From owner-freebsd-questions@freebsd.org Sun Dec 27 17:33:30 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 114094C0C4B for ; Sun, 27 Dec 2020 17:33:30 +0000 (UTC) (envelope-from rahulbharadwajpromos@gmail.com) Received: from mail-io1-xd34.google.com (mail-io1-xd34.google.com [IPv6:2607:f8b0:4864:20::d34]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3npK3BZVz4sDv for ; Sun, 27 Dec 2020 17:33:29 +0000 (UTC) (envelope-from rahulbharadwajpromos@gmail.com) Received: by mail-io1-xd34.google.com with SMTP id p187so7591769iod.4 for ; Sun, 27 Dec 2020 09:33:29 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=Tu/8P4WQlFGaMtOxlxJDZebpaR6sI4N+yhOgyaQKDbY=; b=B7V+b/r1J0T5YoQzq2Br9F9Gds0UMegv01qTvYHSYp19i0kYMXz+9G6jij+lLDlmtr 4VNlVy0QQ4tUIoKS2jEPsXWeCcYfPar1+ZT19aoHdxkI6BMAU/OA+Ph5bJUfjWcQg1jJ lvfiY94rWCWMWqn78czPGNo/dSkylk6FPmVekfnqeUgHk0ORiXYLl8qrIwHPLEHjY7Ck 0S17n/wMGBdKP5NF7GcFQ6ZpI7YPHHDXbvckgxkgeNp1bDkNcXDIHY7Twd2qkJCKSK9L agGYt+SetKiCIN6HR1ltapH7dRXHdhAj8iq33L6LYykH/dge9+zgym7CFK3kkH6KVCXd GSTA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=Tu/8P4WQlFGaMtOxlxJDZebpaR6sI4N+yhOgyaQKDbY=; b=MG6e2bSaP2wJ0oiDfjjejiQZmI9oYmZK4JjohjFdn03Jy2lCV22HkW4WEuKmFtp5q7 UPI8NqRTzaRR1tBuT9g40i5Xn8/HS7J78qYo0U8dWU1q41ocn0xuREBS5TG/OqDzvyCG c/CrCC14LSXJlTbr3wRPkofxFG/jkkbxcCovv9I/y7/mfuDChZaorLICdC0vVarwbF2K FMEfDWEf9SqDAzcx3z9NAkLrWM2dP3r5qz9NOeicS8rmSdXfI4PsbmztrkEZlM5FSt0S Q+VAeNCJ/hnzgGZJYFZgI4teYbNKccyPd6sA5q5L6VFru7uXgn9YCqhYBFcq0gsy8RNd Da2g== X-Gm-Message-State: AOAM533ddWg20XkVsfDH9iZcb1drnrK2mdOltLsq6jiS6kxrQqLpn69Y cYToPP5xNWMUXrc3S+njIneM0nJHiUS8azKw0tTCcTQawh0= X-Google-Smtp-Source: ABdhPJyXRRxySgY6jKlIOSkhInLieNd9fzbTWU4bcCb9Slxpdn4+RvC6iWDZwTMtTppXC0CahjNtzHBKrFdHWKPmLbQ= X-Received: by 2002:a6b:b8d6:: with SMTP id i205mr33636403iof.135.1609090408344; Sun, 27 Dec 2020 09:33:28 -0800 (PST) MIME-Version: 1.0 From: Rahul Bharadwaj Date: Sun, 27 Dec 2020 23:03:17 +0530 Message-ID: Subject: =?UTF-8?Q?What_does_=E2=80=9CNo_anode=E2=80=9D_mean_in_errno_55_when_socke?= =?UTF-8?Q?t_connection_fails=3F?= To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4D3npK3BZVz4sDv X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=B7V+b/r1; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of rahulbharadwajpromos@gmail.com designates 2607:f8b0:4864:20::d34 as permitted sender) smtp.mailfrom=rahulbharadwajpromos@gmail.com X-Spamd-Result: default: False [-1.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d34:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d34:from:127.0.2.255]; NEURAL_SPAM_SHORT(1.00)[0.999]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d34:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 17:33:30 -0000 I was doing a few performance tests on a local server and once in a while I hit an error where opening a socket connection fails. i.e. considering the simplest code: #include #include int main() { /* code to create socket object */ int ret = connect(sock, (struct sockaddr *)&serv_addr, sizeof(serv_addr)); if (ret < 0) { fprintf(stderr, "connect() failed with: %d\n", errno); // <---- *get errno as 55* exit(1); } /* other code */ } There is no explanation for this error number "55". In every place, the only mention is "No anode". There is no mention of what "anode" means and what "No anode" specifically means. Can someone please help me with what this errno means or point me to some documentation explaining the same. Thanks and regards, Rahul. From owner-freebsd-questions@freebsd.org Sun Dec 27 17:50:25 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E57EA4C1B23 for ; Sun, 27 Dec 2020 17:50:25 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.126.134]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3p9r4Wncz4v6s for ; Sun, 27 Dec 2020 17:50:24 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([94.222.15.85]) by mrelayeu.kundenserver.de (mreue010 [212.227.15.167]) with ESMTPA (Nemesis) id 1MJmbB-1kZypb04sb-00KBa1; Sun, 27 Dec 2020 18:50:22 +0100 Date: Sun, 27 Dec 2020 18:50:21 +0100 From: Polytropon To: Rahul Bharadwaj Cc: freebsd-questions@freebsd.org Subject: Re: What does =?UTF-8?Q?=E2=80=9CNo_anode=E2=80=9D?= mean in errno 55 when socket connection fails? Message-Id: <20201227185021.1190a289.freebsd@edvax.de> In-Reply-To: References: Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:SOcixoI/Sm9hGIGFA4/d/FkzParmNGx5UNkRrWl2+nvjGVRrfcL UXhv5dmcLHqe9LJrc8j16Lf1iFG3qJiq3DHE0Q1ZmGBcgzynFerz38Na5JDI9SsU7BMtAHq tCeBt9mb2x7Ygr5gidPhNpbt/sTPCA2WEsV/ZY00mA6IZQ3oKOUkltz5WSi0o20+n/grjq1 BFHEgfqfbQmnTVUGlQZLA== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:EVBlgeDOo84=:uEEbrgYve1GkZnMnBjD4za JtWBUNl5Q1g0PlM78/pYD9XswYsxOX/agiMnea5t0vWZ+hKMNWpaF2l0cnWS7eWBhsivt0QqU HEg1f7Usrq3Sbo3Mni7ZqwoEE3Rem7DGvyksnNXoL05N0nLhUMMB290UVAIEoRLuBKeJJik2V k4T49yjIIK3TISZLrYjiDSHg3yEZxMTlqPUoshVnPlFOTJfTP9M6nbrXliKcY+USGhbv2XNrn fnxZXB8ch8WppO8QMYuIpxY398FgspkOPwn7JV3milBh7OhdARR9XSkGJgZoDiWd89kHsBbBX vZDU1tDj4W11hXzbIOxh6aaMpJc6eNBXM6OLxKz2rVJbBqJSLv/wRLeXfOPk9T859PFAjzFIC T65YzY1v1rq1yxcs6LK+oQyY/YJItQMOxBs8B8NqIBS4ZZTBwcgJjYqdiJoIn X-Rspamd-Queue-Id: 4D3p9r4Wncz4v6s X-Spamd-Bar: ++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of freebsd@edvax.de has no SPF policy when checking 212.227.126.134) smtp.mailfrom=freebsd@edvax.de X-Spamd-Result: default: False [2.02 / 15.00]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.126.134:from]; RECEIVED_SPAMHAUS_PBL(0.00)[94.222.15.85:received]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; NEURAL_SPAM_SHORT(0.62)[0.624]; SPAMHAUS_ZRD(0.00)[212.227.126.134:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[212.227.126.134:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.126.134:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 17:50:26 -0000 On Sun, 27 Dec 2020 23:03:17 +0530, Rahul Bharadwaj wrote: > I was doing a few performance tests on a local server and once in a while I > hit an error where opening a socket connection fails. > > i.e. considering the simplest code: > > #include > #include > > int main() { > /* code to create socket object */ > > int ret = connect(sock, (struct sockaddr *)&serv_addr, > sizeof(serv_addr)); > if (ret < 0) { > fprintf(stderr, "connect() failed with: %d\n", errno); // <---- *get > errno as 55* > exit(1); > } > /* other code */ > } > > There is no explanation for this error number "55". In /usr/include/sys/errno.h, you can find the following entry: #define ENOBUFS 55 /* No buffer space available */ Also in "man 2 intro", the introduction to system calls, there's a section about errno: 55 ENOBUFS No buffer space available. An operation on a socket or pipe was not performed because the system lacked sufficient buffer space or because a queue was full. That doesn't help much, but regarding your example program snippet, it would match the context. > In every place, the > only mention is "No anode". There is no mention of what "anode" means and > what "No anode" specifically means. This is part of the binutils or gcc-libs (in contrib/ subtree of /usr/src, libiberty, or BSM security/ subtree). An anode is probably a kind of or a synonym for an inode (i-node, index node, a filesystem entry). But the error itself does not have to be in this context; it could be that an inode was requested but could not be allocated (filesystem problem), or the kernel ran out of buffer spaces for sockets, so maybe it means "allocation node"? Or maybe it's just one of those occassions where the programmer tought: I don't know what error to return here... ;-) -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Sun Dec 27 17:54:24 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E76954C1F11 for ; Sun, 27 Dec 2020 17:54:24 +0000 (UTC) (envelope-from rahulbharadwajpromos@gmail.com) Received: from mail-io1-xd31.google.com (mail-io1-xd31.google.com [IPv6:2607:f8b0:4864:20::d31]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3pGS1FGHz4vLK for ; Sun, 27 Dec 2020 17:54:23 +0000 (UTC) (envelope-from rahulbharadwajpromos@gmail.com) Received: by mail-io1-xd31.google.com with SMTP id m23so7658953ioy.2 for ; Sun, 27 Dec 2020 09:54:23 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=sDoGFIj5mNIQDPGXjCn1K0tn82UqUA455voKXUsCY+A=; b=q6OpWyAdkYmf7JDadWQYk0YWUIdZ74kjzwGCgEfXN15WAwy8JbPgiiQ4thGypw+e0H