1xwTNw66JFEZzifB7RzUI5k=; b=tW6ujBNaK/xnzChJQQpc1ffWXL3RIBjy+9jjZftYuu554vlKJSa27n4TC19awrmksrCIki V559JCDfhy7pVsSWtQLTnzoLhdgAEVXOGIKLNcgrUW8NBYGzjrSmMjpdFf1RNA5KIJCvBj 7VokIFfHK3rdEaQ71cTf70rdLjnsP+Q= Received: from amy.home (lfbn-idf2-1-745-114.w86-247.abo.wanadoo.fr [86.247.192.114]) by mx.blih.net (OpenSMTPD) with ESMTPSA id 593170ae (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Thu, 28 Jan 2021 20:22:13 +0000 (UTC) Date: Thu, 28 Jan 2021 21:22:13 +0100 From: Emmanuel Vadot To: Steve Kargl Cc: freebsd-x11@freebsd.org, freebsd-current@freebsd.org Subject: Re: i915kms and chip resets on rsc0? Message-Id: <20210128212213.a7e14bc4b469c745b522ea0a@bidouilliste.com> In-Reply-To: <20210128200255.GA96914@troutmask.apl.washington.edu> References: <20200710192736.GA69592@troutmask.apl.washington.edu> <20210128191510.GA96585@troutmask.apl.washington.edu> <20210128204806.77d1e676a592ec638a82d5be@bidouilliste.com> <20210128200255.GA96914@troutmask.apl.washington.edu> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DRX2H2ZtVz4fWB X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bidouilliste.com header.s=mx header.b=tW6ujBNa; dmarc=pass (policy=none) header.from=bidouilliste.com; spf=pass (mx1.freebsd.org: domain of manu@bidouilliste.com designates 212.83.155.74 as permitted sender) smtp.mailfrom=manu@bidouilliste.com X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx:c]; MV_CASE(0.50)[]; DKIM_TRACE(0.00)[bidouilliste.com:+]; DMARC_POLICY_ALLOW(-0.50)[bidouilliste.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.83.155.74:from]; ASN(0.00)[asn:12876, ipnet:212.83.128.0/19, country:FR]; MIME_TRACE(0.00)[0:+]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[bidouilliste.com:s=mx]; FREEFALL_USER(0.00)[manu]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[212.83.155.74:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current,freebsd-x11] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 20:22:16 -0000 On Thu, 28 Jan 2021 12:02:55 -0800 Steve Kargl wrote: > On Thu, Jan 28, 2021 at 08:48:06PM +0100, Emmanuel Vadot wrote: > > On Thu, 28 Jan 2021 11:15:10 -0800 > > Steve Kargl wrote: > > > > > All, > > > > > > I have finally gotten my old laptop somewhat back to it > > > 2 Dec 2020 working state. The kernel/world/drm-current-kmod > > > from 2 Dec 2020 worked wonderfully. Sadly, the two week > > > recover from a failed update has one final hurdle. > > > > > > With nearly top-of-tree src/ and ports/ > > > > > > % cd /usr/src > > > % git log | more > > > commit 0e01ea872ee475d7aef11d21588504e2ef4eb32c > > > Author: Cy Schubert > > > Date: Wed Jan 27 21:52:08 2021 -0800 > > > > > > % pkg info | grep kmod > > > drm-current-kmod-5.4.62.g20210128 DRM modules for the linuxkpi-based KMS components > > > gpu-firmware-kmod-g20201213 Firmware modules for the linuxkpi-based KMS components > > > > > (snip) > > > > Asynchronous wait on fence i915:Xorg[100156]:4 timed out (hint:0x24ad37f0S) > > > drmn0: GPU recovery timed out, cancelling all in-flight rendering. > > > drmn0: Resetting chip for hang on rcs0 > > > > > > > Does 5.4.62.g20210118 works ? > > It works to the extent that the X server loads and > the fvwm2 window manager comes up with my normal > desktop. In fact, I'm typing this in a xterm at > that moment. > > What I don't know is if the X server is ignoring the GPU. > It is unclear to me if the last "drmn0: Resetting chip > for hang on rcs0" is disabling some functionality. xwininfo > reports > > % xwininfo > > xwininfo: Window id: 0xef (the root window) (has no name) > > Absolute upper-left X: 0 > Absolute upper-left Y: 0 > Relative upper-left X: 0 > Relative upper-left Y: 0 > Width: 1400 > Height: 1050 > Depth: 24 > Visual: 0x21 > Visual Class: TrueColor > Border width: 0 > Class: InputOutput > Colormap: 0x20 (installed) > Bit Gravity State: ForgetGravity > Window Gravity State: NorthWestGravity > Backing Store State: NotUseful > Save Under State: no > Map State: IsViewable > Override Redirect State: no > Corners: +0+0 -0+0 -0-0 +0-0 > -geometry 1400x1050+0+0 > > which looks like what I expect for 'startx -- -depth 24'. > > -- > Steve No I meant does the previous version of the ports works or was it since today's update ? -- Emmanuel Vadot From owner-freebsd-current@freebsd.org Thu Jan 28 22:20:48 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 704654EEDC8; Thu, 28 Jan 2021 22:20:48 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (troutmask.apl.washington.edu [128.95.76.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "troutmask", Issuer "troutmask" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRZg3121Cz4mCX; Thu, 28 Jan 2021 22:20:46 +0000 (UTC) (envelope-from sgk@troutmask.apl.washington.edu) Received: from troutmask.apl.washington.edu (localhost [127.0.0.1]) by troutmask.apl.washington.edu (8.16.1/8.16.1) with ESMTPS id 10SMKeTG097716 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Thu, 28 Jan 2021 14:20:41 -0800 (PST) (envelope-from sgk@troutmask.apl.washington.edu) Received: (from sgk@localhost) by troutmask.apl.washington.edu (8.16.1/8.16.1/Submit) id 10SMKeDZ097715; Thu, 28 Jan 2021 14:20:40 -0800 (PST) (envelope-from sgk) Date: Thu, 28 Jan 2021 14:20:40 -0800 From: Steve Kargl To: Emmanuel Vadot Cc: freebsd-x11@freebsd.org, freebsd-current@freebsd.org Subject: Re: i915kms and chip resets on rsc0? Message-ID: <20210128222040.GA97667@troutmask.apl.washington.edu> References: <20200710192736.GA69592@troutmask.apl.washington.edu> <20210128191510.GA96585@troutmask.apl.washington.edu> <20210128204806.77d1e676a592ec638a82d5be@bidouilliste.com> <20210128200255.GA96914@troutmask.apl.washington.edu> <20210128212213.a7e14bc4b469c745b522ea0a@bidouilliste.com> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20210128212213.a7e14bc4b469c745b522ea0a@bidouilliste.com> X-Rspamd-Queue-Id: 4DRZg3121Cz4mCX X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=washington.edu (policy=none); spf=none (mx1.freebsd.org: domain of sgk@troutmask.apl.washington.edu has no SPF policy when checking 128.95.76.21) smtp.mailfrom=sgk@troutmask.apl.washington.edu X-Spamd-Result: default: False [-1.99 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.95.76.21:from]; SPAMHAUS_ZRD(0.00)[128.95.76.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.99)[-0.995]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:73, ipnet:128.95.0.0/16, country:US]; MAILMAN_DEST(0.00)[freebsd-x11,freebsd-current]; DMARC_POLICY_SOFTFAIL(0.10)[washington.edu : No valid SPF, No valid DKIM, none] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 22:20:48 -0000 On Thu, Jan 28, 2021 at 09:22:13PM +0100, Emmanuel Vadot wrote: > On Thu, 28 Jan 2021 12:02:55 -0800 > Steve Kargl wrote: > > > It works to the extent that the X server loads and > > the fvwm2 window manager comes up with my normal > > desktop. In fact, I'm typing this in a xterm at > > that moment. > > > > No I meant does the previous version of the ports works or was it > since today's update ? > I lost the information about which version of drm-current-kmod I had previouslu installed. The 2 Dec 2020 world/kernel/drm worked without an issue. Looking at 'svn log' on the Makefile for 'drm-current-kmod' shows 5.4.62.g20201003 for 2020-10-03 and an update to latest version on 2020-11-09 (but no version number info). So, I was likely running the 2020-11-09, and so that version did not have the chip reset message. The issue may be in the linuxkpi and not directly drm-current-kmod. I was hoping that by reporting 'chip reset on rcs0' would ring a bell for someone. This is all likely academic as I just saw John Baldwin's email that stated i386 support is being dropped in FreeBSD-current. I suppose my next update will move the laptop to amd64. -- Steve From owner-freebsd-current@freebsd.org Thu Jan 28 22:33:23 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id CDFC84EF37F for ; Thu, 28 Jan 2021 22:33:23 +0000 (UTC) (envelope-from nc@freebsd.org) Received: from rainpuddle.neelc.org (rainpuddle.neelc.org [66.42.69.219]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRZxb2yTBz4nNH; Thu, 28 Jan 2021 22:33:23 +0000 (UTC) (envelope-from nc@freebsd.org) Received: from mail.neelc.org (rainpuddle.neelc.org [IPv6:2001:19f0:8001:fed:5400:2ff:fe73:c622]) by rainpuddle.neelc.org (Postfix) with ESMTPSA id 81D9BEB2A5; Thu, 28 Jan 2021 14:33:14 -0800 (PST) MIME-Version: 1.0 Date: Thu, 28 Jan 2021 14:33:14 -0800 From: Neel Chauhan To: Mark Johnston Cc: Rick Macklem , Ronald Klop , freebsd-current@freebsd.org Subject: Re: Can In-Kernel TLS (kTLS) work with any OpenSSL Application? In-Reply-To: References: User-Agent: Roundcube Webmail/1.4.9 Message-ID: <4bc84eff95bbd6afbbafc13ce5bf32db@freebsd.org> X-Sender: nc@freebsd.org Content-Type: multipart/signed; protocol="application/pgp-signature"; boundary="=_3a35af549f137e51a3495c04c2b2e29a"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4DRZxb2yTBz4nNH X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; local_wl_from(0.00)[freebsd.org]; ASN(0.00)[asn:20473, ipnet:66.42.64.0/20, country:US] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 28 Jan 2021 22:33:23 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --=_3a35af549f137e51a3495c04c2b2e29a Content-Transfer-Encoding: 7bit Content-Type: text/plain; charset=US-ASCII; format=flowed Hi Mark, Thank you so much for your response describing how QAT encryption works. I learned that my server (HPE ProLiant ML110 Gen10) does not have QAT, mainly because the chipset (Intel C621) doesn't enable it. For reference, my firewall box (Intel D-1518-based HPE ProLiant EC200a) probably does, but I'm not going to use it for Tor. Tor uses 512-byte sized packets (a.k.a "cells") so even if I had QAT it may not work well, not to mention Tor is singlethreaded. I think I'll stick with kTLS with AESNI when 13.0-RELEASE is out. Worse case scenario I'll buy an AMD Ryzen-based PC and offload my Tor servers to it (assuming latest Ryzen > Skylake Xeon Scalable in single-thread performance). -Neel On 2021-01-27 11:04, Mark Johnston wrote: > On Sat, Jan 23, 2021 at 03:25:59PM +0000, Rick Macklem wrote: >> Ronald Klop wrote: >> >On Wed, 20 Jan 2021 21:21:15 +0100, Neel Chauhan wrote: >> > >> >> Hi freebsd-current@, >> >> >> >> I know that In-Kernel TLS was merged into the FreeBSD HEAD tree a while >> >> back. >> >> >> >> With 13.0-RELEASE around the corner, I'm thinking about upgrading my >> >> home server, well if I can accelerate any SSL application. >> >> >> >> I'm asking because I have a home server on a symmetrical Gigabit >> >> connection (Google Fiber/Webpass), and that server runs a Tor relay. If >> >> you're interested in how Tor works, the EFF has a writeup: >> >> https://www.eff.org/pages/what-tor-relay >> >> >> >> But the main point for you all is: more-or-less Tor relays deal with >> >> 1000s TLS connections going into and out of the server. >> >> >> >> Would In-Kernel TLS help with an