itBh6JdG37vhOeO8E9YotmorLz96yYdY27l/AaE5giBRxpCg2ri6+G4eqgpNwj93rDRP JP/qeMQKWk3Wr0loXM9Iqr2WQKDaxVtgDZg34YEJXlXab1dFFSsGWLuCF3A0pKaVMf51 E2qGKStQ3Yr2zrMUaWoKK+Z+xsLlHJpuXIbSxYwEDUuc502P9e/4K+PB6fJVMYCJOx99 yb5NpSwLuf0dYrTZgYQfQj74mcQxoaGgtQIyJaCjHZYF5zqXVwn8cnrd41znJH7A7zql Artw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=sDoGFIj5mNIQDPGXjCn1K0tn82UqUA455voKXUsCY+A=; b=VJg/uexYnbOGyqRgK9Lr40I/fVxNYzHXau4TVqsCe5jnF7miE2iu6P+03inqerxwIk gFwp102ixaFaE2vCMNlyAm0hJcZawTD0eNnEEgwNHnirTHkbOd2v7JgRe+CsszgGWYxj HaPR4OthNPjNAZ/P3TqBYSyEdaPh9BnTc+lNuJlwjW3mg31kSVYJ5vWTAxyHv7bWVZ4c 9C+g7+X6yW+Dr19uBf9JmB5KIiPFUeoy0nti5ma7XqgCwc9pHVxRP8Ypo2P/0hmgmQj7 uJJT7h89pyyDeOBuJgcTlWXAvvwl/JuPn093R9oHkZxuGZWmDNO1FXJA99NC24Lv01xH lCrA== X-Gm-Message-State: AOAM533PlP/S5idxDGUAEkvc59abg6RGVK23MBmajYwdOjWIiLFwAJnr Ltwu/8atBIuMRFZzrVJoqp5w3MkRwGx5nMUh4sAd47jB X-Google-Smtp-Source: ABdhPJx94QmI+rGNjz+VpMHCrKY8oV65ghrSKc5mT63InuwEr3iypNH2/NkM1WtvbZ2WpVsWidhN+qF0MX/BeBWYHgs= X-Received: by 2002:a6b:b8d6:: with SMTP id i205mr33683816iof.135.1609091663062; Sun, 27 Dec 2020 09:54:23 -0800 (PST) MIME-Version: 1.0 References: <20201227185021.1190a289.freebsd@edvax.de> In-Reply-To: <20201227185021.1190a289.freebsd@edvax.de> From: Rahul Bharadwaj Date: Sun, 27 Dec 2020 23:24:12 +0530 Message-ID: Subject: =?UTF-8?Q?Re=3A_What_does_=E2=80=9CNo_anode=E2=80=9D_mean_in_errno_55_when_s?= =?UTF-8?Q?ocket_connection_fails=3F?= To: Polytropon Cc: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4D3pGS1FGHz4vLK X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=q6OpWyAd; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of rahulbharadwajpromos@gmail.com designates 2607:f8b0:4864:20::d31 as permitted sender) smtp.mailfrom=rahulbharadwajpromos@gmail.com X-Spamd-Result: default: False [-2.07 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.07)[-0.070]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d31:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d31:from:127.0.2.255]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d31:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 17:54:25 -0000 I see. I had to look into the FreeBSD source than the internet for the error number. Now the error makes sense. Thank you!! On Sun, Dec 27, 2020 at 11:20 PM Polytropon wrote: > On Sun, 27 Dec 2020 23:03:17 +0530, Rahul Bharadwaj wrote: > > I was doing a few performance tests on a local server and once in a > while I > > hit an error where opening a socket connection fails. > > > > i.e. considering the simplest code: > > > > #include > > #include > > > > int main() { > > /* code to create socket object */ > > > > int ret = connect(sock, (struct sockaddr *)&serv_addr, > > sizeof(serv_addr)); > > if (ret < 0) { > > fprintf(stderr, "connect() failed with: %d\n", errno); // <---- > *get > > errno as 55* > > exit(1); > > } > > /* other code */ > > } > > > > There is no explanation for this error number "55". > > In /usr/include/sys/errno.h, you can find the following > entry: > > #define ENOBUFS 55 /* No buffer space > available */ > > Also in "man 2 intro", the introduction to system calls, > there's a section about errno: > > 55 ENOBUFS No buffer space available. An operation on a socket or > pipe > was not performed because the system lacked sufficient buffer > space or because a queue was full. > > That doesn't help much, but regarding your example program > snippet, it would match the context. > > > > > In every place, the > > only mention is "No anode". There is no mention of what "anode" means and > > what "No anode" specifically means. > > This is part of the binutils or gcc-libs (in contrib/ subtree > of /usr/src, libiberty, or BSM security/ subtree). An anode is > probably a kind of or a synonym for an inode (i-node, index node, > a filesystem entry). But the error itself does not have to be in > this context; it could be that an inode was requested but could > not be allocated (filesystem problem), or the kernel ran out of > buffer spaces for sockets, so maybe it means "allocation node"? > > Or maybe it's just one of those occassions where the programmer > tought: I don't know what error to return here... ;-) > > > > > -- > Polytropon > Magdeburg, Germany > Happy FreeBSD user since 4.0 > Andra moi ennepe, Mousa, ... > From owner-freebsd-questions@freebsd.org Sun Dec 27 18:00:47 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 573424C1DD7 for ; Sun, 27 Dec 2020 18:00:47 +0000 (UTC) (envelope-from 4250.82.1d4c70001c68609.b11f5748e11171bd570ec364d58bcb72@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3pPp4vZLz4vlf for ; Sun, 27 Dec 2020 18:00:46 +0000 (UTC) (envelope-from 4250.82.1d4c70001c68609.b11f5748e11171bd570ec364d58bcb72@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1609092047; x=1611684047; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=EAXjaQic/CLstlfcokE4uHirUZR75jFAJaSRS6fncZg=; b=TJqHKwioeI9RF2ZzN1wM0bJvQ6tUbauDurSO5fwezbNAglT/gkJ0A/LF+7CEZnnQFyxUwUEudVr+BfLhQu4gu+T7d77qIQcbPYrZ54Ws9Fga7ldNbyMJOJCIoewJvaRERi0L3FhCHk/SmclPA0x0Q2wefXEnoxeIdqZkjamYdt0= X-Thread-Info: NDI1MC45Mi4xZDRjNzAwMDFjNjg2MDkuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r2.us-east-2.aws.in.socketlabs.com (r2.us-east-2.aws.in.socketlabs.com [142.0.189.2]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 27 Dec 2020 13:00:42 -0500 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r2.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 27 Dec 2020 13:00:41 -0500 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ktaLQ-00042b-06; Sun, 27 Dec 2020 18:00:40 +0000 Date: Sun, 27 Dec 2020 18:00:39 +0000 From: Steve O'Hara-Smith To: Rahul Bharadwaj Cc: freebsd-questions@freebsd.org Subject: Re: What does =?UTF-8?B?4oCcTm8gYW5vZGXigJ0=?= mean in errno 55 when socket connection fails? Message-Id: <20201227180039.b789620029802222e1add768@sohara.org> In-Reply-To: References: X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D3pPp4vZLz4vlf X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=TJqHKwio; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4c70001c68609.b11f5748e11171bd570ec364d58bcb72@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4c70001c68609.b11f5748e11171bd570ec364d58bcb72@email-od.com X-Spamd-Result: default: False [-1.70 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; RWL_MAILSPIKE_GOOD(0.00)[142.0.176.198:from]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-0.995]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4c70001c68609.b11f5748e11171bd570ec364d58bcb72@email-od.com]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4c70001c68609.b11f5748e11171bd570ec364d58bcb72@email-od.com]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[142.0.176.198:from]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 18:00:47 -0000 On Sun, 27 Dec 2020 23:03:17 +0530 Rahul Bharadwaj wrote: > I was doing a few performance tests on a local server and once in a while > I hit an error where opening a socket connection fails. > > i.e. considering the simplest code: > > #include > #include > > int main() { > /* code to create socket object */ > > int ret = connect(sock, (struct sockaddr *)&serv_addr, > sizeof(serv_addr)); > if (ret < 0) { > fprintf(stderr, "connect() failed with: %d\n", errno); // <---- > *get errno as 55* > exit(1); > } > /* other code */ > } > > There is no explanation for this error number "55". In every place, the > only mention is "No anode". There is no mention of what "anode" means and > what "No anode" specifically means. I have no idea where you got that "No anode" from, let alone what it means (no inode I could perhaps understand but not in this context). For many things (including this) the best documentation is in the man pages that are on the system. > Can someone please help me with what this errno means or point me to some > documentation explaining the same. man errno Is where you will find the error numbers described in some detail, the entry for error number 55 is: ------------------------------------------- 55 ENOBUFS No buffer space available. An operation on a socket or pipe was not performed because the system lacked sufficient buffer space or because a queue was full. ------------------------------------------- There is an enormous amount of documentation in the man pages, it's almost all reference style documentation which makes figuring out where to look harder than it should be (man -k for keyword searches helps somewhat) - OTOH nobody has found a good solution to that in all the decades I've been using unices. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Sun Dec 27 18:01:51 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id F25294C1EFE for ; Sun, 27 Dec 2020 18:01:51 +0000 (UTC) (envelope-from 4250.82.1d4c70001c686ec.3ed6f8a051da4f761b9431febf588683@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3pR31S2Nz3BpP for ; Sun, 27 Dec 2020 18:01:50 +0000 (UTC) (envelope-from 4250.82.1d4c70001c686ec.3ed6f8a051da4f761b9431febf588683@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1609092111; x=1611684111; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=4XsE1zDGE34CWcuFl55CPC66NN2/i4WY0cDYVPCUASY=; b=CH+MOxQMpgi9Z+l6JEQvnnW6Aa3XVEFeHZsZwLbH55+i0pzBy6ZbDcG1jm56RQaPWVP5IAuKDXbgMexl6u0XVafxfWFfkeSjjcSQjUVgcQjZQLClYd76FDBTX/BV0aZXYzD+Hq2s4ZTMtrg8V0BHXPdP1+7u6VnaJviepcyxuLM= X-Thread-Info: NDI1MC45Mi4xZDRjNzAwMDFjNjg2ZWMuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r1.us-east-2.aws.in.socketlabs.com (r1.us-east-2.aws.in.socketlabs.com [142.0.189.1]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 27 Dec 2020 13:01:50 -0500 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r1.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 27 Dec 2020 13:01:49 -0500 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ktaMV-00042j-T9 for freebsd-questions@freebsd.org; Sun, 27 Dec 2020 18:01:48 +0000 Date: Sun, 27 Dec 2020 18:01:47 +0000 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: What does =?UTF-8?B?4oCcTm8gYW5vZGXigJ0=?= mean in errno 55 when socket connection fails? Message-Id: <20201227180147.41991ec25c79c16c16cdf651@sohara.org> In-Reply-To: References: <20201227185021.1190a289.freebsd@edvax.de> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D3pR31S2Nz3BpP X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=CH+MOxQM; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4c70001c686ec.3ed6f8a051da4f761b9431febf588683@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4c70001c686ec.3ed6f8a051da4f761b9431febf588683@email-od.com X-Spamd-Result: default: False [-1.69 / 15.00]; RWL_MAILSPIKE_GOOD(0.00)[142.0.176.198:from]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20:c]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; NEURAL_HAM_SHORT(-0.99)[-0.993]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4c70001c686ec.3ed6f8a051da4f761b9431febf588683@email-od.com]; SUBJECT_ENDS_QUESTION(1.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; MIME_TRACE(0.00)[0:+]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4c70001c686ec.3ed6f8a051da4f761b9431febf588683@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[142.0.176.198:from]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 18:01:52 -0000 On Sun, 27 Dec 2020 23:24:12 +0530 Rahul Bharadwaj wrote: > I see. I had to look into the FreeBSD source than the internet for the > error number. Now the error makes sense. The man pages *really* need to be more discoverable. I wish I knew how! -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Sun Dec 27 18:24:02 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 579024C2B52 for ; Sun, 27 Dec 2020 18:24:02 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.17.13]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3pwd1dXmz3DCj for ; Sun, 27 Dec 2020 18:24:00 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([94.222.15.85]) by mrelayeu.kundenserver.de (mreue106 [212.227.15.183]) with ESMTPA (Nemesis) id 1MN4ux-1kdImA0khZ-00J6eF; Sun, 27 Dec 2020 19:23:59 +0100 Date: Sun, 27 Dec 2020 19:23:58 +0100 From: Polytropon To: "Steve O'Hara-Smith" Cc: freebsd-questions@freebsd.org Subject: Re: What does =?UTF-8?Q?=E2=80=9CNo_anode=E2=80=9D?= mean in errno 55 when socket connection fails? Message-Id: <20201227192358.8fb10bb6.freebsd@edvax.de> In-Reply-To: <20201227180147.41991ec25c79c16c16cdf651@sohara.org> References: <20201227185021.1190a289.freebsd@edvax.de> <20201227180147.41991ec25c79c16c16cdf651@sohara.org> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:EUPuyIfC5CvCciYC8zsIbhhv0f12PSmNjlEFRXVaKVh8nes4T2C LWdRGSFId9YmjKpTBD1wFai41/CU7H8fyYa7X/YHQC+T/jgoX3nKeVAtMpIuXGxqtynuu98 n7iSV5KT6PLOgKaS3Zx3OcAEtuIUkE7nBRqyc1v5mcCShM+6FPhSdfnfJEgv63+E8t+srQ6 oBjeqUzxKZJ9ZqP4dLNOA== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:H1V6jhcepY0=:3z7JIWJn3wtlYVWsvKZnyI rJ2cN/xgb03jQ27Y84CGy4O2F+WAyW4lfjJgRSZMJMFWKoZm9OZehclK3ijkssa0PqQHNPTBb C1470LMB851S1/8jGE/YAARtsJViA2QVZvgN2RRPuG4JOHtr1fDhvUo40sLBCd8VR7tUsv1DU ohr5wAzdMGgede+7wJ/9++ZguuABwGNNC6SbPKY/Od8z/F9AfJ6vclCoIaA1KkOZjC8CKBm4H qD8eUFIECmGbLHhxC+h5jR4ssZLtpeLxFUzYmWuUfIUmnaMZojKRz1ypcfB5KpmTigl+Z3SlX hu9r6yXQYDtMp3YXRaglAyO7cgfKl+r+98xLLfm1EyH2MeIqOHazXQn59H5aX9jxYK+auTRtO wsteGBCkqlNKkHiXHIoR6dAq9WGyimxGGmmSC8SGIwqxPrt4QOJ2HoDTmVhiQ X-Rspamd-Queue-Id: 4D3pwd1dXmz3DCj X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of freebsd@edvax.de has no SPF policy when checking 212.227.17.13) smtp.mailfrom=freebsd@edvax.de X-Spamd-Result: default: False [0.40 / 15.00]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; R_DKIM_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.17.13:from]; RECEIVED_SPAMHAUS_PBL(0.00)[94.222.15.85:received]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[212.227.17.13:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[212.227.17.13:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.17.13:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 18:24:02 -0000 On Sun, 27 Dec 2020 18:01:47 +0000, Steve O'Hara-Smith wrote: > On Sun, 27 Dec 2020 23:24:12 +0530 > Rahul Bharadwaj wrote: > > > I see. I had to look into the FreeBSD source than the internet for the > > error number. Now the error makes sense. > > The man pages *really* need to be more discoverable. I wish I knew > how! Conversion to HTML and use of a local search engine accessed by a web browser? Or maybe xman? :-) -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Sun Dec 27 19:16:56 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AF61F4C438A for ; Sun, 27 Dec 2020 19:16:56 +0000 (UTC) (envelope-from 4250.82.1d4c70001cc4647.7bf69cee5a658d38b0d558b247b1b50f@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3r5f6DkYz3HL6 for ; Sun, 27 Dec 2020 19:16:54 +0000 (UTC) (envelope-from 4250.82.1d4c70001cc4647.7bf69cee5a658d38b0d558b247b1b50f@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1609096615; x=1611688615; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=dVbJjZbYPsxDrOiJ6EGRK8JYvX4eeCJcraGfGzi2upQ=; b=J2kP9I/YRAy0ZA3KqEjeTnQfb7DXFqyU3M+LS0/nLvHL4yU0E+F4/5D320WVxpb+sNpCni7H5UM2NGEW/rAC2XFtag0k9EibHDAM9rTclVwvMnO7CbGn5pSr5Ehc/mWRRPfqRqFUDq70DXUxuYJgaSodfsiT5BSZdbSM01TQgNk= X-Thread-Info: NDI1MC45Mi4xZDRjNzAwMDFjYzQ2NDcuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r1.sg.in.socketlabs.com (r1.sg.in.socketlabs.com [142.0.179.11]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 27 Dec 2020 14:16:45 -0500 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r1.sg.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 27 Dec 2020 14:16:45 -0500 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ktbX1-0004Up-RZ; Sun, 27 Dec 2020 19:16:43 +0000 Date: Sun, 27 Dec 2020 19:16:43 +0000 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Cc: Polytropon Subject: Re: What does =?UTF-8?B?4oCcTm8gYW5vZGXigJ0=?