application like Tor (or even load >> >> balancers/TLS termination), or is it more for things like web servers >> >> sending static files via sendfile() (e.g. CDN used by Netflix). >> >> >> >> My server could also work with Intel's QuickAssist (since it has an >> >> Intel Xeon "Scalable" CPU). Would QuickAssist SSL be more helpful here? >> There is now qat(4), which KTLS should be able to use, but I do >> not think it has been tested for this. I also have no idea >> if it can be used effectively for userland encryption? > > KTLS requires support for separate output buffers and AAD buffers, > which > I hadn't implemented in the committed driver. I have a working patch > which adds that, so when that's committed qat(4) could in principle be > used with KTLS. So far I only tested with /dev/crypto and a couple of > debug sysctls used to toggle between the different cryptop buffer > layouts, not with KTLS proper. > > qat(4) can be used by userspace via cryptodev(4). This comes with a > fair bit of overhead since it involves a round-trip through the kernel > and some extra copying. AFAIK we don't have any framework for exposing > crypto devices directly to userspace, akin to DPDK's polling mode > drivers or netmap. > > I've seen a few questions about the comparative (dis)advantages of QAT > and AES-NI so I'll sidetrack a bit and try to characterize qat(4)'s > performance here based on some microbenchmarking I did this week. This > was all done in the kernel and so might need some qualification if > you're interested in using qat(4) from userspace. Numbers below are > gleaned from an Atom C3558 at 2.2GHz with an integrated QAT device. I > mostly tested AES-CBC-256 and AES-GCM-256. > > The high-level tradeoffs are: > - qat(4) introduces a lot of latency. For a single synchronous > operation it can take between 2x and 100x more time than aesni(4) to > complete. aesni takes 1000-2000 cycles to handle a request plus > 3-5 cycles per byte depending on the algorithm. qat takes at least > ~150,000 cycles between calling crypto_dispatch() and the cryptop > completion callback, plus 5-8 cycles per byte. qat dispatch itself > is > quite cheap, typically 1000-2000 cycles depending on the size of the > buffer. Handling a completion interrupt involves a context switch to > the driver ithread but this is also a small cost relative to the > entire operation. So, for anything where latency is crucial QAT is > probably not a great bet. > - qat can save a correspondingly large number of CPU cycles. It takes > qat roughly twice as long as aesni to complete encryption of a 32KB > buffer using AES-CBC-256 (more with GCM), but with qat the CPU is > idle > much of the time. Dispatching the request to firmware takes less > than > 1% of the total time elapsed between request dispatch and completion, > even with small buffers. OTOH with really small buffers aesni can > complete a request in the time that it takes qat just to dispatch the > request to the device, so at best qat will give comparable throughput > and CPU usage and worse latency. > - qat can handle multiple requests in parallel. This can improve > throughput dramatically if the producer can keep qat busy. > Empirically, the maximum throughput improvement is a function of the > request size. For example, counting the number of cycles required to > encrypt 100,000 buffers using AES-GCM-256: > > max # in flight 1 16 64 128 > > aesni, 16B 206M n/a n/a n/a > aesni, 4KB 1.52B n/a n/a n/a > aesni, 32KB 10.8B n/a n/a n/a > qat, 16B 17.1B 1.11B 219M 184M > qat, 4KB 20.9B 1.68B 710M 694M > qat, 32KB 38.2B 8.37B 4.25B 4.23B > > As a side note, OpenCrypto supports async dispatch for software > crypto > drivers, in which crypto_dispatch() hands work off to other threads. > This is enabled by net.inet.ipsec.async_crypto, for example. Of > course, the maximum parallelism is limited by the number of CPUs in > the system, but this can improve throughput significantly as well if > you're willing to spend the corresponding CPU cycles. > > To summarize, QAT can be beneficial when some or all of the following > apply: > 1. You have large requests. qat can give comparable throughput for > small requests if the producer can exploit parallelism in qat, > though > OpenCrypto's backpressure mechanism is really primitive (arguably > non-existent) and performance will tank if things get to a point > where qat can't keep up. > 2. You're able to dispatch requests in parallel. But see point 1. > 3. CPU cycles are precious and the extra latency is tolerable. > 3b. aesni doesn't implement some transform that you care about, but qat > does. Some (most?) Xeons don't implement the SHA extensions for > instance. I don't have a sense for how the plain cryptosoft driver > performs relative to aesni though. > _______________________________________________ > freebsd-current@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-current > To unsubscribe, send any mail to > "freebsd-current-unsubscribe@freebsd.org" --=_3a35af549f137e51a3495c04c2b2e29a Content-Type: application/pgp-signature; name=signature.asc Content-Disposition: attachment; filename=signature.asc; size=488 Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQEzBAEBCAAdFiEEFpeUj+sDItoNIly9vzSRBRPfYX0FAmATO6oACgkQvzSRBRPf YX3OFQf/YKr0TYb93+TkAkp+yCeMXUABIi404bdx7k0EGyAj1NLeg9pGQgJoKTZV IIVytN9RoyyVsGYios7/mLgx6qYsp95PbbnYzvSco304DQS6ep2U1wkZB/bjRzq3 vepSaCU1sd7WxHERHVHa1bOHG5lHBpl9pn7zh1PdJX6NgiSCUNJH1ulrO03bq4Dq 6jrZFD5cBGg9ziNBWNG6UjCWPHqjRzXAKuchn4NWJrtOK9cpOLsO28Q/FXrikdHH L1+PGID8zwVhUjvnhIl75FOx2LUD3EEmjKR++k1cjf3nnHZ2+ImocAN+iEageQ5B kiJ5/EFvE5Uji/U8A793BT6QZ5KbgQ== =t1pO -----END PGP SIGNATURE----- --=_3a35af549f137e51a3495c04c2b2e29a-- From owner-freebsd-current@freebsd.org Fri Jan 29 04:44:34 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A52D74FC4DC for ; Fri, 29 Jan 2021 04:44:34 +0000 (UTC) (envelope-from joe@via.net) Received: from smtp4.via.net (smtp4.via.net [209.81.0.254]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "via.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRl9r73c7z3q1R for ; Fri, 29 Jan 2021 04:44:32 +0000 (UTC) (envelope-from joe@via.net) Received: from mail.via.net (mail.via.net [157.22.3.34]) by smtp4.via.net (8.15.2/8.14.1-VIANET) with ESMTPS id 10T4iVCQ020895 (version=TLSv1.2 cipher=DHE-RSA-AES256-GCM-SHA384 bits=256 verify=FAIL) for ; Thu, 28 Jan 2021 20:44:31 -0800 (PST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.97.3 at smtp4.via.net Received: from [209.81.2.65] ([209.81.2.65]) by mail.via.net (8.15.2/8.14.1-VIANET) with ESMTP id 10T4iUj2000825 for ; Thu, 28 Jan 2021 20:44:30 -0800 (PST) From: joe mcguckin Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.4\)) Subject: 12.2 installer crash Message-Id: <726AA409-926E-4DA3-886F-BAD5AB497B1D@via.net> Date: Thu, 28 Jan 2021 20:44:20 -0800 To: FreeBSD-Current X-Mailer: Apple Mail (2.3608.120.23.2.4) X-Greylist: Sender IP whitelisted, not delayed by milter-greylist-4.4.3 (smtp4.via.net [209.81.0.254]); Thu, 28 Jan 2021 20:44:31 -0800 (PST) X-Rspamd-Queue-Id: 4DRl9r73c7z3q1R X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of joe@via.net designates 209.81.0.254 as permitted sender) smtp.mailfrom=joe@via.net X-Spamd-Result: default: False [1.20 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_SPAM_SHORT(1.00)[1.000]; FREEFALL_USER(0.00)[joe]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[209.81.0.254:from]; MV_CASE(0.50)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[via.net]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[209.81.0.254:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[209.81.0.254:from]; R_SPF_ALLOW(-0.20)[+MX]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:7091, ipnet:209.81.0.0/18, country:US]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 Jan 2021 04:44:34 -0000 Supermicro X9DRI-LN4F+ motherboard 512G dram !2.2 DVD installer starts loading kernel then dies just after: mfisyspd0 1907456MB (3906469888 sectors) SYSPD volume (deviceid: 13) mfisyspd0: SYSPD volume attached mfi0: DJA NA XXX SYSPDIO Fatal trap 12: page fault while in kernel mode cpuid: 12 apic id: 0c fault virtual address: 0x0 fault code: sup read data. page not present (I can send a screenshot of the rest of the error data) Any ideas? Do I need to build a special kernel when using this much DRAM? Thanks, Joe Joe McGuckin ViaNet Communications joe@via.net 650-207-0372 cell 650-213-1302 office 650-969-2124 fax From owner-freebsd-current@freebsd.org Fri Jan 29 09:59:36 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 95A664E4CF2 for ; Fri, 29 Jan 2021 09:59:36 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from p-impout007.msg.pkvw.co.charter.net (p-impout007aa.msg.pkvw.co.charter.net [47.43.26.138]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRt9M1P3Mz4dfM for ; Fri, 29 Jan 2021 09:59:34 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from [192.168.13.11] ([45.47.45.55]) by cmsmtp with ESMTP id 5QYploStfzFB25QYpl0sBL; Fri, 29 Jan 2021 09:59:27 +0000 X-Authority-Analysis: v=2.3 cv=QMkWuTDL c=1 sm=1 tr=0 a=oJ4f3sEZGTo/oTi6ieWQlw==:117 a=oJ4f3sEZGTo/oTi6ieWQlw==:17 a=IkcTkHD0fZMA:10 a=X6wLfm9-oN-tMg0bDrcA:9 a=QEXdDO2ut3YA:10 To: freebsd-current@freebsd.org From: monochrome Subject: drm-fbsd13-kmod pkg-descr Message-ID: <0909b672-9c39-5a55-de97-93edab009e22@twcny.rr.com> Date: Fri, 29 Jan 2021 04:59:27 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-CMAE-Envelope: MS4wfAOUnUuhBG3iYNd2hIJOQwj7blgoB0TCnsZwwF8rCzOm6zzndkENNHdteqX07cZaWkpgc7lVJI+/T5oUXMZTeQ8y44/UdkYGHe5g/pCI78bVHpXnSpZB p106ocuxBigWbQirQH5FV0Nd2JyKXpj0fgmpPpsMEMQKOUz9ROtQmKcG5PXerfZgwOukEqe64beacg== X-Rspamd-Queue-Id: 4DRt9M1P3Mz4dfM X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of monochrome@twcny.rr.com designates 47.43.26.138 as permitted sender) smtp.mailfrom=monochrome@twcny.rr.com X-Spamd-Result: default: False [0.70 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[47.43.26.138:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:47.43.26.0/24]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[rr.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_SPAM_SHORT(1.00)[1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:40294, ipnet:47.43.24.0/21, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current]; RECEIVED_SPAMHAUS_PBL(0.00)[45.47.45.55:received] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 Jan 2021 09:59:36 -0000 correct me if I'm wrong, but shouldn't it say: Currently corresponding to Linux 5.4.62 DRM. instead of: Currently corresponding to Linux 4.16 DRM. got caught by this while trying to update drm-devel-kmod from ports on stable/13, and took a chance that it was just an oversight :) From owner-freebsd-current@freebsd.org Fri Jan 29 10:05:41 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D13334E5367 for ; Fri, 29 Jan 2021 10:05:41 +0000 (UTC) (envelope-from manu@bidouilliste.com) Received: from mx.blih.net (mx.blih.net [212.83.155.74]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx.blih.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRtJN5MnZz4f88 for ; Fri, 29 Jan 2021 10:05:40 +0000 (UTC) (envelope-from manu@bidouilliste.com) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bidouilliste.com; s=mx; t=1611914732; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=67LJrYOjXrrztFBW07DZEXOTjlC38ODPQFZv+a4XOOo=; b=IkcP9rqAFlX7WFM2p84qHRJevWURwgOG3HOJAg0E3z2ETZZxqdGI70T2B8PjDSu8VbQcnT 9c/OwsBibyvjFPtVBUeKlRaqFReGNN3VtK0hgPCobmK59eHAtI+Fprp+RpJ+jIqJdFrBV6 RaJBAbqgVHqIHX3J2RL2DPWGu1rxBOg= Received: from skull.home.blih.net (lfbn-idf2-1-745-114.w86-247.abo.wanadoo.fr [86.247.192.114]) by mx.blih.net (OpenSMTPD) with ESMTPSA id 8828a052 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Fri, 29 Jan 2021 10:05:32 +0000 (UTC) Date: Fri, 29 Jan 2021 11:05:32 +0100 From: Emmanuel Vadot To: monochrome Cc: freebsd-current@freebsd.org Subject: Re: drm-fbsd13-kmod pkg-descr Message-Id: <20210129110532.d7342f3c50de156881b23378@bidouilliste.com> In-Reply-To: <0909b672-9c39-5a55-de97-93edab009e22@twcny.rr.com> References: <0909b672-9c39-5a55-de97-93edab009e22@twcny.rr.com> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd14.0) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DRtJN5MnZz4f88 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bidouilliste.com header.s=mx header.b=IkcP9rqA; dmarc=pass (policy=none) header.from=bidouilliste.com; spf=pass (mx1.freebsd.org: domain of manu@bidouilliste.com designates 212.83.155.74 as permitted sender) smtp.mailfrom=manu@bidouilliste.com X-Spamd-Result: default: False [0.46 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[bidouilliste.com:s=mx]; FREEFALL_USER(0.00)[manu]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_GOOD(-0.10)[text/plain]; R_SPF_ALLOW(-0.20)[+mx]; ARC_NA(0.00)[]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; NEURAL_SPAM_SHORT(0.96)[0.957]; SPAMHAUS_ZRD(0.00)[212.83.155.74:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[bidouilliste.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[bidouilliste.com,none]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.83.155.74:from]; ASN(0.00)[asn:12876, ipnet:212.83.128.0/19, country:FR]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 Jan 2021 10:05:41 -0000 On Fri, 29 Jan 2021 04:59:27 -0500 monochrome wrote: > correct me if I'm wrong, but shouldn't it say: > > Currently corresponding to Linux 5.4.62 DRM. > > instead of: > > Currently corresponding to Linux 4.16 DRM. > > got caught by this while trying to update drm-devel-kmod from ports on > stable/13, and took a chance that it was just an oversight :) Indeed, just fixed this. Thanks, -- Emmanuel Vadot From owner-freebsd-current@freebsd.org Fri Jan 29 10:10:58 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 49C924E56EA for ; Fri, 29 Jan 2021 10:10:58 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from p-impout005.msg.pkvw.co.charter.net (p-impout005aa.msg.pkvw.co.charter.net [47.43.26.136]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRtQT1n6Cz4fPk for ; Fri, 29 Jan 2021 10:10:56 +0000 (UTC) (envelope-from monochrome@twcny.rr.com) Received: from [192.168.13.11] ([45.47.45.55]) by cmsmtp with ESMTP id 5QjqlpqTBbGHJ5QjqlJ5Qn; Fri, 29 Jan 2021 10:10:50 +0000 X-Authority-Analysis: v=2.3 cv=A5oSwJeG c=1 sm=1 tr=0 a=oJ4f3sEZGTo/oTi6ieWQlw==:117 a=oJ4f3sEZGTo/oTi6ieWQlw==:17 a=IkcTkHD0fZMA:10 a=ayC55rCoAAAA:8 a=0Ys3ajJHl0NEYq89Hz8A:9 a=QEXdDO2ut3YA:10 a=B_RyunTPg8udlmYm5Cu2:22 Subject: Re: drm-fbsd13-kmod pkg-descr To: freebsd-current@freebsd.org References: <0909b672-9c39-5a55-de97-93edab009e22@twcny.rr.com> <20210129110532.d7342f3c50de156881b23378@bidouilliste.com> From: monochrome Message-ID: <9f78a99f-62d3-ad48-e841-47d2e69a1dac@twcny.rr.com> Date: Fri, 29 Jan 2021 05:10:50 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210129110532.d7342f3c50de156881b23378@bidouilliste.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-CMAE-Envelope: MS4wfPrw2KYf5oHy9Dg7hrgKrZwhAqL9cWqh0EYVy/kJHZGl0HoTulB/vpj6AnJyCwGMHO5WYHGs3Icfza6jD1VhMZyXP++gDfn5XqeYJYYcHF/boF+wnzHX jKPXoCdhQoOOibGOo9FYHF6bR2K3wxelIt4wNkW3IYp4gBDBYWc1YBMm6Ayu9IAMWGSv4TOvS6Wp/w== X-Rspamd-Queue-Id: 4DRtQT1n6Cz4fPk X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of monochrome@twcny.rr.com designates 47.43.26.136 as permitted sender) smtp.mailfrom=monochrome@twcny.rr.com X-Spamd-Result: default: False [0.70 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[47.43.26.136:from]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[47.43.26.136:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:47.43.26.0/24]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[rr.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[47.43.26.136:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[45.47.45.55:received]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:40294, ipnet:47.43.24.0/21, country:US]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 Jan 2021 10:10:58 -0000 heh I got worried because my ryzen vega needs 4.17 and up On 1/29/21 5:05 AM, Emmanuel Vadot wrote: > On Fri, 29 Jan 2021 04:59:27 -0500 > monochrome wrote: > >> correct me if I'm wrong, but shouldn't it say: >> >> Currently corresponding to Linux 5.4.62 DRM. >> >> instead of: >> >> Currently corresponding to Linux 4.16 DRM. >> >> got caught by this while trying to update drm-devel-kmod from ports on >> stable/13, and took a chance that it was just an oversight :) > > Indeed, just fixed this. > > Thanks, > From owner-freebsd-current@freebsd.org Fri Jan 29 11:34:46 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A57E94E8509; Fri, 29 Jan 2021 11:34:46 +0000 (UTC) (envelope-from linimon@lonesome.com) Received: from mail.soaustin.net (mail.soaustin.net [18.222.6.11]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.soaustin.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DRwH94sCWz4mRV; Fri, 29 Jan 2021 11:34:45 +0000 (UTC) (envelope-from linimon@lonesome.com) Received: from lonesome.com (unknown [18.188.142.31]) by mail.soaustin.net (Postfix) with ESMTPSA id 857C5170FC; Fri, 29 Jan 2021 11:34:44 +0000 (UTC) Date: Fri, 29 Jan 2021 11:34:43 +0000 From: Mark Linimon To: Steve Kargl Cc: Emmanuel Vadot , freebsd-x11@freebsd.org, freebsd-current@freebsd.org Subject: Re: i915kms and chip resets on rsc0? Message-ID: <20210129113442.GA24082@lonesome.com> References: <20200710192736.GA69592@troutmask.apl.washington.edu> <20210128191510.GA96585@troutmask.apl.washington.edu> <20210128204806.77d1e676a592ec638a82d5be@bidouilliste.com> <20210128200255.GA96914@troutmask.apl.washington.edu> <20210128212213.a7e14bc4b469c745b522ea0a@bidouilliste.com> <20210128222040.GA97667@troutmask.apl.washington.edu> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20210128222040.GA97667@troutmask.apl.washington.edu> User-Agent: Mutt/1.5.21 (2010-09-15) X-Rspamd-Queue-Id: 4DRwH94sCWz4mRV X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of linimon@lonesome.com has no SPF policy when checking 18.222.6.11) smtp.mailfrom=linimon@lonesome.com X-Spamd-Result: default: False [0.96 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_SHORT(-0.84)[-0.845]; RCVD_IN_DNSWL_LOW(-0.10)[18.222.6.11:from]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[18.222.6.11:from]; ASN(0.00)[asn:16509, ipnet:18.220.0.0/14, country:US]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; FREEFALL_USER(0.00)[linimon]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[lonesome.com]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[18.222.6.11:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current,freebsd-x11] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 Jan 2021 11:34:46 -0000 On Thu, Jan 28, 2021 at 02:20:40PM -0800, Steve Kargl wrote: > This is all likely academic as I just saw John Baldwin's email > that stated i386 support is being dropped in FreeBSD-current. s/dropped/downgraded/ The only difference seems to be that security upgrades that _only_ affect i386 will no longer be prioritized. This will put it mostly on a par with arm64, armv7, and powerpc64. That's all it means. mcl From owner-freebsd-current@freebsd.org Fri Jan 29 22:40:30 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 643084FB700 for ; Fri, 29 Jan 2021 22:40:30 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from maybe.home.utahime.org (gate.home.utahime.org [183.180.29.210]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSC3K3VPHz4WfW for ; Fri, 29 Jan 2021 22:40:29 +0000 (UTC) (envelope-from yasu@utahime.org) Received: from eastasia.home.utahime.org (eastasia.home.utahime.org [192.168.174.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by maybe.home.utahime.org (Postfix) with ESMTPS id 7BC7112F5A for ; Sat, 30 Jan 2021 07:40:20 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=utahime.org; s=maybe2019112701; t=1611960020; bh=v+ANArBHt0wVSASA4A2Vz2MP0cblMZVyEk0kXUv1uKQ=; h=Date:To:Subject:From:In-Reply-To:References; b=Da4pdgQixU0MZUtA9MquJz1oEDu53SZpbUrsucrc3dqQpIMaraOnOVaJLewsHlXyd 5w2100vpk2OMQxGcnQIP9BJDAmhW06JlIIhWfPJtA8q2yE1KNEp4VWOSnatMJEEn77 fvrtywtZXsECSRU54qu6hXK1FS9sCHD/uUJaReASeT68NgnTiBiO1wr0U8vfPPW24/ P3X/f8Yu+vSKANBQGnAuDvAS5LC1ku+9hWJTLZoBMyp5d3icT/oroZKm2RobXlAuDR y4FAgPRAnSgG7x3tctXhVOnwrL+UhIOLc1UZD9xc2WFU+WV5Z8sPIWql4Fa4abRwQW cJG4tj/FmjYuA== Received: from localhost (rolling.home.utahime.org [192.168.174.11]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-384) server-digest SHA384) (No client certificate requested) by eastasia.home.utahime.org (Postfix) with ESMTPSA id 680061C9E3; Sat, 30 Jan 2021 07:40:19 +0900 (JST) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.0 at eastasia.home.utahime.org Date: Sat, 30 Jan 2021 07:40:03 +0900 (JST) Message-Id: <20210130.074003.1244393857868272421.yasu@utahime.org> To: freebsd-current@freebsd.org Subject: Re: Waiting for bufdaemon From: Yasuhiro Kimura In-Reply-To: <20210128.050242.1986722766748729591.yasu@utahime.org> References: <20210115.201030.1395690536446474720.yasu@utahime.org> <20210116.040323.136067379540977557.yasu@utahime.org> <20210128.050242.1986722766748729591.yasu@utahime.org> X-Mailer: Mew version 6.8 on Emacs 27.1 Mime-Version: 1.0 Content-Type: Text/Plain; charset=us-ascii Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DSC3K3VPHz4WfW X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=pass header.d=utahime.org header.s=maybe2019112701 header.b=Da4pdgQi; dmarc=none; spf=pass (mx1.freebsd.org: domain of yasu@utahime.org designates 183.180.29.210 as permitted sender) smtp.mailfrom=yasu@utahime.org X-Spamd-Result: default: False [1.30 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:spf-authorized.utahime.org]; TO_DN_NONE(0.00)[]; HFILTER_HELO_IP_A(1.00)[maybe.home.utahime.org]; HFILTER_HELO_NORES_A_OR_MX(0.30)[maybe.home.utahime.org]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[utahime.