= mean in errno 55 when socket connection fails? Message-Id: <20201227191643.479926b62614febbd1d90268@sohara.org> In-Reply-To: <20201227192358.8fb10bb6.freebsd@edvax.de> References: <20201227185021.1190a289.freebsd@edvax.de> <20201227180147.41991ec25c79c16c16cdf651@sohara.org> <20201227192358.8fb10bb6.freebsd@edvax.de> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.1) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D3r5f6DkYz3HL6 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=J2kP9I/Y; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4c70001cc4647.7bf69cee5a658d38b0d558b247b1b50f@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4c70001cc4647.7bf69cee5a658d38b0d558b247b1b50f@email-od.com X-Spamd-Result: default: False [-1.70 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; RWL_MAILSPIKE_GOOD(0.00)[142.0.176.198:from]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4c70001cc4647.7bf69cee5a658d38b0d558b247b1b50f@email-od.com]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4c70001cc4647.7bf69cee5a658d38b0d558b247b1b50f@email-od.com]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[142.0.176.198:from]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 19:16:56 -0000 On Sun, 27 Dec 2020 19:23:58 +0100 Polytropon wrote: > On Sun, 27 Dec 2020 18:01:47 +0000, Steve O'Hara-Smith wrote: > > On Sun, 27 Dec 2020 23:24:12 +0530 > > Rahul Bharadwaj wrote: > > > > > I see. I had to look into the FreeBSD source than the internet for the > > > error number. Now the error makes sense. > > > > The man pages *really* need to be more discoverable. I wish I > > knew how! > > Conversion to HTML and use of a local search engine accessed > by a web browser? Or maybe xman? :-) Both have been done without much success - the "which man page do I need to read" problem is a hard one with experience being the usual tool and that fails when new stuff turns up unnoticed (sysrc had been around for some time before I stumbled onto it for example). -- Steve O'Hara-Smith | Directable Mirror Arrays C:\>WIN | A better way to focus the sun The computer obeys and wins. | licences available see You lose and Bill collects. | http://www.sohara.org/ From owner-freebsd-questions@freebsd.org Sun Dec 27 19:42:15 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 49F254C4AB8 for ; Sun, 27 Dec 2020 19:42:15 +0000 (UTC) (envelope-from kudzu@tenebras.com) Received: from mail-lf1-x12e.google.com (mail-lf1-x12e.google.com [IPv6:2a00:1450:4864:20::12e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3rfs6cNHz3JpY for ; Sun, 27 Dec 2020 19:42:13 +0000 (UTC) (envelope-from kudzu@tenebras.com) Received: by mail-lf1-x12e.google.com with SMTP id o17so19780247lfg.4 for ; Sun, 27 Dec 2020 11:42:13 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=tenebras-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=RE/vrNwSTEjzNNnXRcU4Iw1xOOCjP0jIocadEseXuxU=; b=vWgbZdu0htFkgbAgvAqVfrf6Pkp0J7yDbhJ7EPHAyAgdT3DTxDGg5ra5qqlnd5OJfM 0CU7wxI99D7CM6kqVo1kFvki6MTaW6a7SbewT4KLiTiV8+1I1vQTg4QeLG0bwrTFvEsS 19QDJDjWlHkvNBitTXCJEK78/HpTEiBxj1N5gRwmrPrD2gXF1XoRUnNowkPBTWAbjZXY CfmYnrLczqRnw2SgiIhaEAfyFuf4gsIW0XPppcwTowmjdCWKObR5tOvFAXWZY5/dgkGL NWHIf6jAGWZwQpvNb/aXoYLDVbt0s9FIyRx9tmTatJaFwE65stvCBGlk8deMkp6bA5Sb 26VA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=RE/vrNwSTEjzNNnXRcU4Iw1xOOCjP0jIocadEseXuxU=; b=Y05coGSVfy283lVINd3KgFcez/07KP4LHx+G6ogF8Mk+kgA+Ls5ucJQZr/t5EGf4bu IjBU+sNzuBMrQAl4iPZMtvya6BeA1g9ekygsafvKceXynEbTkonePvCqTEJ9sJBCwGRS EiluyOn32BQWaRw3Mmd78y/3jaQgHG/g/EL0BwEEGWzeHoR3vQL0FzXqkkEztppJkzSG wNlW6n7f9v7UmijyP04aB0JRmuk7SZ9KCEXoGuoNvHr1ZTYBf3G7hS4T5yMXaT9cuuNW APg1RGkuB+Yt9v5tRtraUkDCptiQIZgn6S3ZwTnXPCfAliJwFUCdKHdW9+NmqnZ9/GQi 0a9w== X-Gm-Message-State: AOAM533tMQlUcBr4O8CqnW7y2cgrYgTRKRt8IYTi5xdKwYHY8rfJHMPe 6dMIXwDArwelGkfgMABsAM73mN/ompFV04UI/uWlwcRJSL7Nxw== X-Google-Smtp-Source: ABdhPJzQHJWhCIT5efQN+4KURKxWqdKT521GuDztLy6PLn4yoC1g3vr86Jh5rdJWTIrDFLdjHnqBHbcSssDgbPy9Xk0= X-Received: by 2002:a05:651c:87:: with SMTP id 7mr19823872ljq.312.1609098131960; Sun, 27 Dec 2020 11:42:11 -0800 (PST) MIME-Version: 1.0 References: <20201227185021.1190a289.freebsd@edvax.de> <20201227180147.41991ec25c79c16c16cdf651@sohara.org> <20201227192358.8fb10bb6.freebsd@edvax.de> <20201227191643.479926b62614febbd1d90268@sohara.org> In-Reply-To: <20201227191643.479926b62614febbd1d90268@sohara.org> From: Michael Sierchio Date: Sun, 27 Dec 2020 11:41:36 -0800 Message-ID: Subject: =?UTF-8?Q?Re=3A_What_does_=E2=80=9CNo_anode=E2=80=9D_mean_in_errno_55_when_s?= =?UTF-8?Q?ocket_connection_fails=3F?= To: FreeBSD Questions X-Rspamd-Queue-Id: 4D3rfs6cNHz3JpY X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=tenebras-com.20150623.gappssmtp.com header.s=20150623 header.b=vWgbZdu0; dmarc=none; spf=none (mx1.freebsd.org: domain of kudzu@tenebras.com has no SPF policy when checking 2a00:1450:4864:20::12e) smtp.mailfrom=kudzu@tenebras.com X-Spamd-Result: default: False [-2.29 / 15.00]; RCVD_TLS_ALL(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::12e:from]; R_DKIM_ALLOW(-0.20)[tenebras-com.20150623.gappssmtp.com:s=20150623]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[tenebras.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::12e:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[tenebras-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-0.99)[-0.988]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::12e:from]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 27 Dec 2020 19:42:15 -0000 On Sun, Dec 27, 2020 at 11:17 AM Steve O'Hara-Smith wrote: >- ...the "which man page do I > need to read" problem is a hard one with experience being the usual tool > and that fails when new stuff turns up unnoticed (sysrc had been around f= or > some time before I stumbled onto it for example). > > I have often longed for a complete, annotated list of sysctl MIBs. --=20 "Well," Brahm=C4=81 said, "even after ten thousand explanations, a fool is = no wiser, but an intelligent person requires only two thousand five hundred." - The Mah=C4=81bh=C4=81rata From owner-freebsd-questions@freebsd.org Mon Dec 28 00:42:14 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A01714CC81E for ; Mon, 28 Dec 2020 00:42:14 +0000 (UTC) (envelope-from tundra@tundraware.com) Received: from oceanview.tundraware.com (oceanview.tundraware.com [45.55.60.57]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mailman.tundraware.com", Issuer "mailman.tundraware.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D3zK15kZLz4S9Y for ; Mon, 28 Dec 2020 00:42:13 +0000 (UTC) (envelope-from tundra@tundraware.com) Received: from [192.168.0.2] (ozzie.tundraware.com [75.145.138.73]) (authenticated bits=0) by oceanview.tundraware.com (8.16.1/8.16.1) with ESMTPSA id 0BS0enZk096697 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128 verify=NO) for ; Sun, 27 Dec 2020 18:40:49 -0600 (CST) (envelope-from tundra@tundraware.com) To: FreeBSD Mailing List From: Tim Daneliuk Subject: 11-STABLE to 12-STABLE Migration Questions Autocrypt: addr=tundra@tundraware.com; prefer-encrypt=mutual; keydata= xsFNBFlVgYoBEADIYD9W4mbKz5cEleX923hagDWkxyJl4kRiMJnz+dNAH71MItSdErMb0cFt CPxVncb4dR4R2ec0c0MjPcgVINNtbY1DMWsF7t31TKD8NG9ZjLqF6fZDFjgkRejqHytgjmCI UejrMSCf0UJsLtg+I3N1ZVVxd7ALj2bCvC/uc5S7j+YbNnhQvSoBbdFj/xOTjyOGGpk7WfB7 e42PGKq1NSgnI7tcY6HSaSH+LHeoc0yUpBb5A1ge+RhR1N9JTniEFe0qvOBi+HgUltEoxsk4 xb6IhpkDOTsxHvEg5h0ukfl8kG9cu+LrEBqwPaC8lPw3UmoTEAU+lXHanPE12JCF/54EtVCc rb4W0vqgGmLJzn5dRU/fWkar0FKPq4eoV0XMbGZKIC6pWQnMEsxEMpNvh7oefK6Kyn+LO+59 +sNYHbv1RImDJccmfHTOA6/jHdwOcnYy37U8UF7e+mGrwNs8GsMQx2AaQbR6VErakH3GBgft bMFOGQxiaRBkbzba7BZCQ060yhiC3/Mb/xHoVi7PBEmKig1SErTMA7Fh3CYPYIRDphNs6OSr tf9O4hbzUAsjbU3rxOfiWQjP3fSOM0KUBj4wpIWZlMrjAGnMIz2wHb211wsBiLqSaGiiO1LR 7RrcvbIFZvHQHiWe2tdRyuH3N/h7A316yoLfx+yy1gyP5weWsQARAQABzSRUaW0gRGFuZWxp dWsgPHR1bmRyYUB0dW5kcmF3YXJlLmNvbT7CwXcEEwEIACEFAllVgYoCGyMFCwkIBwIGFQgJ CgsCBBYCAwECHgECF4AACgkQdoOXo5EJFKntcA/9F9ags9Ik5C49N39iRq+yqBdn/Lr75rqv +Yg7JkjeVlwHpnQt1S6orTC7EaJc+AqY3szCEmhfuT0+E96Bw2k+G/XRnaedZ9SHSdImlmq0 RmOFpWLr67ScvlA9YG1tyR+QYraEFqK5EB6qhOWRJoz1BYtAAntK9b9gUTXt/277sT7lAWaj oPi4CDd4DofHc4E9VRsniMQNMLCWqc/ygAK07cWbK2Rh90tS2C4nK6OHFkNkK94zDilfxod1 NBFTUPPYfEU2CSa3eLlpfhYY3/2X7zNvmmCt+chHUnAhQLhldQ3WlqmTKP+ZK9LX002/bY1O M8Zk76WyA/A3EfsIUbnXBQvFyjwX6W4QEytlZWtp/yRIe64JOa3dZ8rkhragb2N4VgVLBVe3 jtZgfQ72pHrfNk/T0uT+hjFqInvIYiXkhxB2GiD7Ga28VuXojTmeoaW3GKcvoVxONSju7WzD XgyxWRmNpd5uifJcC3YU3tNNAosnQ0/5FW4wkducSEVwwqnAiSMQEMDDa/e6oP6GyOzes5SV LTNCRYdHWVKbxjetYU4SKm5RdLx9XuJo0qL9vO97mCNwdNkTM7gO2ycQ49qUiGbCZJOh2gpP ZRFrpJDxbloosAfOEB6IYjhb38u6jvbScJKK3bWA+a8TK4SrQpdRd1cAnW9sA8jCTV8ejZq0 CHnOwU0EWVWBigEQAJYuihAOOOe/kAn045Ayn+3is3S+6eV4IAgL6lJhoChkgUJJuFoRX9BY rd35z29+q2/UCoProzd4Mk66wXeWv6n4s5R79OUzjgMLCTVlVaMy4gjPL9NRDwMt7KYRF56g mnoKZwfPDi/oJ5toPPboW94FrMwonqbdqYM2Pyi/HPMe4e396WQ4TaA1CdhyzKHoFSpkGcjX zIQ5yQ5aaGS7wonRu/pg15dbu+8QOgxRNFa0bO+ntz/30u+VmxFqFVbExjuy3Or8fSBhJgx4 cfyrrunKLclpZ/52VeK3l53yWYpR8RaTZfzpu8Ih+ijAY4XLO5F8P1T6sEviMaTY2F0sbFRx