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[183.180.29.210:from]; ASN(0.00)[asn:2519, ipnet:183.180.0.0/16, country:JP]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[utahime.org:s=maybe2019112701]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[utahime.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[183.180.29.210:from:127.0.2.255]; MID_CONTAINS_FROM(1.00)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 29 Jan 2021 22:40:30 -0000 From: Yasuhiro Kimura Subject: Re: Waiting for bufdaemon Date: Thu, 28 Jan 2021 05:02:42 +0900 (JST) > It took for a while to investigate, but according to the result of > bisect following commit is the source of problem in my case. > > ---------------------------------------------------------------------- > commit 84eaf2ccc6a > Author: Konstantin Belousov > Date: Mon Dec 21 19:02:31 2020 +0200 > > x86: stop punishing VMs with low priority for TSC timecounter > > I suspect that virtualization techniques improved from the time when we > have to effectively disable TSC use in VM. For instance, it was reported > (complained) in https://github.com/JuliaLang/julia/issues/38877 that > FreeBSD is groundlessly slow on AWS with some loads. > > Remove the check and start watching for complaints. > > Reviewed by: emaste, grehan > Discussed with: cperciva > Sponsored by: The FreeBSD Foundation > Differential Revision: https://reviews.freebsd.org/D27629 > ---------------------------------------------------------------------- > > I confirmed the problem still happens with 5c325977b11 but reverting > above commit fixes it. I submitted this problem to Bugzilla. Timeout of bufdaemon happens at shutdown time with -CURRENT amd64 and VirtulaBox VM https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=253087 --- Yasuhiro Kimura From owner-freebsd-current@freebsd.org Sat Jan 30 00:25:15 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 508134FDE89; Sat, 30 Jan 2021 00:25:15 +0000 (UTC) (envelope-from delphij@delphij.net) Received: from anubis.delphij.net (anubis.delphij.net [IPv6:2001:470:1:117::25]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "anubis.delphij.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSFNB27tVz4ddx; Sat, 30 Jan 2021 00:25:14 +0000 (UTC) (envelope-from delphij@delphij.net) Received: from odin.corp.delphij.net (unknown [IPv6:2601:646:8601:f4a:24cb:affb:858d:bf92]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-384) server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by anubis.delphij.net (Postfix) with ESMTPSA id E5EEF3A73C; Fri, 29 Jan 2021 16:25:06 -0800 (PST) Reply-To: d@delphij.net To: Kurt Jaeger , freebsd-current@freebsd.org, freebsd-fs@freebsd.org References: From: Xin Li Subject: Re: zpool upgrade to draid feature: does it require updated zfs boot code ? Message-ID: <7a2b946a-636c-5aae-1129-adbf73168b70@delphij.net> Date: Fri, 29 Jan 2021 16:25:05 -0800 User-Agent: Thunderbird MIME-Version: 1.0 In-Reply-To: Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="hWrMO7rPhdsDJYLDGUj3G9Xg1c1c7Paj8" X-Rspamd-Queue-Id: 4DSFNB27tVz4ddx X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.09 / 15.00]; HAS_REPLYTO(0.00)[d@delphij.net]; RCVD_VIA_SMTP_AUTH(0.00)[]; XM_UA_NO_VERSION(0.01)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+a:sirius.delphij.net]; HAS_ATTACHMENT(0.00)[]; DKIM_TRACE(0.00)[delphij.net:+]; DMARC_POLICY_ALLOW(-0.50)[delphij.net,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:470:1:117::25:from]; ASN(0.00)[asn:6939, ipnet:2001:470::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[delphij.net:s=m7e2]; FREEFALL_USER(0.00)[delphij]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,multipart/mixed,text/plain]; REPLYTO_DOM_EQ_FROM_DOM(0.00)[]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[2001:470:1:117::25:from:127.0.2.255]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:~]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current,freebsd-fs] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 00:25:15 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --hWrMO7rPhdsDJYLDGUj3G9Xg1c1c7Paj8 Content-Type: multipart/mixed; boundary="RXtbqnI58ptDH0mlteTjkRmHln3IJszCs"; protected-headers="v1" From: Xin Li Reply-To: d@delphij.net To: Kurt Jaeger , freebsd-current@freebsd.org, freebsd-fs@freebsd.org Message-ID: <7a2b946a-636c-5aae-1129-adbf73168b70@delphij.net> Subject: Re: zpool upgrade to draid feature: does it require updated zfs boot code ? References: In-Reply-To: --RXtbqnI58ptDH0mlteTjkRmHln3IJszCs Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: quoted-printable On 1/28/21 11:00, Kurt Jaeger wrote: > Hi! >=20 > Short question: >=20 > Does a zpool upgrade on 14.0 (current) for the draid feature > require a boot code update ? >=20 > Long version of the same question: [...] > With the draid update, no message was displayed. >=20 > Does it require the bootcode update anyway or, if not, why not ? This sounded like a bug. Is it your boot pool, or just a regular data po= ol? > gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 1 nvd0 > gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 1 nvd1 To answer your short question: do I need to update bootcode? No if draid is the only feature that you have enabled on an existing pool, but personally I don't recommend upgrading boot pool right now. The reason for that "No" answer is 1) the boot code do not currently support draid, and 2) enabling the feature won't activate it until draid vdev is added to the pool, which is quite unlikely in your case; note that if you do add draid vdev, your bootcode won't be able to boot from it anymore. On my personal laptop, old bootcode would boot pool with draid enabled but not activated just fine (note that the loader.efi on -CURRENT won't boot my P51, which I will start a separate discussion; I used FreeBSD-13.0-CURRENT-amd64-20201231-282381aa53a-255460-memstick.img and fixed my EFI loader and it worked fine with the draid-enabled boot ZFS pool). Hope this helps. Cheers, --RXtbqnI58ptDH0mlteTjkRmHln3IJszCs-- --hWrMO7rPhdsDJYLDGUj3G9Xg1c1c7Paj8 Content-Type: application/pgp-signature; name="OpenPGP_signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="OpenPGP_signature" -----BEGIN PGP SIGNATURE----- wsF5BAABCAAjFiEEceNg5NEMZIki80nQQHl/fJX0g08FAmAUp2EFAwAAAAAACgkQQHl/fJX0g089 WQ//Uhbo4p3dC3A3D+cbueizilJTEWTSs2i+XhurP2AtlYYlxZPm0JfQA5qnxwAojM3qR+DSc2jK 7ccJk6ThpnoVCb3dd/dOInrgFC0EMjtqr7oeM7hkXTYiQfihSMYx/ZAZzDcFdazxLAwpCC8jHMxa fwxfGFM8sRBQMxwqahCZ/CCxm4AslI4bYykIrFvNZ/kC0kQdxUrD1cl4vIUIn33/vbQ/RKlVbsw1 Nr17js16bBs2FNlGzgng2YahdHzZl915W2iDb1rlYa/kVh2NJYD9oaygzGZl3yOz7N379W4IgMI8 S7CKG6th9xN70evmVNoSaQpZe2tNIcchcojST0Qtpg4Vtd7f+cFeMn5Ze9KBZ54OPBQqYqG5ElVq J+MQxhRY6/TVo5mFgLN5b5q9TmGUTCztZUp6uIX4NaRDS5QTzF7B/mDoKHpDUC8sF/8D2tm8l3iU nbkQqbzuT9lQ79UGnj1LA04CQ2MKas+D1QULqsCO96pKLr+Y2o2dvrWlYqQdNcXAMl0OyPopY2Qt sKcsf+kXX6UWch7wYzGoIsIQgHSnONhLbpRvDlEUn2eEqAc+CyFO/DWtDH7JSVzn5tWT0RczWP6y 0e2FEAWgeEGJhxpfrz/73jxgxL+yg6CLOjUOe7O2EK18I96lwYl+zbEmUUIHgUEr3j399bUxYbEt UD4= =Ka1L -----END PGP SIGNATURE----- --hWrMO7rPhdsDJYLDGUj3G9Xg1c1c7Paj8-- From owner-freebsd-current@freebsd.org Sat Jan 30 06:38:48 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DAE72526DCA for ; Sat, 30 Jan 2021 06:38:48 +0000 (UTC) (envelope-from o.hartmann@walstatt.org) Received: from mout.gmx.net (mout.gmx.net [212.227.15.19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSPgC1Mcjz3FMV for ; Sat, 30 Jan 2021 06:38:46 +0000 (UTC) (envelope-from o.hartmann@walstatt.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1611988724; bh=jPAdDxmc6T4kjzz2nzVuH3LrBuT74gofT86QKgeUavQ=; h=X-UI-Sender-Class:Date:From:To:Subject; b=NJLZ5wY3bCtUOmwz/bZxeDzbz42XbiDJ83KrvUmNX/PkJa4M9gAOk9v3ZAucY3Efe xvpc9ayJKRSrUF4l8lYSgrJqqxDYG39B2Q74/oA0AnKwwEyoTwsNXW4OoYz0F3duX3 8C4tP/GR1Lv6HJ/BCNCpRIDcfHVkm6pOgSUuNnJ8= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from hermann.fritz.box ([89.12.230.249]) by mail.gmx.net (mrgmx004 [212.227.17.190]) with ESMTPSA (Nemesis) id 1MmlT2-1ln0XC2B2E-00jtG7 for ; Sat, 30 Jan 2021 07:38:44 +0100 Date: Sat, 30 Jan 2021 07:38:36 +0100 From: "Hartmann, O." To: FreeBSD CURRENT Subject: (n244517-f17fc5439f5) svn stuck forever in /usr/ports? Message-ID: <20210130073836.7e156158@hermann.fritz.box> Organization: walstatt.org MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/kuFG35fn9rxHu_3DsZcqbGw"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Provags-ID: V03:K1:kNmKuGlwkXJhA7TDPpIpHc+vvjUkQDAWLsSGQaFARmxhDezVgBN qTIhlcBBXQxCM1QIF432qt4ismN28e9YPr0jcVudekkFR8DdkbSN+YFL6u2WubYaOKN1xT8 /Ux8vT8bVKJNJaetDx5Hi8ldJ7f5EdPWHv9vu752e2b9H+lKXyfZgfgSuSnEQkWp7wrsJ6m kmmXYICgkhxgTxe1TUCCw== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:AMLcj+xCD2c=:qFPXyl7EZEYZQm8dVwrpMd vfANqy4Hzrfdy07PAsQHIQ3TzTE4cgFqiDGPJCOZPH5ZpQNGiG/lZcLUBzai+l3wQIV/ECfsz JUvLENBal2OyipILOlnI+AU9RnvHEEI5/gZFqJ9qx0Rd7qA8pvc/amxtd0PpXJyaVwTDjy8wL Qv38p2dg5fJL4FsvRLC8cbirifDxqv6MH88AsRefB/TK8wK5fBDpZdwCppsePkqDklEN5VFo/ x/36JmNvmHg0ojcpvJTKv1YYHCEO9KNqKaB+XqLAGIQ/pf3v1BE00ZDzngwVzWHFjinrzmeiG docgLCO9L42BECB72G50S5vJ7G9zntZJXJonBHS1xwf/3bR4MHDnwHc3lvPf8Bru5oZrEPrPG FGw1yRqfzoD7qfY2fWjVcOlqWGdqj30w/QczdamGN3t1qVx90DlW6cbXeJcNxfinbuauyLxaj nAaH6giScmD6TiJng0mWnJmQoI7usCPEzhUQDnDWPaEB7po/9xzpeRTB4TXxt388CNr3iiQ+c 2GxlrGwuiLAg5yNJtDy87tQPh727O0AJU3jYFCBuN/rWLePk9Vb3YkGLJkkDnhpyaPyPqcnOJ RO7VUF/m9UIb55d0xWpMzd6vf2yQ+BpbmAaWuO7SdU+R5mqLlQ530bWhdheaDCZVCR8SqQ7jZ Y3TGXQ+6D67piIE89QxNhCmE8Q/5LOw/9DuaGW5dZbpktReNWcN3vOajIpddBimnu1tofGevt +Zz1vUEd1rTXNW1z9PqVQPZHe4dfKyhYEq+r8/P2+pZQlD1EQjv8iiAOcBGMTe5oCtPf+R6Jv W9ObmOV9WROOVamP7ylY32GfZpj0txx/BS4CrrcRbVVhbfHxFpnrFdKRamKbfdTAzVb9rkyAC q8b7SxS8wGJKgKaBgIDQ== X-Rspamd-Queue-Id: 4DSPgC1Mcjz3FMV X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmx.net header.s=badeba3b8450 header.b=NJLZ5wY3; dmarc=none; spf=none (mx1.freebsd.org: domain of o.hartmann@walstatt.org has no SPF policy when checking 212.227.15.19) smtp.mailfrom=o.hartmann@walstatt.org X-Spamd-Result: default: False [-2.35 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[212.227.15.19:from]; HAS_ORG_HEADER(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmx.net:+]; NEURAL_HAM_SHORT(-0.95)[-0.946]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.15.19:from]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RECEIVED_SPAMHAUS_PBL(0.00)[89.12.230.249:received]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmx.net:s=badeba3b8450]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[walstatt.