ZJXsgFpiKeWPHUn7/LX7qcoFJYoFqG6b3n5km+qy39x6lMgJDuxKpeN6lYj//LB6xVzn0JI+ 4ZHPrEkFqxu8VkL7deCPTI67ZJik18jXjTH9sha1YBvgvxIPFMA7ZwXX2AwNu7PzdcCpWarS usOAHbjQBUsQ+ZPpI1oeFnsCPZ+8/mMcTjVRZyJxOPs3KnXZv2cXNuaa7lwkWS366gHzQI7O l6WdC8TyNjiOzR654cL8BgYQ/xNSW1vTXqPWSRU8/b/5IueY2tQJh0CKIvfoP0rk8976wa1R 8SRi08mwHX7+F5oSeXLRNHicQGpS1f0DywdRcQ0MFHyq/CV4dTltABEBAAHCwV8EGAEIAAkF AllVgYoCGwwACgkQdoOXo5EJFKkDNw//c8nailIVOV72l7Lze+2AuK9MYUCFb1i4qI1WTnG0 OHQlCAltPhdwZPAozJw/eNqIcuWQh8rZspve9ipj589wLSsVyaFRsuYXTiYZ9RlRsnJYa36h 2JML3ZGrRsSxaUEAggbiOKbwmw27JuOIPmC3Gln4tJuZ+nw6cfCgMI45bIzinVanxHwPLeLp BZKpaEYzAwtBykUfAXn3jDwrI95UlMJvhHDFuRgvb6uSyJIqmp5aR/BjnlSdEwICyWpRAVSt yqZeBMeHbCr1B97PIRzk/q0eHm9T+AoiZWwz1iVGGgkYdAaCfs2PBlNHmRm93cfgoEcaGvNb RbTXOe28niMJeYMQsnjOTy5AQIrhVKeP5E+qVs/oPK/inmLiTbjZcnrO2wR+uxpPGgmR6M/3 p8qyRdaOvT87HZXO+Wr+r9A4UnwhCPsfELwPlEo+TJQ/oE71Mlkx/ddQCWELcHjXrQF9YbzA Ml7g0zTkgHysh4DNkV5iYteOcmCwsWdOwn0H0yZfz6weyr8nEdPngyOjFNKMIpcTbeg8866c GxXAJj46dub4VdVwfvMRHfmmRJkjdId7YHWMgz2Kf7S7KPCROLis7WjlOdSS0q2m/7qy9WL/ ZW50YLS8ZZLMrnari5JxCyJX+8n6ZASo2AA93iTbKmYegK2LDwW1QLU1iAF3GyGOnSE= Message-ID: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> Date: Sun, 27 Dec 2020 18:40:44 -0600 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:68.0) Gecko/20100101 Thunderbird/68.10.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 7bit X-Greylist: Sender succeeded SMTP AUTH, not delayed by milter-greylist-4.6.2 (oceanview.tundraware.com [45.55.60.57]); Sun, 27 Dec 2020 18:40:49 -0600 (CST) X-TundraWare-MailScanner-Information: Please contact the ISP for more information X-TundraWare-MailScanner-ID: 0BS0enZk096697 X-TundraWare-MailScanner: Found to be clean X-TundraWare-MailScanner-SpamCheck: not spam (whitelisted), SpamAssassin (not cached, timed out) X-TundraWare-MailScanner-From: tundra@tundraware.com X-Spam-Status: No X-Rspamd-Queue-Id: 4D3zK15kZLz4S9Y X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of tundra@tundraware.com designates 45.55.60.57 as permitted sender) smtp.mailfrom=tundra@tundraware.com X-Spamd-Result: default: False [-3.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[45.55.60.57:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+a]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[45.55.60.57:from:127.0.2.255]; DMARC_NA(0.00)[tundraware.com]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:14061, ipnet:45.55.32.0/19, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 00:42:14 -0000 I have several production 11-STABLE systems I want to move to 12-STABLE. I've clone the stable/12 repo and am doing buildworld and buildkernel. Assuming I do mergemaster -Fi successfully, I should be able to happily install a 12-STABLE environment. However ... some questions: - Does 12 have any significant config changes I should be ready for? - Will I have to rebuild all my installed ports? (We don't use packages.) TIA, Tim From owner-freebsd-questions@freebsd.org Mon Dec 28 02:07:27 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3927C4CE1CB for ; Mon, 28 Dec 2020 02:07:27 +0000 (UTC) (envelope-from corey.stephan@marquette.edu) Received: from mx0b-0020b801.pphosted.com (mx0a-0020b801.pphosted.com [148.163.148.69]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.pphosted.com", Issuer "Thawte RSA CA 2018" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D41CK6tgKz4XqT for ; Mon, 28 Dec 2020 02:07:25 +0000 (UTC) (envelope-from corey.stephan@marquette.edu) Received: from pps.filterd (m0094259.ppops.net [127.0.0.1]) by mx0b-0020b801.pphosted.com (8.16.0.43/8.16.0.43) with SMTP id 0BS21kZ5013069 for ; Sun, 27 Dec 2020 20:07:24 -0600 Received: from nam12-dm6-obe.outbound.protection.outlook.com (mail-dm6nam12lp2169.outbound.protection.outlook.com [104.47.59.169]) by mx0b-0020b801.pphosted.com with ESMTP id 35p1fxcgjr-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Sun, 27 Dec 2020 20:07:24 -0600 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=LrHYNewEXBp057skKfwWjvBnyvdV4R3xltD8/kK9Lwq6wXTkluVsT0UANPiqJb6y+DTsrnZ5XydgXXhB/X2lVlqE1DKD9Y57PobEqFX+oJjdQi/WL40holbCQiXwD094gxfQIiOb+h2eHZoFvTshPfQ91XKAZ2GH1jH3sNd8IPWAr5/TEpg1uTWHh3OgtjEiehb+ki78an2jhfb3x1bzv26yM/9mqkY11XsipaNu2vvlOYEO77lyeCWoSdD2gpNlo6FC44PuKJO8gdevoU+bSvUrcR7kMgQvpjY7NWghSojR5psfH58s9k3sFXmyan0z4tW330OckkYNZn1OcFwhCg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=OWYECR/y89MZT7rohfHl+BPO447SXgZkLTwN2HXmxd8=; b=MjgPEMIqpK36qpaRrxTuiuNY1xGbDdg4PLnt6xWsXBaJgUDSuXsw+l8dMBTXZVlUSATCVAwXkCv82LrVAK9cE0NMZaMx6UyReGGLumnpfVRMTp3BfPYOTKDbxHNfKP3408iO2+woLMIgzM+7XXfgaUNXWBoKxWa6lWqWB8Glnp+yjBPc5SnREfXnTFwocB5BAcBy85V+HGQyQyInWZHGd3eNB0EHBEOJ8xNJ7u4OJE9Okd3yuJu74vn6MUrjhIhzyzy4RlzkEWmFj04MBGqXCkraWQFusVek9g4LmaxC7z1V+K5WqEh19u4aQf/Ne40c0mF1+qJbG6GgJvxldIcEYg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=marquette.edu; dmarc=pass action=none header.from=marquette.edu; dkim=pass header.d=marquette.edu; arc=none Received: from DM6PR01MB4747.prod.exchangelabs.com (2603:10b6:5:6c::23) by DM6PR01MB5291.prod.exchangelabs.com (2603:10b6:5:6c::10) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3700.31; Mon, 28 Dec 2020 02:07:16 +0000 Received: from DM6PR01MB4747.prod.exchangelabs.com ([fe80::5cb3:6db3:d37:d48a]) by DM6PR01MB4747.prod.exchangelabs.com ([fe80::5cb3:6db3:d37:d48a%6]) with mapi id 15.20.3700.031; Mon, 28 Dec 2020 02:07:16 +0000 From: "Stephan, Corey" To: "freebsd-questions@freebsd.org" Subject: Raspberry Pi 4 8GB: Boot Hang, (Simple) Workaround? Thread-Topic: Raspberry Pi 4 8GB: Boot Hang, (Simple) Workaround? Thread-Index: AQHW3L4pSBN/uA54c0WP5DEzkg3JLg== Date: Mon, 28 Dec 2020 02:07:16 +0000 Message-ID: Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-originating-ip: [65.30.129.133] x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: ea19170c-a492-4cdf-aee2-08d8aad54cad x-ms-traffictypediagnostic: DM6PR01MB5291: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:10000; x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: a1ykBXTq5GEh8qjtCsjR7FcV7orQG4GMhY7eZpVeB+TQU0Pzy1sRzIyWvwy8byNWN8DrLp0dB6cKOcVFikCiWC8cW5vDuBFQOVWns2mVin1oFJQSahYG0ZN4/qJyQHubNGagN1bEc4hxMPDYn0VdJdxj8zdBAeLwbgqGghR2g4GNmqRAJJGw7oPdKO53u3tS4mm6+N9zm2xts0aJDTKFzAJbI+XsQaqCIlAP1j+DRpUeR8ZblN1pbwfXI2WRFr3JlQBtxpiNVSfiGmhteHf7Ot8h9sFR2TklTI2PJ37xLzRMyzzREw6KFJGl/lLD6Axpib1HjQs7jA3GbDtcbHbWkAROpLIBQP38VA0RJnE/lWpAfJsXYqX42L+yLyPnr6WsM9Tz0rD5IItG28FMIkER58v+GVy3P6WHAd2YB6yc0KZ+OphKezFXiDQEwtwPiGxNiTOz2sVjJv1TfFldBhWR3A== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:DM6PR01MB4747.prod.exchangelabs.com; PTR:; CAT:NONE; SFS:(4636009)(39850400004)(396003)(346002)(376002)(366004)(136003)(7696005)(5660300002)(478600001)(6916009)(9686003)(75432002)(66446008)(33656002)(76116006)(66946007)(52536014)(66476007)(71200400001)(66556008)(6506007)(64756008)(55016002)(91956017)(8676002)(26005)(8936002)(186003)(83380400001)(86362001)(316002)(786003)(966005)(2906002); DIR:OUT; SFP:1101; x-ms-exchange-antispam-messagedata: =?us-ascii?Q?AomOVxf/jPh8z3aOSZIuV8I+KcedADgBF9ZHD/8Xdtz+xZ5vzTuwPcsPf1Jf?= =?us-ascii?Q?0a/UjBWe5cXUNFxUH0XVeGJvpd0Q4dZSiVKyVx8ptbRxlWSX+Q6fKoimKIXy?= =?us-ascii?Q?H7eJH3JhEdD+M71ckDzthnvz5jqKsFnbmwa55UAKyenZd9BYa4ZbgwDVBWOM?= =?us-ascii?Q?0FloHNzZvzSJVzu/iK9dTnHPHKtPdDrzzHKVg28fV/HmuM49ueEnZHPgeMoU?= =?us-ascii?Q?A7TTyPVA0i3gaAZxBXX5tL0CbiRHMvBIoJJcMXOTDCdPKZkhO6lf4T3Bjofu?= =?us-ascii?Q?mxKFV7hOfS1TUV0My/7/SxbLc3mM97+1vGM4FaIDKWWC7WzTFC6Y5d1DsDpo?= =?us-ascii?Q?SYKW6KQ/EevXaNJe2t3SS21iynMuop12rpo+zFWRsFYnrqUSwA69L38oZmJi?= =?us-ascii?Q?xu7uAfpMPg3QLMDwuHX7ZLd8pNBYx4zR+baxAsiiAB5mHVns3sftEYZ1Fbxb?= =?us-ascii?Q?mTk1MHCSLdw3RNw111wA5GjmxGcriyxJNWp4Aq9/+tvAJSQSlbpccEYCNrPp?= =?us-ascii?Q?CqwI5qc4RSkoXn7zIl/J1ZBs+95+zdoWWwOrlGuhKzSBaL2M+fZT//B3he4c?= =?us-ascii?Q?3tGoZuV4rOfvFejB3JZEoHFWQYGqE29HQq9eDQ2fmcNdXa98b7UXlNBEUc5I?= =?us-ascii?Q?wY8qWTDYZSSZKWMW0IZHxGF0J2zyUtoN8/AXE1nATc4wo1Y8pRCteH1l3ziR?= =?us-ascii?Q?zTWoyOJBUX6eLPGY6w49dwmqrWgytOej6+6YODKmEzERN7tZUTGjln37gswo?= =?us-ascii?Q?iHS0KfgYT83Kgx7e8Vz07azjaPM7eyOKkfX2v1GgBeGXY98z/q8A5711Mjz4?= =?us-ascii?Q?si461Wzrw73jP1x9dKUYM5CFYgT0G6msZBCV09m/8kuL70Mr7/hA1UuwnK7r?= =?us-ascii?Q?ZT1/N3gXbNmgtS3gkpGdlZ6q/9Q2lrjlZzhrFeplWpuysQDTV2K+n+yJvCmX?= =?us-ascii?Q?8fqfUlGxsfUFWzLa2c5rkwacbgmTLxC5+SvEPaCZ2+ayFHjXQKLbhGp3dsI2?= =?us-ascii?Q?R4/h?= x-ms-exchange-transport-forked: True Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-OriginatorOrg: marquette.edu X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: DM6PR01MB4747.prod.exchangelabs.com X-MS-Exchange-CrossTenant-Network-Message-Id: ea19170c-a492-4cdf-aee2-08d8aad54cad X-MS-Exchange-CrossTenant-originalarrivaltime: 28 Dec 2020 02:07:16.1583 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: abe32f68-c72d-420d-b5bd-750c63a268e4 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: MT0zsYydYumbOwI1uUYRXf+KUwpi6ofe5JosBh6J0L+ASODj/PgLD/S4LGp5ARENbTPWT51d9nhwyO4GshZPBOZGwAyM3fEvxV4qNg+B8jE= X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR01MB5291 X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2020-12-28_01:2020-12-24, 2020-12-27 signatures=0 X-Proofpoint-Spam-Details: rule=outbound_notspam policy=outbound score=0 spamscore=0 priorityscore=1501 clxscore=1011 mlxlogscore=522 bulkscore=0 impostorscore=0 mlxscore=0 adultscore=0 lowpriorityscore=0 suspectscore=0 phishscore=0 malwarescore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2009150000 definitions=main-2012280010 X-Rspamd-Queue-Id: 4D41CK6tgKz4XqT X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; arc=pass (microsoft.com:s=arcselector9901:i=1); dmarc=none; spf=pass (mx1.freebsd.org: domain of corey.stephan@marquette.edu designates 148.163.148.69 as permitted sender) smtp.mailfrom=corey.stephan@marquette.edu X-Spamd-Result: default: False [-1.30 / 15.00]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[148.163.148.69:from]; RCVD_COUNT_FIVE(0.00)[5]; HAS_XOIP(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:148.163.148.69]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[marquette.edu]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[148.163.148.69:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[148.163.148.69:from]; TO_DN_EQ_ADDR_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:26211, ipnet:148.163.148.0/22, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 02:07:27 -0000 Hello, fellow open source fans. I am attempting to install FreeBSD on a =0A= new Raspberry Pi 4 8GB, but I simply cannot get the device to boot. The =0A= latest Raspberry Pi OS (Raspbian), NOOBS, etc. all work. The Pi's =0A= firmware and BIOS are up-to-date. The SD card is new, stable, and passes = =0A= verification tests.=0A= =0A= Tried: 13.0-CURRENT from Dec-10, 13.0-CURRENT from Dec-03, 12.2-RELEASE, = =0A= 12.2-STABLE, and 12.1-RELEASE images for the Raspberry Pi 3 (RPI3 images = =0A= are recommended in the FreeBSD Wiki: =0A= https://wiki.freebsd.org/arm/Raspberry%20Pi)=0A= =0A= FreeBSD 12-series does not show a boot screen at all, but I more-or-less = =0A= expected as such, since the RPI4 8GB is known to be WIP in 13-CURRENT. =0A= With 13.0-CURRENT, I reach the boot screen, but I am greeted with the =0A= following 2 error messages:=0A= =0A= Error 00000044=0A= =0A= This device requires newer software.=0A= =0A= I have read in the FreeBSD subreddit that this has to do with the =0A= FreeBSD SD card image's bootloader being out of date.=0A= =0A= Does anyone have FreeBSD working on the RPI4 8GB?=0A= =0A= Other: The only advice about this that I have read involves rebuilding =0A= the FreeBSD SD card image. That is above my knowledge. Moreover, of =0A= course, I am sure that the aim of everyone here is to bring FreeBSD to =0A= this popular testing and learning platform :)=0A= =0A= Thank you in advance, everyone. Cheers,=0A= Corey=0A= From owner-freebsd-questions@freebsd.org Mon Dec 28 03:50:04 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 443394CF8CC for ; Mon, 28 Dec 2020 03:50:04 +0000 (UTC) (envelope-from vas@sibptus.ru) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D43Tk3mzvz4dZy for ; Mon, 28 Dec 2020 03:50:02 +0000 (UTC) (envelope-from vas@sibptus.ru) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=In-Reply-To:Message-ID:Subject:To:From:Date; bh=XL152xyXfwIn0fZ/1dEASc4cgkN/3grHAgezW04LXS0=; b=Iu3Y3g6xuQE9MTcDRNYnfRn29h RMBtpVFPTbXRdLLNUgVFWFjY+W7PPPH0Wt45rqenGz72vyOEr4+bachT+itTUEYUVfIikoImA+sY3 euJ1eqozfNtUgMqSIkGGoLNSPoRXEW/b0se5kWrfQVqb5ye0GA3pHqxPX7SL3wNJBfRk=; Received: from vas by admin.sibptus.ru with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ktjXe-0007UB-FZ for freebsd-questions@freebsd.org; Mon, 28 Dec 2020 10:49:54 +0700 Date: Mon, 28 Dec 2020 10:49:54 +0700 From: Victor Sudakov To: freebsd-questions@freebsd.org Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201228034954.GA28466@admin.sibptus.ru> References: <20201223025406.GA25600@admin.sibptus.ru> <20201223104459.GA36737@admin.sibptus.ru> <6cbaa416-0262-c85f-8e74-19a8ac95605d@gmail.com> <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201225152138.GA76538@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="h31gzZEtNLTqOjlF" Content-Disposition: inline In-Reply-To: <20201225152138.GA76538@admin.sibptus.ru> X-PGP-Key: http://admin.sibptus.ru/~vas/ X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 X-Rspamd-Queue-Id: 4D43Tk3mzvz4dZy X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sibptus.ru header.s=20181118 header.b=Iu3Y3g6x; dmarc=pass (policy=none) header.from=sibptus.ru; spf=pass (mx1.freebsd.org: domain of vas@sibptus.ru designates 2001:19f0:5001:21dc::10 as permitted sender) smtp.mailfrom=vas@sibptus.ru X-Spamd-Result: default: False [-5.95 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:19f0:5001:21dc::10:from]; R_DKIM_ALLOW(-0.20)[sibptus.ru:s=20181118]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2001:19f0:5001:21dc::10:from:127.0.2.255]; DKIM_TRACE(0.00)[sibptus.ru:+]; DMARC_POLICY_ALLOW(-0.50)[sibptus.ru,none]; NEURAL_HAM_SHORT(-0.85)[-0.853]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:20473, ipnet:2001:19f0:5000::/38, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 03:50:04 -0000 --h31gzZEtNLTqOjlF Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Victor Sudakov wrote: > Rick Miller wrote: > > > > > > I've never thought I will have to build a kernel with an MFS image > > > within (outside of NanoBSD). How are you going to boot this kernel fr= om > > > iPXE? Put it on an ISO image and sanboot the ISO? > > > > >=20 > > Yes. That is precisely how it is accomplished. >=20 > I see. >=20 > >=20 > > Is it not possible to fetch a GENERIC kernel by loader.efi, then fetch > > > an MFSROOT image as a separate file? This is the way I did the job > > > during the pxelinux (old BIOS based netboot) times. > > > > >=20 > > It seems you refer to loading a kernel and separate ramdisk or initrd. = I've > > heard it rumored there could be preliminary experimental code to accomp= lish > > this, but don't have any evidence. >=20 > It works very well in the old pxeboot environment: >=20 > 1. Place kernel as /tftpboot/boot/kernel/kernel.gz > 2. Place mfsroot as /tftpboot/mfsroot.gz > 3. Configure pxelinux.0 to chainload /pxeboot from TFTP. > 4. pxeboot loads the kernel and mfsroot. >=20 > To accomplish (4), I have the following lines in /tftpboot/boot/loader.co= nf: >=20 > mfs_load=3D"YES" > mfs_type=3D"mfs_root" > mfs_name=3D"/mfsroot" > ahci_load=3D"YES" > vfs.root.mountfrom=3D"ufs:/dev/md0" >=20 >=20 > All this however has become obsolete with the introduction of UEFI. I've tried it with mfsBSD. This approach works with pxelinux/BIOS, but does not with PXE/UEFI, see my last comments in https://github.com/mmatuska/mfsbsd/issues/110 --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --h31gzZEtNLTqOjlF Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJf6VXiAAoJEA2k8lmbXsY0QJgIAIoYVK5AHgGAniSukmTM3TXJ p/TfcSHwq+WfmfntchRmRQb+j1mA8JZZdZT/B/um8DNWROnZ9b3Qc7Nc5rPNVWNt CER79VCb1vkBB5yjS2nApriWXNoxXCip9AAdnvxqj7w/Xlj0wcS/mEbZ65/MSECC yB2oD8kGLVJvARLVxlZuaHpA3JSJJNlYaRTi22hSMc/ZXiebHoBq66CCNccSf+pQ ry9mHUBKXkWk81M5FhRZO5wZJI6o1I9UIeqni3PJ14rsPvcjUCk5j5xCligtiXTK ZiKPDPmMYvrquaH34XwGu8dt0/rfrcTKSfemiHK8H1NVs3/H3y/ReaWDeWQtYNU= =D98U -----END PGP SIGNATURE----- --h31gzZEtNLTqOjlF-- From owner-freebsd-questions@freebsd.org Mon Dec 28 06:38:15 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 44D984D2837 for ; Mon, 28 Dec 2020 06:38:15 +0000 (UTC) (envelope-from 4250.82.1d4c70001d48d9e.4dc934197a95129c23d36ad4072e0adc@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D47Cp2MxFz4lKn