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[212.227.15.19:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[212.227.15.19:from]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 06:38:48 -0000 --Sig_/kuFG35fn9rxHu_3DsZcqbGw Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable We recently updated to FreeBSD 14.0-CURRENT #9 main-n244517-f17fc5439f5: Fr= i Jan 29 16:29:50 CET 2021 amd64. After make delete-oldfiles/delete-old-libs, the c= ommand=20 make update issued in /usr/ports on those 14-CURRENT boxes remains stuck forever or it = is working like a snail! Hitting Ctrl-t on the console gives: load: 0.06 cmd: svn 96552 [kqread] 2530.57r 270.92u 5.68s 10% 10584k mi_switch+0xbe sleepq_catch_signals+0x324 sleepq_timedwait_sig+0x12 _sleep+= 0x188 kqueue_kevent+0x2d0 kern_kevent_fp+0x51 kern_kevent_generic+0xdd sys_kevent= +0x61 amd64_syscall+0x10c fast_syscall_common+0xf8 make: Working in: /usr/ports The system is idle otherwise. How can this be resolved? Is this phenomenon known? Kind regards and thank you very much in advance, O. Hartmann --Sig_/kuFG35fn9rxHu_3DsZcqbGw Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iHUEARYIAB0WIQSy8IBxAPDkqVBaTJ44N1ZZPba5RwUCYBT+7AAKCRA4N1ZZPba5 R5qyAQDIUTOd3Yad4ZGTBWJ/6PZ2ybLsRALYsTKj351/p7PQxgD+K/kav/UlUZyN hlZ6TKtglQNMgT6PO2KmM/lB0X9BOwA= =rkRE -----END PGP SIGNATURE----- --Sig_/kuFG35fn9rxHu_3DsZcqbGw-- From owner-freebsd-current@freebsd.org Sat Jan 30 06:39:27 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 250AE5268E0 for ; Sat, 30 Jan 2021 06:39:27 +0000 (UTC) (envelope-from ohartmann@walstatt.org) Received: from mout.gmx.net (mout.gmx.net [212.227.15.15]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSPgx6fX5z3Fk2 for ; Sat, 30 Jan 2021 06:39:25 +0000 (UTC) (envelope-from ohartmann@walstatt.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1611988764; bh=KYR+qDQi29yWb2H/wxFBg1/bDD9VGCQEJnDFQKUd5LU=; h=X-UI-Sender-Class:Date:From:To:Subject; b=U0UhydHeIjG2p66BgCAZYW4XQ2jos0FxRqLfT9wXOd4YU8LweZg972AH1uRLsQoNR wRPpBPYrlJD/SF9xcKgw457N/OGRh5YHKPepNMjPQ5Vbh/xcIN0uMrOjJHL4ZB1zet zW0GimgUxWe9koMvqMSbMB0c3ZRUB/0BDF+3XXOc= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from hermann.fritz.box ([89.12.230.249]) by mail.gmx.net (mrgmx004 [212.227.17.190]) with ESMTPSA (Nemesis) id 1MjjCL-1lqZvj0HpD-00lGu7 for ; Sat, 30 Jan 2021 07:39:24 +0100 Date: Sat, 30 Jan 2021 07:39:23 +0100 From: "Hartmann, O." To: FreeBSD CURRENT Subject: (n244517-f17fc5439f5) svn stuck forever in /usr/ports? Message-ID: <20210130073923.0b2a80c1@hermann.fritz.box> Organization: walstatt.org MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/5_8EWyzNboC54xogNP2qr+B"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Provags-ID: V03:K1:ioGVc7xHM3IW3CfNXDRHdbrSG5YNHCyznZ3H4CUeMQIYlbgQdKL e1vrMRU+gdBtv5LyAB3Hh6VJi55332GLsoL4/+66G4k8H7jpuJjkW+sWh42tBk0xlkWRbF4 0ak2T4d9fQcNYq1wxxBFRwJvtxFMPsA7lo78tFtOh6VY5h7/7Ag5lz5QfFVj7Z7Ljyz1y2e Sb1qdn+iLB4o+PDFHHRSw== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:jVuBLygOuLM=:w9oqddU9ZwK2UftKVc1ojE MkMtZ3xeEpkmR5YfnRpLXNlf20L7NrKccQxGpOaGu/vqe2xti3tZg0W5TuiQ0UTZepVfYI70l yfctGE4k8tmAICa7AbsSKhYZ8S/Xup74ioUNOsvyd4mN9XyRX7ccYb2vEk5TUEQ3/QWLEclSX LirL6D10GYrQE6mjoGgXWPXnai2jjxhL89YXlr1MP1tdOlcDbFycsUNNaVQcFVGwbr6/s7N0o tGE0F7BnXiUKjMTR7U9e3aA/ADjYWVjgS/6y6Nwgf6+Sw/Kqfs/MbEyYku9AL81Lfq82SvkdS 8LP+ow5Kjik8SdNll4fnZ69vcxBonkzDPmKz5ZQozP9U8c6gE2VcRojO9Rdb7FLiFL9lxvMOT c3uo7Roqx3W8c15PsZifGYnj0ANT4ATnHzf0NB5tQFJTGNp7u0GQ9wt4m8oKNMXGzCcVE9YEQ fkJHHQ6fzSqtltl/sB07blUBDjOF+rqQlyCE/S4I0f2QzL6+e1JLz6bgDuOl6WXQL8pg8ir57 Crr8mpcTBshIder1wp1GEhSyvz7iSpvkzy0f8m6daomjjxufhYL9hNgBmUNHzLYpi/1GvKUnL v0QdGrfrwdAx10oS6ia+B7M+rHC6M0ggAPMVt1aMp9WFHjca8sOBq9jka0Dgy5BzK5+eq9pmS GjlqUL2TrNyHKlGGnBtist4IlY8LHd7q7aytm2gp7nIhTiyRThPyu9FDtOaDHPGFSBZMaNKFG ss4el5Dr4ZrF7b2nKo9YfTyPWNDUWhGSOMZvx0yDM5w7MG9l+uTILQTLstelM9XmuH2FIUxSY QrPJjoFNnwzt0B6OZJEpCyM1AsRpn1cqMp2R6Ts38/qV2v4Z/DKVtjioEB7B0xy4uoW6nkTK8 IolBCz4kmzBXvsGhDWxA== X-Rspamd-Queue-Id: 4DSPgx6fX5z3Fk2 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmx.net header.s=badeba3b8450 header.b=U0UhydHe; dmarc=none; spf=none (mx1.freebsd.org: domain of ohartmann@walstatt.org has no SPF policy when checking 212.227.15.15) smtp.mailfrom=ohartmann@walstatt.org X-Spamd-Result: default: False [-2.35 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[212.227.15.15:from]; HAS_ORG_HEADER(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmx.net:+]; NEURAL_HAM_SHORT(-0.95)[-0.945]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.15.15:from]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RECEIVED_SPAMHAUS_PBL(0.00)[89.12.230.249:received]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmx.net:s=badeba3b8450]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[walstatt.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[212.227.15.15:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[212.227.15.15:from]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 06:39:27 -0000 --Sig_/5_8EWyzNboC54xogNP2qr+B Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable We recently updated to FreeBSD 14.0-CURRENT #9 main-n244517-f17fc5439f5: Fr= i Jan 29 16:29:50 CET 2021 amd64. After make delete-oldfiles/delete-old-libs, the c= ommand=20 make update issued in /usr/ports on those 14-CURRENT boxes remains stuck forever or it = is working like a snail! Hitting Ctrl-t on the console gives: load: 0.06 cmd: svn 96552 [kqread] 2530.57r 270.92u 5.68s 10% 10584k mi_switch+0xbe sleepq_catch_signals+0x324 sleepq_timedwait_sig+0x12 _sleep+= 0x188 kqueue_kevent+0x2d0 kern_kevent_fp+0x51 kern_kevent_generic+0xdd sys_kevent= +0x61 amd64_syscall+0x10c fast_syscall_common+0xf8 make: Working in: /usr/ports The system is idle otherwise. How can this be resolved? Is this phenomenon known? Kind regards and thank you very much in advance, O. Hartmann --Sig_/5_8EWyzNboC54xogNP2qr+B Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iHUEARYIAB0WIQSy8IBxAPDkqVBaTJ44N1ZZPba5RwUCYBT/GwAKCRA4N1ZZPba5 R72RAQCpGSASIkA0NWtk26jxeDkz2ub+2d46b96QkEn0osL8AgEAribK5eKelawq noUI9gDqBhtzE+rs5bmrVhJjkVwbRgM= =OQLO -----END PGP SIGNATURE----- --Sig_/5_8EWyzNboC54xogNP2qr+B-- From owner-freebsd-current@freebsd.org Sat Jan 30 09:13:06 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 81F024E2964 for ; Sat, 30 Jan 2021 09:13:06 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail.madpilot.net (vogon.madpilot.net [159.69.1.99]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DST5F3RC6z3NqS for ; Sat, 30 Jan 2021 09:13:05 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail (mail [192.168.254.3]) by mail.madpilot.net (Postfix) with ESMTP id 4DST562vMgz6dVT; Sat, 30 Jan 2021 10:12:58 +0100 (CET) Received: from mail.madpilot.net ([192.168.254.3]) by mail (mail.madpilot.net [192.168.254.3]) (amavisd-new, port 10026) with ESMTP id Kqyu1UHrMFDh; Sat, 30 Jan 2021 10:12:56 +0100 (CET) Subject: Re: (n244517-f17fc5439f5) svn stuck forever in /usr/ports? To: "Hartmann, O." , FreeBSD CURRENT References: <20210130073923.0b2a80c1@hermann.fritz.box> From: Guido Falsi Message-ID: <396f8b81-3b37-2488-8c53-3e4f524dfc5e@madpilot.net> Date: Sat, 30 Jan 2021 10:12:55 +0100 In-Reply-To: <20210130073923.0b2a80c1@hermann.fritz.box> Content-Type: text/plain; charset=windows-1252; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DST5F3RC6z3NqS X-Spamd-Bar: - X-Spamd-Result: default: False [-1.00 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[159.69.1.99:from]; R_DKIM_ALLOW(-0.20)[madpilot.net:s=bjowvop61wgh]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; MISSING_MIME_VERSION(2.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[159.69.1.99:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[madpilot.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[madpilot.net,quarantine]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:24940, ipnet:159.69.0.0/16, country:DE]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 09:13:06 -0000 On 30/01/21 07:39, Hartmann, O. wrote: > We recently updated to FreeBSD 14.0-CURRENT #9 main-n244517-f17fc5439f5: Fri Jan 29 > 16:29:50 CET 2021 amd64. After make delete-oldfiles/delete-old-libs, the command > > make update > > issued in /usr/ports on those 14-CURRENT boxes remains stuck forever or it is working > like a snail! > Hitting Ctrl-t on the console gives: > > load: 0.06 cmd: svn 96552 [kqread] 2530.57r 270.92u 5.68s 10% 10584k > mi_switch+0xbe sleepq_catch_signals+0x324 sleepq_timedwait_sig+0x12 _sleep+0x188 > kqueue_kevent+0x2d0 kern_kevent_fp+0x51 kern_kevent_generic+0xdd sys_kevent+0x61 > amd64_syscall+0x10c fast_syscall_common+0xf8 make: Working in: /usr/ports > > > The system is idle otherwise. > > How can this be resolved? Is this phenomenon known? I'm seeing similar behaviour. Switching to the svn:// scheme was a successful workaround. -- Guido Falsi From owner-freebsd-current@freebsd.org Sat Jan 30 09:55:03 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6164E4E3E86 for ; Sat, 30 Jan 2021 09:55:03 +0000 (UTC) (envelope-from delphij@delphij.net) Received: from anubis.delphij.net (anubis.delphij.net [IPv6:2001:470:1:117::25]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "anubis.delphij.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSV1f136Tz3Qs2; Sat, 30 Jan 2021 09:55:01 +0000 (UTC) (envelope-from delphij@delphij.net) Received: from p51.home.us.delphij.net (unknown [IPv6:2601:646:8601:f4a:e670:b8ff:fe5c:4e69]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-384) server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by anubis.delphij.net (Postfix) with ESMTPSA id 4366B3AAF0; Sat, 30 Jan 2021 01:54:56 -0800 (PST) From: Xin Li Subject: UEFI boot hangs after loading kernel with efi_max_resolution="4k" Reply-To: d@delphij.net To: freebsd-current@freebsd.org Cc: tsoome@freebsd.org Organization: The FreeBSD Project Message-ID: <8a4b2d5c-fb19-9784-b104-d725a7992041@delphij.net> Date: Sat, 30 Jan 2021 01:54:55 -0800 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DSV1f136Tz3Qs2 X-Spamd-Bar: --- X-Spamd-Result: default: False [-4.00 / 15.00]; HAS_REPLYTO(0.00)[d@delphij.net]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+a:sirius.delphij.net]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; DKIM_TRACE(0.00)[delphij.