for ; Mon, 28 Dec 2020 06:38:14 +0000 (UTC) (envelope-from 4250.82.1d4c70001d48d9e.4dc934197a95129c23d36ad4072e0adc@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1609137494; x=1611729494; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=YACconPjn/cq4JyOLgwB2dgLPHsM7IGc212vSmyvi2Y=; b=V+AZlAYIYkRueU7GfeNmO+kaQautfN+mWt2UhD3R5jGjF398+VEzUtqJ1CMFW44r/pfd3dztV6Bn7xJMEG3WlBFqWSXWZ7SGEjCfnet8ycpijvf8oF02g9VqGBvLTukbaZGgIV0ZjPBYiuEbdjhCXPGY0UY6EeBWjNOWMwyVTIE= X-Thread-Info: NDI1MC45Mi4xZDRjNzAwMDFkNDhkOWUuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.us-west-2.aws.in.socketlabs.com (r3.us-west-2.aws.in.socketlabs.com [142.0.190.3]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 28 Dec 2020 01:38:05 -0500 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.us-west-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Mon, 28 Dec 2020 01:38:03 -0500 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ktmAL-0008P6-8u; Mon, 28 Dec 2020 06:38:01 +0000 Date: Mon, 28 Dec 2020 06:38:01 +0000 From: Steve O'Hara-Smith To: Tim Daneliuk Cc: FreeBSD Mailing List Subject: Re: 11-STABLE to 12-STABLE Migration Questions Message-Id: <20201228063801.fa5a93eb19e85e21730046f3@sohara.org> In-Reply-To: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> References: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D47Cp2MxFz4lKn X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=V+AZlAYI; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4c70001d48d9e.4dc934197a95129c23d36ad4072e0adc@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4c70001d48d9e.4dc934197a95129c23d36ad4072e0adc@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; RWL_MAILSPIKE_GOOD(0.00)[142.0.176.198:from]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4c70001d48d9e.4dc934197a95129c23d36ad4072e0adc@email-od.com]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; MID_RHS_MATCH_FROM(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4c70001d48d9e.4dc934197a95129c23d36ad4072e0adc@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[142.0.176.198:from]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 06:38:15 -0000 On Sun, 27 Dec 2020 18:40:44 -0600 Tim Daneliuk wrote: > - Will I have to rebuild all my installed ports? (We don't use packages.) Yes. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Mon Dec 28 07:09:44 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 306014D2D5B for ; Mon, 28 Dec 2020 07:09:44 +0000 (UTC) (envelope-from dewayne@heuristicsystems.com.au) Received: from hermes.heuristicsystems.com.au (hermes.heuristicsystems.com.au [203.41.22.115]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2560 bits) client-digest SHA256) (Client CN "hermes.heuristicsystems.com.au", Issuer "Heuristic Systems Type 4 Host CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D47w60wcHz4nGW for ; Mon, 28 Dec 2020 07:09:41 +0000 (UTC) (envelope-from dewayne@heuristicsystems.com.au) Received: from [10.0.5.3] (noddy.hs [10.0.5.3]) (authenticated bits=0) by hermes.heuristicsystems.com.au (8.15.2/8.15.2) with ESMTPSA id 0BS77p1R042056 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NOT) for ; Mon, 28 Dec 2020 18:07:52 +1100 (AEDT) (envelope-from dewayne@heuristicsystems.com.au) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=heuristicsystems.com.au; s=hsa; t=1609139272; x=1609744073; bh=PfmnxWVcEplB2UtJ1MsLysJYQVWr5N0Kv/5vyCiVOXg=; h=Subject:To:From:Message-ID:Date; b=SCafHxuGrhrpc3vC0UgynfMx0utpD7fo4dusIuCcwJPBmX/nXyJHIJ/y9LilxtvzJ e+0x0NKMqL2Vty3nOJoFgndILXKcDw20oFFaUtZ7y8kdYeMTf4iqgjyYbA+JQcFsLC KWgtUMw+SErz6u4VzkEx/RdFMD6ropd5vNsw+fZaI7ziN/TP30H7Y X-Authentication-Warning: b3.hs: Host noddy.hs [10.0.5.3] claimed to be [10.0.5.3] Subject: Re: 11-STABLE to 12-STABLE Migration Questions To: freebsd-questions@freebsd.org References: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> <20201228063801.fa5a93eb19e85e21730046f3@sohara.org> From: Dewayne Geraghty Message-ID: <3333c645-3c3e-002c-f356-e2a82bd6794b@heuristicsystems.com.au> Date: Mon, 28 Dec 2020 18:07:59 +1100 User-Agent: Mozilla/5.0 (Windows NT 6.1; rv:78.0) Gecko/20100101 Thunderbird/78.5.1 MIME-Version: 1.0 In-Reply-To: <20201228063801.fa5a93eb19e85e21730046f3@sohara.org> Content-Type: text/plain; charset=utf-8 Content-Language: en-GB Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D47w60wcHz4nGW X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=heuristicsystems.com.au header.s=hsa header.b=SCafHxuG; dmarc=none; spf=pass (mx1.freebsd.org: domain of dewayne@heuristicsystems.com.au designates 203.41.22.115 as permitted sender) smtp.mailfrom=dewayne@heuristicsystems.com.au X-Spamd-Result: default: False [-6.20 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; HAS_XAW(0.00)[]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; TO_DN_NONE(0.00)[]; RCVD_IN_DNSWL_MED(-0.20)[203.41.22.115:from]; DKIM_TRACE(0.00)[heuristicsystems.com.au:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:1221, ipnet:203.40.0.0/13, country:AU]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[heuristicsystems.com.au:s=hsa]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_MED(-2.00)[heuristicsystems.com.au:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[heuristicsystems.com.au]; RCPT_COUNT_ONE(0.00)[1]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 07:09:44 -0000 On 28/12/2020 5:38 pm, Steve O'Hara-Smith wrote: > On Sun, 27 Dec 2020 18:40:44 -0600 > Tim Daneliuk wrote: > >> - Will I have to rebuild all my installed ports? (We don't use packages.) > > Yes. > Tim, The most significant change will be the openssl version. If any of your ports use go, you must include options COMPAT_FREEBSD11 because 12 uses 64 bit inodes. And I'd strongly suggest that you compare the GENERIC kernel config from the 11 and 12 sources that you are and will be using. I run very custom environment and a few things caught me out. Some of the older network cards are no longer supported... Enjoy :) From owner-freebsd-questions@freebsd.org Mon Dec 28 14:01:28 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 89E5F4B61B0 for ; Mon, 28 Dec 2020 14:01:28 +0000 (UTC) (envelope-from acupuncture@cgocable.ca) Received: from mail8136c14.megamailservers.com (mail8136c14.megamailservers.com [66.226.81.36]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4K3C4Wnrz3khF for ; Mon, 28 Dec 2020 14:01:27 +0000 (UTC) (envelope-from acupuncture@cgocable.ca) Received: from [192.168.1.105] (unknown [142.169.96.5]) by mail8136c14.megamailservers.com (mail8136c14) with ESMTPA id 0900E921ADDD4 for ; Mon, 28 Dec 2020 09:01:23 -0500 (EST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=cgocable.ca; s=email; t=1609164086; bh=BRkH+YreepwdVBK2Pq+BD/4JyMTAAA9Mr8c7A017cg4=; h=Subject:To:References:From:Date:In-Reply-To:From; b=Y7Ozib441inipQZvPhL7IdTgHtd7xB3MYwW7SEDkU6+HqKP1jgWQ+EUWQVKkuoh4B khfJ3x7qY0tBBinc2c7UogOlRQSleeQIx9e3O4V7KTJHM5BWER0tNDbJe28iyieXSw vl2Fki/FbGnOn0+W4QMLRPfMjIEs1R9aaQcuSFQE= Feedback-ID: acupuncture@cgo Subject: Re: 11-STABLE to 12-STABLE Migration Questions To: freebsd-questions@freebsd.org References: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> From: LVM Message-ID: Date: Mon, 28 Dec 2020 09:01:14 -0500 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: fr-FR X-CSC: 0 X-CHA: v=2.3 cv=UqAdyN4B c=1 sm=1 tr=0 a=/pFyI045PpMuLuRMUOk8IA==:117 a=/pFyI045PpMuLuRMUOk8IA==:17 a=IkcTkHD0fZMA:10 a=6I5d2MoRAAAA:8 a=sdP5ur3j2UgXaJ8QZvwA:9 a=QEXdDO2ut3YA:10 a=IjZwj45LgO3ly-622nXo:22 X-CTCH-RefID: str=0001.0A742F1C.5FE9E536.002B:SCFSTAT68225434, ss=1, re=-4.000, recu=0.000, reip=0.000, cl=1, cld=1, fgs=0 X-CTCH-VOD: Unknown X-CTCH-Spam: Unknown X-CTCH-Score: -4.