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[delphij.net,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:470:1:117::25:from]; ASN(0.00)[asn:6939, ipnet:2001:470::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[delphij.net:s=m7e2]; FREEFALL_USER(0.00)[delphij]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_DOM_EQ_FROM_DOM(0.00)[]; SPAMHAUS_ZRD(0.00)[2001:470:1:117::25:from:127.0.2.255]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 09:55:03 -0000 Hi, It seems that some recent change after 282381aa53a would prevent my laptop (Lenovo P51, with 4k LCD) from booting. I have made some attempt to find out why, so far, it seems that setting efi_max_resolution="480p" or efi_max_resolution="720p" would allow it to boot to single user mode. Unfortunately, with KMS modules loaded, the screen would enter high resolution mode, and the screen output would be garbled. To make the situation worse, because I have the following configuration set in /etc/rc.conf: allscreens_flags="-f /usr/share/vt/fonts/terminus-b32.fnt" the kernel would panic shortly after loading the font: === Unread portion of the kernel message buffer: <118>Configuring vt: blanktime allscreens panic: free: address 0xffffffff81c6ee00(0xffffffff81c6e000) has not been allocated. cpuid = 3 time = 1611996927 KDB: stack backtrace: db_trace_self_wrapper() at db_trace_self_wrapper+0x2b/frame 0xfffffe0141dbc490 vpanic() at vpanic+0x181/frame 0xfffffe0141dbc4e0 panic() at panic+0x43/frame 0xfffffe0141dbc540 free() at free+0xf8/frame 0xfffffe0141dbc570 vt_change_font() at vt_change_font+0x16f/frame 0xfffffe0141dbc5c0 vtterm_ioctl() at vtterm_ioctl+0xef6/frame 0xfffffe0141dbc610 termtty_ioctl() at termtty_ioctl+0xc3/frame 0xfffffe0141dbc660 tty_ioctl() at tty_ioctl+0x8e/frame 0xfffffe0141dbc6b0 ttydev_ioctl() at ttydev_ioctl+0x247/frame 0xfffffe0141dbc700 devfs_ioctl() at devfs_ioctl+0xcb/frame 0xfffffe0141dbc750 vn_ioctl() at vn_ioctl+0x131/frame 0xfffffe0141dbc860 devfs_ioctl_f() at devfs_ioctl_f+0x1e/frame 0xfffffe0141dbc880 kern_ioctl() at kern_ioctl+0x289/frame 0xfffffe0141dbc8f0 sys_ioctl() at sys_ioctl+0x12a/frame 0xfffffe0141dbc9c0 amd64_syscall() at amd64_syscall+0x12e/frame 0xfffffe0141dbcaf0 fast_syscall_common() at fast_syscall_common+0xf8/frame 0xfffffe0141dbcaf0 --- syscall (54, FreeBSD ELF64, sys_ioctl), rip = 0x80038bc9a, rsp = 0x7fffffffe938, rbp = 0x7fffffffebf0 --- Uptime: 28s Dumping 1421 out of 32433 MB:..2%..11%..21%..31%..41%..51%..61%..71%..82%..91% ==== I thought the panic was fixed (bug 252833), but it's probably a different corner case, which can happen when loader/EFI provided resolution is different from the current KMS-enabled resolution (haven't took a closer look yet). But it's still unclear to me why the screen would go blank when efi_max_resolution is set to "4k" or unset. I thought it's probably panicked somewhere, but it's hard to confirm as I don't have a serial console with this laptop. If I replace the loader taken from the 20201231 snapshot (from 282381aa53a), then the laptop would boot just fine. In summary, what I know so far was: Old loader: everything would work just fine. New loader: efi_max_resolution="4k" in /boot/loader.conf: Screen goes blank after "boot" in loader prompt No efi_max_resolution in /boot/loader.conf: 'show' gives me efi_max_resolution="1x1" and screen goes blank after "boot" in loader prompt efi_max_resolution="720p" or 480p in /boot/loader.conf: Kernel boots fine up to single user mode. Panic immediately when loading font. Any suggestion on what this could be? It's hard to debug boot loader issues on this laptop as I don't have an usable serial console and blank screen would make me blind :) Cheers, From owner-freebsd-current@freebsd.org Sat Jan 30 10:25:32 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7E6994E50F4 for ; Sat, 30 Jan 2021 10:25:32 +0000 (UTC) (envelope-from junchoon@dec.sakura.ne.jp) Received: from www121.sakura.ne.jp (www121.sakura.ne.jp [153.125.133.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSVhp4qDbz3jCS for ; Sat, 30 Jan 2021 10:25:29 +0000 (UTC) (envelope-from junchoon@dec.sakura.ne.jp) Received: from kalamity.joker.local (115-38-187-204.shizuoka1.commufa.jp [115.38.187.204]) (authenticated bits=0) by www121.sakura.ne.jp (8.16.1/8.16.1/[SAKURA-WEB]/20201212) with ESMTPA id 10UAPLlR078121 for ; Sat, 30 Jan 2021 19:25:21 +0900 (JST) (envelope-from junchoon@dec.sakura.ne.jp) Date: Sat, 30 Jan 2021 19:25:20 +0900 From: Tomoaki AOKI To: freebsd-current@freebsd.org Subject: Re: (n244517-f17fc5439f5) svn stuck forever in /usr/ports? Message-Id: <20210130192520.e7cf7f680c0abd31b0771107@dec.sakura.ne.jp> In-Reply-To: <20210130073923.0b2a80c1@hermann.fritz.box> References: <20210130073923.0b2a80c1@hermann.fritz.box> Reply-To: junchoon@dec.sakura.ne.jp Organization: Junchoon corps X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd13.0) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DSVhp4qDbz3jCS X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of junchoon@dec.sakura.ne.jp has no SPF policy when checking 153.125.133.21) smtp.mailfrom=junchoon@dec.sakura.ne.jp X-Spamd-Result: default: False [1.41 / 15.00]; HAS_REPLYTO(0.00)[junchoon@dec.sakura.ne.jp]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; REPLYTO_ADDR_EQ_FROM(0.00)[]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; NEURAL_HAM_SHORT(-0.99)[-0.990]; RECEIVED_SPAMHAUS_PBL(0.00)[115.38.187.204:received]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[153.125.133.21:from]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:7684, ipnet:153.125.128.0/18, country:JP]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; DMARC_NA(0.00)[sakura.ne.jp]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[153.125.133.21:from:127.0.2.255]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCVD_TLS_LAST(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 10:25:32 -0000 On Sat, 30 Jan 2021 07:39:23 +0100 "Hartmann, O." wrote: > We recently updated to FreeBSD 14.0-CURRENT #9 main-n244517-f17fc5439f5: Fri Jan 29 > 16:29:50 CET 2021 amd64. After make delete-oldfiles/delete-old-libs, the command > > make update > > issued in /usr/ports on those 14-CURRENT boxes remains stuck forever or it is working > like a snail! > Hitting Ctrl-t on the console gives: > > load: 0.06 cmd: svn 96552 [kqread] 2530.57r 270.92u 5.68s 10% 10584k > mi_switch+0xbe sleepq_catch_signals+0x324 sleepq_timedwait_sig+0x12 _sleep+0x188 > kqueue_kevent+0x2d0 kern_kevent_fp+0x51 kern_kevent_generic+0xdd sys_kevent+0x61 > amd64_syscall+0x10c fast_syscall_common+0xf8 make: Working in: /usr/ports > > > The system is idle otherwise. > > How can this be resolved? Is this phenomenon known? > > Kind regards and thank you very much in advance, > > O. Hartmann > +1. IIRC, d6327ae8c11b was OK, but ebc61c86b556 is not. Unfortunately, I currently don't have enough time to bisect further. :-( As stable/13 is OK via https at 76dd854f47f4, so it wouldn't be a server-side problem. Regards. -- Tomoaki AOKI From owner-freebsd-current@freebsd.org Sat Jan 30 11:01:49 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EE8274E6989 for ; Sat, 30 Jan 2021 11:01:49 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-wr1-x42e.google.com (mail-wr1-x42e.google.com [IPv6:2a00:1450:4864:20::42e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSWVj2Rn3z3kbl for ; Sat, 30 Jan 2021 11:01:49 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-wr1-x42e.google.com with SMTP id q7so11337606wre.13 for ; Sat, 30 Jan 2021 03:01:49 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=sPPaRq9XvckL64JTyUCOnlEWDcYbqUByRTUHhJaan9k=; b=cvTF+GIpsa3DxyTLzQX0DHoG3Jt8qyPEW+HMyeEgpvrdIBdIp8lqecZrtQUGKFVUux AlW/S9Howc9CwXOqrGnA8oAkZH4BU8Q8qlDsFZJG9koAw7qwpOXCkvyX8+XEzpHstUp8 5THnoWeMZ1zuFBbQrFwcySEjeoaDTz6XPbMBe16CeIsupJC/Yqek9zyxcMarC/CopdDX 9FRJcGURmk8ISObTlsUEw5ybyz11h/U8UUfgBisjaxRv+O4cQ8xV8jBmUbacoIWAAgHp j/g3Qf8/IAQWFNcthL/gADQ/Ny03jPNu+8QA34Z2HJ3SFjIJhXCevRtG1lGML66kaYN/ /5Nw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=sPPaRq9XvckL64JTyUCOnlEWDcYbqUByRTUHhJaan9k=; b=uG6r9HsR3NEvJJA2NDpC07wLToh5Zq77upJJFlMfQEwOmSn5I0zPxGR8PdiEdDD7Hq 8mOVKzoQXLJjaR6oHOinDijj31L7k/1mT3bUKWegrIYGQ7bkv4m7ksp72O+EwJ56JWnI 6Qe/zUTP9rkSDpABxXcBB8g939Z5KjKikVbrfozU9nQc04pKryBxNSOkDQJBVyqJ8v4W JZNXyJfWu6OK+1kKBnPdDT0qXMREsUItdN0zhDoHyBvoO2zGe1W9kFVQipGj7tbXGfAj pj6eIBZvaCb2iUfkcrQ5lBoiGLi46S+5EufdksNXJss9T2Y17JIOfBXc33KmbxQ/q5q2 QAgA== X-Gm-Message-State: AOAM532r9iSm7kTPNtvY2x01G6kd7rXYcqUZFpKJ3AVKsW0itXm2GOO1 pEuv+uZUNJZZ0DZo0raPikIWVDwDM47chQ== X-Google-Smtp-Source: ABdhPJwPRicJYH5SWfr1URyJ6n4GDSeZlZrdS2+/Q5X/V6hZ2/JgIQj63pxBQqMLmxRWzmR5CxMCMw== X-Received: by 2002:adf:814f:: with SMTP id 73mr9036829wrm.368.1612004506664; Sat, 30 Jan 2021 03:01:46 -0800 (PST) Received: from [192.168.1.13] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id q16sm20400633wme.1.2021.01.30.03.01.45 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sat, 30 Jan 2021 03:01:45 -0800 (PST) Subject: drm-fbsd13-kmod and drm-current-kmod package descriptions To: freebsd-current@freebsd.org References: <0909b672-9c39-5a55-de97-93edab009e22@twcny.rr.com> <20210129110532.d7342f3c50de156881b23378@bidouilliste.com> From: Graham Perrin Message-ID: Date: Sat, 30 Jan 2021 11:01:44 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: <20210129110532.d7342f3c50de156881b23378@bidouilliste.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-GB X-Rspamd-Queue-Id: 4DSWVj2Rn3z3kbl X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=cvTF+GIp; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::42e as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-3.99 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_EQ_ENVFROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::42e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-0.99)[-0.990]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::42e:from:127.0.2.255]; MIME_TRACE(0.00)[0:+]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::42e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 11:01:50 -0000 On 29/01/2021 10:05, Emmanuel Vadot wrote: > On Fri, 29 Jan 2021 04:59:27 -0500 > monochrome wrote: > >> correct me if I'm wrong, but shouldn't it say: >> >> Currently corresponding to Linux 5.4.62 DRM. >> >> instead of: >> >> Currently corresponding to Linux 4.16 DRM. >> >> got caught by this while trying to update drm-devel-kmod from ports on >> stable/13, and took a chance that it was just an oversight :) > Indeed, just fixed this. > > Thanks, Also: 253092 – graphics/drm-current-kmod and graphics/drm-fbsd13-kmod package messages are wrong From owner-freebsd-current@freebsd.org Sat Jan 30 11:05:13 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D69244E6B81 for ; Sat, 30 Jan 2021 11:05:13 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-wm1-x330.google.com (mail-wm1-x330.google.com [IPv6:2a00:1450:4864:20::330]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSWZc75nRz3lPw for ; Sat, 30 Jan 2021 11:05:12 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-wm1-x330.google.com with SMTP id j18so8703264wmi.3 for ; Sat, 30 Jan 2021 03:05:12 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:references:to:cc:from:message-id:date:user-agent :mime-version:in-reply-to:content-language; bh=X5K5jD07o7Pr8+k5w/s15lwP1FzM4pu95+NL0yIfci4=; b=kYwzL+dCasYtFDTbr5BWLN8xf2snidRXdTuUMQ723xHb2rc8rxnUw86Rmh4Rjwp4Tr x7GrYIaZfJA99dNSrFJLoqkMXXPNbGSbXkMmQFVej7Ply9bihewksAJa7rf+/xvXgMOo aHMptOyChucERELEZ/6y5w3Fi6l0NCVmN7GiAxdEytVx5uP1FnJUopRSkAOmVnrSIek3 1oHX5tASZEecVv1qVkw6w+a8Ib10Mu2KaMEVuGr01XbLFkA/wg1xwsTvBRcjyLawLexg vhGJKUGfMJm2mxSHgupV69GwmjT1ldz+A2QPFU+vTz2IsvIJp6HuXE4lpaimheCAWEoG ow3g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:references:to:cc:from:message-id:date :user-agent:mime-version:in-reply-to:content-language; bh=X5K5jD07o7Pr8+k5w/s15lwP1FzM4pu95+NL0yIfci4=; b=MR5NQiPJWfy+MFLbHGjMz8pEmjwK/by7CyVXYYrWshjhPhZidp7N/FWgyXDUowK+KJ 18+KLPPx61YuEyzxlltnzNcbwh5Vx8gPS+aJ0msB1Q6EF28g9kfzex80mR4yNAn5irod kh0RAKumVaFwGlstMerwUSP7uhs/ggp+dw8HK59ZESVfIO9hXqBFjwhVP3lAgMId6C7X fQ3W18ey59x6dKUYz4Vcb4azb5q3EljbvetlcqvBvKnQHxBYr2mCDqsVSJNAYMQ3n6Il AMshPN2t2lLDR0AkqYPbDNXsbGiaALK9IfO0BDjuUV3Yyv+JFrIsAuNwBAM8DENDpfAn ek1Q== X-Gm-Message-State: AOAM531TPG8AXBuqjzkwWZwYr0XHKTWSMWn/rOFV10UV7rylCDCYefph 2L4SMafwplPgj5b274dlPAnypc4XqdMhBQ== X-Google-Smtp-Source: ABdhPJx4ZL4IawT5WMLZsP9pOBFG+fP4SjIs6SBSy0lC3VNcRNs9P4DdcqyfUIFP4V6wT2chkGLKGg== X-Received: by 2002:a1c:4e17:: with SMTP id g23mr7646453wmh.171.1612004711734; Sat, 30 Jan 2021 03:05:11 -0800 (PST) Received: from [192.168.1.13] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id a17sm13665767wrx.63.2021.01.30.03.05.10 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sat, 30 Jan 2021 03:05:10 -0800 (PST) Subject: Fwd: Best way to submit patches for -current References: To: FreeBSD CURRENT Cc: Marc Veldman From: Graham Perrin X-Forwarded-Message-Id: Message-ID: <9c4eae62-322f-c8b1-14d1-6b5e96deddcf@gmail.com> Date: Sat, 30 Jan 2021 11:05:10 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.1 MIME-Version: 1.0 In-Reply-To: Content-Language: en-GB X-Rspamd-Queue-Id: 4DSWZc75nRz3lPw X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=kYwzL+dC; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::330 as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::330:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::330:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::330:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 11:05:13 -0000 -------- Forwarded Message -------- Subject: Best way to submit patches for -current Date: Fri, 29 Jan 2021 13:48:21 +0100 From: Marc Veldman To: freebsd-hackers@freebsd.org Hello, now that FreeBSD has moved to Git, what is the recommended way to provide patches? A GitHub or GitLab Merge Request against the FreeBSD main branch? Or a (set of) patches generated with git format-patch, the output of gitt diff Or any other way? Best regards, Marc From owner-freebsd-current@freebsd.org Sat Jan 30 11:14:11 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8C4744E7217; Sat, 30 Jan 2021 11:14:11 +0000 (UTC) (envelope-from pi@freebsd.org) Received: from home.opsec.eu (home.opsec.eu [IPv6:2001:14f8:200::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSWmz1RjGz3m34; Sat, 30 Jan 2021 11:14:11 +0000 (UTC) (envelope-from pi@freebsd.org) Received: from pi by home.opsec.eu with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1l5oCW-000LPM-0i; Sat, 30 Jan 2021 12:14:00 +0100 Date: Sat, 30 Jan 2021 12:14:00 +0100 From: Kurt Jaeger To: freebsd-current@freebsd.org, freebsd-fs@freebsd.org, Xin Li Subject: Re: zpool upgrade to draid feature: does it require updated zfs boot code ? Message-ID: References: <7a2b946a-636c-5aae-1129-adbf73168b70@delphij.net> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <7a2b946a-636c-5aae-1129-adbf73168b70@delphij.net> X-Rspamd-Queue-Id: 4DSWmz1RjGz3m34 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; local_wl_from(0.00)[freebsd.org]; ASN(0.00)[asn:12502, ipnet:2001:14f8::/32, country:DE] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 11:14:11 -0000 Hi! > > Short question: > > Does a zpool upgrade on 14.0 (current) for the draid feature > > require a boot code update ? > > Long version of the same question: > > With the draid update, no message was displayed. > > > > Does it require the bootcode update anyway or, if not, why not ? > > This sounded like a bug. Is it your boot pool, or just a regular data pool? Its my boot pool. > > gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 1 nvd0 > > gpart bootcode -b /boot/pmbr -p /boot/gptzfsboot -i 1 nvd1 > > To answer your short question: do I need to update bootcode? No if > draid is the only feature that you have enabled on an existing pool, but > personally I don't recommend upgrading boot pool right now. The boot pool shows: zroot feature@draid enabled local > The reason for that "No" answer is 1) the boot code do not currently > support draid, and 2) enabling the feature won't activate it until draid > vdev is added to the pool, which is quite unlikely in your case; note > that if you do add draid vdev, your bootcode won't be able to boot from > it anymore. Ok. -- pi@opsec.eu +49 171 3101372 Now what ? From owner-freebsd-current@freebsd.org Sat Jan 30 11:34:27 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DE6374E7E43 for ; Sat, 30 Jan 2021 11:34:27 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail.madpilot.net (vogon.madpilot.net [159.69.1.99]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSXDL2NSZz3n0S for ; Sat, 30 Jan 2021 11:34:26 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail (mail [192.168.254.3]) by mail.madpilot.net (Postfix) with ESMTP id 4DSXDH735pz6dVT; Sat, 30 Jan 2021 12:34:23 +0100 (CET) Received: from mail.madpilot.net ([192.168.254.3]) by mail (mail.madpilot.net [192.168.254.3]) (amavisd-new, port 10026) with ESMTP id 6SZMJKJySkpT; Sat, 30 Jan 2021 12:34:21 +0100 (CET) Subject: Re: (n244517-f17fc5439f5) svn stuck forever in /usr/ports? To: junchoon@dec.sakura.ne.jp, freebsd-current@freebsd.org References: <20210130073923.0b2a80c1@hermann.fritz.box> <20210130192520.e7cf7f680c0abd31b0771107@dec.sakura.ne.jp> From: Guido Falsi Message-ID: <18e15d74-d95b-76b7-59a4-64a8f338ba73@madpilot.net> Date: Sat, 30 Jan 2021 12:34:21 +0100 In-Reply-To: <20210130192520.e7cf7f680c0abd31b0771107@dec.sakura.ne.jp> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DSXDL2NSZz3n0S X-Spamd-Bar: - X-Spamd-Result: default: False [-1.00 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[159.69.1.99:from]; R_DKIM_ALLOW(-0.20)[madpilot.net:s=bjowvop61wgh]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx:c]; MISSING_MIME_VERSION(2.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[159.69.1.99:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[madpilot.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[madpilot.net,quarantine]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:24940, ipnet:159.69.0.0/16, country:DE]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 11:34:27 -0000 On 30/01/21 11:25, Tomoaki AOKI wrote: > On Sat, 30 Jan 2021 07:39:23 +0100 > "Hartmann, O." wrote: > >> We recently updated to FreeBSD 14.0-CURRENT #9 main-n244517-f17fc5439f5: Fri Jan 29 >> 16:29:50 CET 2021 amd64. After make delete-oldfiles/delete-old-libs, the command >> >> make update >> >> issued in /usr/ports on those 14-CURRENT boxes remains stuck forever or it is working >> like a snail! >> Hitting Ctrl-t on the console gives: >> >> load: 0.06 cmd: svn 96552 [kqread] 2530.57r 270.92u 5.68s 10% 10584k >> mi_switch+0xbe sleepq_catch_signals+0x324 sleepq_timedwait_sig+0x12 _sleep+0x188 >> kqueue_kevent+0x2d0 kern_kevent_fp+0x51 kern_kevent_generic+0xdd sys_kevent+0x61 >> amd64_syscall+0x10c fast_syscall_common+0xf8 make: Working in: /usr/ports >> >> >> The system is idle otherwise. >> >> How can this be resolved? Is this phenomenon known? >> >> Kind regards and thank you very much in advance, >> >> O. Hartmann >> > > +1. > IIRC, d6327ae8c11b was OK, but ebc61c86b556 is not. > > Unfortunately, I currently don't have enough time to bisect > further. :-( I'm running 07d218f70c2f and it is affected, this restricts the range slightly more. -- Guido Falsi From owner-freebsd-current@freebsd.org Sat Jan 30 15:22:55 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E08144F0456 for ; Sat, 30 Jan 2021 15:22:55 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail.madpilot.net (vogon.madpilot.net [159.69.1.99]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSdHz02wBz4gZs for ; Sat, 30 Jan 2021 15:22:54 +0000 (UTC) (envelope-from mad@madpilot.net) Received: from mail (mail [192.168.254.3]) by mail.madpilot.net (Postfix) with ESMTP id 4DSdHx1cPJz6dWw; Sat, 30 Jan 2021 16:22:53 +0100 (CET) Received: from mail.madpilot.net ([192.168.254.3]) by mail (mail.madpilot.net [192.168.254.3]) (amavisd-new, port 10026) with ESMTP id wbtkBbpur7z3; Sat, 30 Jan 2021 16:22:51 +0100 (CET) Subject: Re: (n244517-f17fc5439f5) svn stuck forever in /usr/ports? To: junchoon@dec.sakura.ne.jp, freebsd-current@freebsd.org References: <20210130073923.0b2a80c1@hermann.fritz.box> <20210130192520.e7cf7f680c0abd31b0771107@dec.sakura.ne.jp> <18e15d74-d95b-76b7-59a4-64a8f338ba73@madpilot.net> From: Guido Falsi Message-ID: Date: Sat, 30 Jan 2021 16:22:50 +0100 In-Reply-To: <18e15d74-d95b-76b7-59a4-64a8f338ba73@madpilot.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4DSdHz02wBz4gZs X-Spamd-Bar: - X-Spamd-Result: default: False [-1.00 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[madpilot.net:s=bjowvop61wgh]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[159.69.1.99:from]; MISSING_MIME_VERSION(2.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[159.69.1.99:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[madpilot.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[madpilot.net,quarantine]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:24940, ipnet:159.69.0.0/16, country:DE]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 15:22:55 -0000 On 30/01/21 12:34, Guido Falsi via freebsd-current wrote: > On 30/01/21 11:25, Tomoaki AOKI wrote: >> On Sat, 30 Jan 2021 07:39:23 +0100 >> "Hartmann, O." wrote: >> >>> We recently updated to FreeBSD 14.0-CURRENT #9 >>> main-n244517-f17fc5439f5: Fri Jan 29 >>> 16:29:50 CET 2021  amd64. After make delete-oldfiles/delete-old-libs, >>> the command >>> >>> make update >>> >>> issued in /usr/ports on those 14-CURRENT boxes remains stuck forever >>> or it is working >>> like a snail! >>> Hitting Ctrl-t on the console gives: >>> >>> load: 0.06  cmd: svn 96552 [kqread] 2530.57r 270.92u 5.68s 10% 10584k >>> mi_switch+0xbe sleepq_catch_signals+0x324 sleepq_timedwait_sig+0x12 >>> _sleep+0x188 >>> kqueue_kevent+0x2d0 kern_kevent_fp+0x51 kern_kevent_generic+0xdd >>> sys_kevent+0x61 >>> amd64_syscall+0x10c fast_syscall_common+0xf8 make: Working in: >>> /usr/ports >>> >>> >>> The system is idle otherwise. >>> >>> How can this be resolved? Is this phenomenon known? >>> >>> Kind regards and thank you very much in advance, >>> >>> O. Hartmann >>> >> >> +1. >> IIRC, d6327ae8c11b was OK, but ebc61c86b556 is not. >> >> Unfortunately, I currently don't have enough time to bisect >> further. :-( > > I'm running 07d218f70c2f and it is affected, this restricts the range > slightly more. > I tried bisecting the kernel only between d6327ae8c11b and 07d218f70c2f, but got no results. Looks like the problem is not in the kernel but somewhere else (libc? ssl?) Bisecting the whole system is going to take longer. I'll try to find the time. -- Guido Falsi From owner-freebsd-current@freebsd.org Sat Jan 30 17:23:14 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id ADBFC4F346C for ; Sat, 30 Jan 2021 17:23:14 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from wout1-smtp.messagingengine.com (wout1-smtp.messagingengine.com [64.147.123.24]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSgyn5r9Fz4pRp for ; Sat, 30 Jan 2021 17:23:13 +0000 (UTC) (envelope-from tech-lists@zyxst.net) Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by mailout.west.internal (Postfix) with ESMTP id 7326EF90 for ; Sat, 30 Jan 2021 12:23:12 -0500 (EST) Received: from mailfrontend2 ([10.202.2.163]) by compute1.internal (MEProxy); Sat, 30 Jan 2021 12:23:12 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=zyxst.net; h= date:from:to:subject:message-id:mime-version:content-type; s= fm1; bh=NULUx1isG38HLbNyqI6DdXUUD/MsG//5WM37rkB+0fc=; b=aJFXlTje J7Q6RzbuhJgAvHhjIzijZ0dsSmZpu1NNfeB89afrI4BOnI1xDUswLDvMQtMU7mpE ddAhe6NV7bRX8KurkCFEHLDGgeXqXs3Q1ZtC8JM4m6hKSCjXuJQohvM5xRGKHzTY bYG9xHhunnb5gQ2ZcfORnkvCZ1HLrEaDZzj66tG29a5Q14jLnX4+hGJ+NG/j9UTg yFK0GafGW9NORR06AReXTYXkKq2cnSujAoIOHx9n2FKlpGkYJ1DsBMkM6AX3TB/9 GM5QjQDy3e+4itEg/dmwXH4/EKKsZSkCHRnUF3Fq+ad9xk6dQawRkld1UKELxoGs hCUXMWeDsh3ktQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:message-id :mime-version:subject:to:x-me-proxy:x-me-proxy:x-me-sender :x-me-sender:x-sasl-enc; s=fm1; bh=NULUx1isG38HLbNyqI6DdXUUD/MsG //5WM37rkB+0fc=; b=pOMBqTKrWRSJcFLiUVgpdNm2PWA21esCmnM+4FL+Rh0+F 6wTcURyg3dY8lg827KgepjH5PaoYcwIlG9DJr/FmX6sCpA+79UPj8Sg1RWOU6U6O 9dx6Kcm+KQN/3TeaxpvGJvFwb/t2aTYxF7VQ1LBsPs6SV5B8u5m0gEa8RFKPDBTT kh+Vro6kGZrCY/59KsNfwkEgAxNr4/E5E0Qs6EMD0RtIbkLyYbAHyCcoJ3tfs04C ZWQOugq4GEQFQKybr77lGj4r4OEgCNZtEnCw7jMpLJBvlTokkyYeHcq1MFirq8gJ p55agQuihzU34kI9ravoVdUvIGmSgEKCC2QWpdrWQ== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduledrfeeggddutdduucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpeffhffvuffkgggtugesghdtreertd dtvdenucfhrhhomhepthgvtghhqdhlihhsthhsuceothgvtghhqdhlihhsthhsseiihiig shhtrdhnvghtqeenucggtffrrghtthgvrhhnpeevgffhffdtfeekleelhedtjeelvdfhvd egieejveffgfduvdfhteegjeeujeeuieenucfkphepkedvrdejtddrledurddutddunecu vehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepthgvtghhqd hlihhsthhsseiihiigshhtrdhnvght X-ME-Proxy: Received: from ceres.local (fws.zyxst.net [82.70.91.101]) by mail.messagingengine.com (Postfix) with ESMTPA id 8F81C1080059 for ; Sat, 30 Jan 2021 12:23:11 -0500 (EST) Date: Sat, 30 Jan 2021 17:23:09 +0000 From: tech-lists To: freebsd-current@freebsd.org Subject: trying to make release with git-derived 14-current Message-ID: Mail-Followup-To: freebsd-current@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="1/nqxHtbFf+h+/NM" Content-Disposition: inline X-Rspamd-Queue-Id: 4DSgyn5r9Fz4pRp X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=zyxst.net header.s=fm1 header.b=aJFXlTje; dkim=pass header.d=messagingengine.com header.s=fm1 header.b=pOMBqTKr; dmarc=none; spf=pass (mx1.freebsd.org: domain of tech-lists@zyxst.net designates 64.147.123.24 as permitted sender) smtp.mailfrom=tech-lists@zyxst.net X-Spamd-Result: default: False [-5.70 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[zyxst.net:s=fm1,messagingengine.com:s=fm1]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[64.147.123.24:from]; R_SPF_ALLOW(-0.20)[+ip4:64.147.123.24:c]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-current@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[zyxst.net]; DKIM_TRACE(0.00)[zyxst.net:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:11403, ipnet:64.147.123.0/24, country:US]; MAILMAN_DEST(0.00)[freebsd-current]; RCVD_IN_DNSWL_LOW(-0.10)[64.147.123.24:from] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 17:23:14 -0000 --1/nqxHtbFf+h+/NM Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hi, I'm trying to make release with -current on a rpi4b/8GB. Basically, I have a working rpi4B/8GB with a no-debug kernel running -current. However, release(7) says a lot about svn and nothing about git. What's the method with git? thanks, --=20 J. --1/nqxHtbFf+h+/NM Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQIzBAABCAAdFiEE8n3tWhxW11Ccvv9/s8o7QhFzNAUFAmAVlfYACgkQs8o7QhFz NAUG1RAAjlQiOo0FquJkDlqZHw1sz6uK3RDWka1jQ59oCctUhOAEL9V0w9p4xZpM 0rHqgfEZlLjuAHA65wz1SVLAzCs6A81/GiyfT1KuGlDgxkLiTBrBijM2vxK2fIbp oPkem3AS13g0RWG/QAxWysVQB3lNbXZZRgjWuruDXIHt9UENFXiEWwTAGLLr2Fiu xFC0qm8noxhLCdv5eAoqVdNqjCNQs9tKf8sklFApiHP8A0X40vr7MREFa89pLuKu vVePreZJJTqpIT6AxVCL+wEGpnoT54VL46WDse8o0nu4vJCaLLF1KT400Cp2BzFJ mtzkjAxAeS3HlAKIDiHr8EnZziIbYLYh3q58XA6YoQHVGKD8/Z1DS8xe42WlHByO NXy8DU5qAHw2aPlvXSzi7RC8kcClz0NPSqIuhA7A7rGnw1Fvc8GJgKNOa31vyyrq SVfG7tYSnzAtPlM+YpiEyAJ5CfkwoU5Lk3ypZaXYhhOtVwryBKI8w3XRcqnLZHaF /rHNBD+xLYRG7hooHj+483H1nGCryN/jJEvJ1RW4NRwHGYRew/lOIGKFOrPgvRlI ymW/K/p+9XynJju7JeKhFDf8ZWvV2Rn+oNFm3rlzklDpRoCbOg8QmBJsA6AURBiV M6fsWVi3hI7B4plugzKzUnQDAjL54iXhJDssVRaGYeiGWQ/7k5g= =pCHr -----END PGP SIGNATURE----- --1/nqxHtbFf+h+/NM-- From owner-freebsd-current@freebsd.org Sat Jan 30 21:42:34 2021 Return-Path: Delivered-To: freebsd-current@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8662A4FA09C for ; Sat, 30 Jan 2021 21:42:34 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic307-55.consmr.mail.gq1.yahoo.com (sonic307-55.consmr.mail.gq1.yahoo.com [98.137.64.31]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DSnk13dtzz3LJv for ; Sat, 30 Jan 2021 21:42:33 +0000 (UTC) (envelope-from marklmi@yahoo.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1612042951; bh=3KOhDutr5HR1S8e3jv4lxJMkXK0OYpEP3DUl/Scpmj2=; h=From:Subject:Date:To:From:Subject:Reply-To; b=lNKt9E9P5k9O6fE6j4q0l2E+er0ORE6svacAf5dgG2Rgj2O9tB9bT2CQv37btJMAu8qqoZ44GZl+toEHrG/VhnhiV2vpqK8Z3nGxRAXHX5wFV3FOY/5jMlN/3IN3LvUZA1ALGOV0SNAomNYsmtSBauIwtYn1hnzFyf4nxL/kfU0yoXa5r1tPcqurYJXCgMRZc09IqSv2b06ED8ZteoQhUvcFAtWq+YXCETzzcgLGIDTAKohnQg/m0SdC5/PhJrGM0uvVBZpLKRd+J1f7pcrm/UANDyyg20C8Xp/+f35TvDCSn98VAc0ONorViKRsXAkmvnLOFuFllSfK1Ij7jOCG3w== X-YMail-OSG: ojVrp70VM1kTl5rDVKKoExOF4g6K7c.9Jp5VQvq0DYwSjV6YxnZZII2Nq4or6wd lIhlOIyHJRmVHgYoOatSXAOQJ0JttJ1RD4_ebmxx34x3cFpBY1YbyRFbr8MEraapOIfSDdVdtqsc bDj_KP26IuG1e4JshLl4pVtN9Izkwq9pNcakQEg47I_7_VWXH48o8WwJJnEV1PqLn5eMxFp.CBSz sD1MoQaNaB4nJPh542.WNB2oTl9MCEOHb24dgv86L70mc3z0oZ3LTec..D5stnqgzAJdhc81DPcG w9zcH1W_KZnuCWc2AH.vlM_AZ3L2sbR6l0aBjEDnP8mEItBfeC.Atj__bsdpdiDqkyh54jLvAHae NK45BnYJBYM8iutTbE_.na8fGY4t_Y5uiKz7g8lgfzEB8hwttspZ6gb9kIixJfjbCvJA8bGhgIey FM9EhQInT9XIbmcfAY9MW59B5ZnyqO4tCNebS_u3Mpg4q6e_oevocXCugRDiRmHLv41O1nIotJO1 WiWofkR9lgORi7_mtcbBIrlsau5eyLTe6J31m8RI6x2zOG8rZrxkSytdwe8sO2HxaTiER4Bej07X KhyFzFCJEixWLsBtgRZ7HrCaZRkCZxXwDpDREVScJCoLsoW.MSszEpQYEi8QSrouANyOTfmZbYoD NnMt9MQk2zf0Oix5GNJcCIJIEXDMoXDHdB0nNtFtt1CQ8uRnnH8TDJAO1y2FD3Zb6B1x37Y3ZKVU MJ_3RBX0XUzraDtjDcI5mljBX8THEYv7Yt1.Wtq6I.gkTRpRwpx9_J6C2wnbwxemkMlyHEx05daO P2k3HbbTbkOA5eyhbFVbhcQBTWnL6VUVlxmpVayjDPvh9252T9kOayEL0YPJM8opPidKErzBtD2C TXEyoiBm6PhcB5Fz1PKYpwMBDMpPei7QvfnNxPAv.nuZQdRv.klYKjDj.d0iYaJz4Tn_7L9FyQTY VTY5ZOQEb4ZilhhhHjZC_GvdwVKFpKbMcABzP_c0PJrONiJdhc6zfZPUQmfmW0SMKfG8MrL3fUrx Kte3ZBJ48jz2.Fp4V4ro20meeuKKGhT4WMMgrRrQFo9..aciMYaCqnoC5Hp8LmwnQNnCzrzjlKkS eLP9qz1qJBtjfXFyJAuH98unehmdlafHx.iXWgpdVTEkgonld5YvwekFP0GxTRoa7mEH63hAVFMV UGfGZcX5fH0K7hO2NLlZjLwTorECvDKIqSMCL6kziLk0KyKa9givXMWogr.mBYjndLC5uNJNrvxC p6QLWLOc1EAQXuMSljOaR_ECbNnQQH8gV5q_a4EtMIgcaifJf3919iKwdIKdc3hLnP71E3CRz3dm EXIvpqTikgefIG3K.47.JRS4qjqenzfDMYTSEO3E4JN0H6AQYTbswm_0cfJ8FLg3BrF1nCglzSun _EcZ0ELT439gcDNH6PfMjbjJMVYp8j_D8VdQpOtEcvaPQGhA9IWC1KNzRRAbzPYT4ZmmoEX9.wx7 E5CC0Kkcyw2CYDo4xVmZUV7c53R1ePj1lnAqcg96EO0vFYIKoh.r7CkJ29sTmDrhOzjk8FuG5K5v IA.8ZiHWcJSUqGrMRMzSDks6L2UKkvYNEObM2L6VYoxdsV6aMQ8hSO3HPGHmVN9QNJa6eKtaarHg WCaz9da3iC3VvZtOWCx9pFl6q3X9Rn4jwcNqrlmPtdDeZouBnrjdPPj4BbNC_EgfZyM.kIv0A01O HxJsZaopp6qu4uDKHtudoq8INeJRuRueT5hT0R681HNsJi3SvYbYWwJn51b4g8M9UbyRfBXE9FBN Z2ROgmyxsqCsDxG.aCOBTx_Ru4IYMjrojBAtHGSU.TXxMnzhVR6R.IbHHc7yBVt.zo63or9KZZ1D _KastcbALXbeFnRk8b9T9ZyrQTNU6WeqGF4ugTIKJy7qVcSSjmPm6HLuY9ZdKp.6OgYmtFmil73G IjVoqVwQN4syw_wdAu1BmKtAsEQpH2c6dS_MpFOJjL3g6UBL7Qf10AvR5Bkte8rLvYn8uMkMbgy7 qmvgTcLBJEBsIxKHdZgJCpz9ZnxXIHlMZxZBiqu9w0NX30RwZdlboD.FtnoMoSFTqnUTLlx1Wdgy wivjaRcgsgLzMBHBZvCiDeobt1.7BHPE5Lwwz8XQjzeiD1qUH2YFUVf7ZImamL7pEQzJHsz5PBEJ ZyK8HOSSQaIbYUOy18jO7u7Xyai.xeyhfKMuoQCn_Sp5hbTgaZ1DJVcuNiBXJsIW9ss4IlVuCxeU emlGwUVqeHJqUGtVIB5YUQaqQehK0IGNq1RYXMIEAQg9.sg3dlfofLA8ZKA0pygIfdnBuketVeFi aent_Rb0eK29aR8jNfF5WmJpw3wF1xKixkGL.acMqqKieNfEw.2u5KpWQFzH0kKwIDWJUa9IN8kp u2tKU8aUjQP6oyh_Cw4aB3tK42PppkaASvSt_USZ0d6RNcWJpMWCQQKSWP2_E_6IaHbrg8q2GLkr xhckJbtN4Ip3_p1NY7brUNMqlca67OQJuLniOUNinVA-- Received: from sonic.gate.mail.ne1.yahoo.com by sonic307.consmr.mail.gq1.yahoo.com with HTTP; Sat, 30 Jan 2021 21:42:31 +0000 Received: by smtp425.mail.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID b597b2041f1615422ff1cba0ee7913f9; Sat, 30 Jan 2021 21:42:28 +0000 (UTC) From: Mark Millard Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: gcc bootstrap or such outdated references in src.conf and make.conf for 13 and 14 Message-Id: <2C4CB713-423A-45C1-8DB6-2E69E034E90C@yahoo.com> Date: Sat, 30 Jan 2021 13:42:25 -0800 To: Ed Maste , Current FreeBSD X-Mailer: Apple Mail (2.3654.40.0.2.32) References: <2C4CB713-423A-45C1-8DB6-2E69E034E90C.ref@yahoo.com> X-Rspamd-Queue-Id: 4DSnk13dtzz3LJv X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[yahoo.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.31:from]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; SPAMHAUS_ZRD(0.00)[98.137.64.31:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.31:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.31:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-current] X-BeenThere: freebsd-current@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: Discussions about the use of FreeBSD-current List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 30 Jan 2021 21:42:34 -0000 QUOTE from man src.conf : To be able to build the system, either gcc or clang bootstrap must be enabled unless an alternate = compiler is provided via XCC. END QUOTE QUOTE from man src.conf : The CCACHE_COMPILERCHECK option defaults to content when using the in-tree bootstrap compiler, and mtime when using an external compiler. The CCACHE_CPP2 option is used for Clang but not GCC. END QUOTE With clang/clang++ 11's change to what -O means, I'm not sure about the following from man make.conf : QUOTE from man make.conf CFLAGS (str) Controls the compiler setting when compiling C = code. Optimization levels other than -O and -O2 are not supported. END QUOTE Same here: QUOTE from man make.conf COPTFLAGS (str) Controls the compiler settings when building = the kernel. Optimization levels above [-O (-O2, ...)] = are not guaranteed to work. END QUOTE Context man outputs are from: # ~/fbsd-based-on-what-freebsd-main.sh=20 merge-base: 3f43ada98c89bce5ae416e203ba0e81595a5cd88 merge-base: CommitDate: 2021-01-29 19:46:24 +0000 e124d7d5fc88 (HEAD -> mm-src) mm-src snapshot for mm's patched build in = git context. 3f43ada98c89 (freebsd/main, freebsd/HEAD, pure-src, main) Catch up with = 6edfd179c86: mechanically rename IFCAP_NOMAP to IFCAP_MEXTPG. FreeBSD FBSDFHUGE 14.0-CURRENT FreeBSD 14.0-CURRENT = mm-src-n244523-e124d7d5fc88 GENERIC-NODBG amd64 amd64 1400003 1400003 =3D=3D=3D Mark Millard marklmi at yahoo.com ( dsl-only.net went away in early 2018-Mar)