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedujedrvdduledgiedvucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffquffvqffrkfetpdfqfgfvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepuffvfhfhkffffgggjggtgfesthekredttdefjeenucfhrhhomhepnfggofcuoegrtghuphhunhgtthhurhgvsegtghhotggrsghlvgdrtggrqeenucggtffrrghtthgvrhhnpeeufeekteevueetveevhfdvleffhfelueeljeekleejheeuffduhefffffhueeljeenucffohhmrghinhepfhhrvggvsghsugdrohhrghenucfkphepudegvddrudeiledrleeirdehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudegvddrudeiledrleeirdehpdhhvghloheplgduledvrdduieekrddurddutdehngdpmhgrihhlfhhrohhmpefnggfouceorggtuhhpuhhntghtuhhrvgestghgohgtrggslhgvrdgtrgeqpdhrtghpthhtohepfhhrvggvsghsugdqqhhuvghsthhiohhnshesfhhrvggvsghsugdrohhrgh X-Origin-Country: CA X-Rspamd-Queue-Id: 4D4K3C4Wnrz3khF X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=cgocable.ca header.s=email header.b=Y7Ozib44; dmarc=none; spf=pass (mx1.freebsd.org: domain of acupuncture@cgocable.ca designates 66.226.81.36 as permitted sender) smtp.mailfrom=acupuncture@cgocable.ca X-Spamd-Result: default: False [-3.60 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:66.226.81.0/24]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[cgocable.ca:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_LOW(-0.10)[66.226.81.36:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RECEIVED_SPAMHAUS_PBL(0.00)[142.169.96.5:received]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[66.226.81.36:from]; DWL_DNSWL_NONE(0.00)[cgocable.ca:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[cgocable.ca:s=email]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; ASN(0.00)[asn:14116, ipnet:66.226.80.0/21, country:US]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[66.226.81.36:from:127.0.2.255]; DMARC_NA(0.00)[cgocable.ca]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 14:01:28 -0000 Le 27/12/2020 à 19:40, Tim Daneliuk a écrit : > I have several production 11-STABLE systems I want to move to 12-STABLE. > > I've clone the stable/12 repo and am doing buildworld and buildkernel. > > Assuming I do mergemaster -Fi successfully, I should be able to happily install > a 12-STABLE environment. > > However ... some questions: > > - Does 12 have any significant config changes I should be ready for? > - Will I have to rebuild all my installed ports? (We don't use packages.) > > TIA, > Tim > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.org" Did just that (with releng). Didn't have to do significant config changes except manually merging files going through mergemaster -Fi. But I'm using GENERIC for kernel. I certainly didn't have to update my (installed) ports after a svn update. From owner-freebsd-questions@freebsd.org Mon Dec 28 16:04:09 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6ACEF4B9B67 for ; Mon, 28 Dec 2020 16:04:09 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "Let's Encrypt Authority X3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4Mmn2MnPz3tqM; Mon, 28 Dec 2020 16:04:09 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from smtp.infracaninophile.co.uk (smtp.infracaninophile.co.uk [IPv6:2001:8b0:151:1:c4ea:bd49:619b:6cb3]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.infracaninophile.co.uk", Issuer "Let's Encrypt Authority X3" (verified OK)) (Authenticated sender: matthew/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 013AEF4F0; Mon, 28 Dec 2020 16:04:08 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from liminal.local (unknown [IPv6:2001:8b0:151:1:e99e:39bf:d42:7457]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: m.seaman@infracaninophile.co.uk) by smtp.infracaninophile.co.uk (Postfix) with ESMTPSA id 47AD51A75C; Mon, 28 Dec 2020 16:04:06 +0000 (UTC) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=none (p=none dis=none) header.from=FreeBSD.org Authentication-Results: smtp.infracaninophile.co.uk/47AD51A75C; dkim=none; dkim-atps=neutral To: LVM , freebsd-questions@freebsd.org References: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> From: Matthew Seaman Subject: Re: 11-STABLE to 12-STABLE Migration Questions Message-ID: <3caeac44-7f1b-5ef9-b0c1-4ceffb2048e5@FreeBSD.org> Date: Mon, 28 Dec 2020 16:04:03 +0000 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.16; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="v0Wxhc7N2HTA47RioMmIROdIC2OPRMh8V" X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 16:04:09 -0000 This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --v0Wxhc7N2HTA47RioMmIROdIC2OPRMh8V Content-Type: multipart/mixed; boundary="IbR3PuelgMG88GyzAa7A3pS87tPnNCLqg"; protected-headers="v1" From: Matthew Seaman To: LVM , freebsd-questions@freebsd.org Message-ID: <3caeac44-7f1b-5ef9-b0c1-4ceffb2048e5@FreeBSD.org> Subject: Re: 11-STABLE to 12-STABLE Migration Questions References: <46f7c65c-877c-7910-186e-fcd0879ab205@tundraware.com> In-Reply-To: --IbR3PuelgMG88GyzAa7A3pS87tPnNCLqg Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-GB Content-Transfer-Encoding: quoted-printable On 28/12/2020 14:01, LVM wrote: > Did just that (with releng). Didn't have to do significant config=20 > changes except manually merging files going through mergemaster -Fi. >=20 > But I'm using GENERIC for kernel. >=20 > I certainly didn't have to update my (installed) ports after a svn upda= te. Careful now. There are some pitfalls here that you could run into some=20 time down the line. * Most of the shared libraries (certainly all of the important ones) in= the FreeBSD base system use symbol versioning. Meaning that a binary compiled on an older version of the OS with shlibs using an older ABI version can still dynamically link against the latest version of the shlib. Effectively the shlib contains the entire sequence of ABI versions since they started doing the versioning thing, which was way back around 7.x-RELEASE IIRC. So all of your 11.x binaries will still run on a 12.x system, as you have observed. * For simple applications, which only rely on the shlibs from the FreeBSD base, and don't do any dynamic loading of modules you can upgrade them at will -- the 'compiled for 12.x' binaries may reference a more up-to-date ABI version than other ported applications compiled for 11.x, but there's no chance of conflict * Any other software with more complex dynamic linking requirements can be a problem. You may, or may not, find things unexpectedly crashing when you later do a routine ports update. The trouble occurs when you end up trying to dynamically link two different ABI versions from the same shared library into the same executable. This can happen in a number of ways. For example: Port A links to a shared library from port B. Both the application A and the library B need to link against the base system libc.so Now, if you install an update to A (links to libc ABI from 12.x) but not B (still links to libc ABI from 11.x) then you're looking at this sort of potential version conflict. Same applies if you update B but not A. It's not a guarranteed failure -- the details of exactly what symbols A and B reference are important. The same sort of considerations apply to many perl, python, PHP etc. modules or to Apache loadable modules. So, you don't need to reinstall all your ports immediately you upgrade,=20 but you are at risk of problems when you later incrementally upgrade=20 your installed ports. For absolute peace of mind the simplest course is to force a re-install=20 of all of your ports. That's overkill really, as many ports don't even=20 contain any compiled binaries, but it's probably quicker overall than=20 sitting down and trying to work out what really has to be reinstalled. This analysis doesn't apply to loadable kernel modules: those _will_=20 have to be upgraded to match the upgraded kernel. Neither does it apply = to certain applications that know "too much" about the internals of the=20 kernel memory -- lsof(1) being the poster child here. Cheers, Matthew --IbR3PuelgMG88GyzAa7A3pS87tPnNCLqg-- --v0Wxhc7N2HTA47RioMmIROdIC2OPRMh8V Content-Type: application/pgp-signature; name="OpenPGP_signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="OpenPGP_signature" -----BEGIN PGP SIGNATURE----- wsF5BAABCAAjFiEEGfFU7L8RLlBUTj8wAFE/EOCp5OcFAl/qAfQFAwAAAAAACgkQAFE/EOCp5OeA xg/+JQ3Pkso8EpJfqr7YgE/TMOShMAV1js1+HiI3HFRHQPifbUjCakYYc/L0B5UlR+/7LbyHdQTT lJY/blamYj+XUEcAxsRCEr9ODC2UwZwrBRToIowRnASVPaMxyalTFVDUCPcqOkItKeb2IN2TMYji gpdvDxbL21MuXIaXSzusQnIjc+4ZZ15USBQTj/RO3tv8hGDZB+noQu27wD7vOgnnOqj8r9IFVx/u N9p18SPJN/pj/lvf2rs7lB59OQzzbYQqQtxO0l/XRAH8ns+1VQCHuf7Bj+GqPyBlqA5biNJz0Vnn +mftVqal6JF1CyO7V0zgF8sHvkp2eVl3HhYZLhPYu5Y9Zeo80AXQWeSDcVRn+9HksoxLpYcU14m0 03visaa3yuPZUz6ZE2u8DWnJSA/oTSoowGzm3mc58+QSSn1eeaKwRRxSgoZXKcA1DuK84zX9ROTO KtFVbPM8XM5CM8uSgTqsXVFliun6NkgE7TyWYfkV9DSAEJ3w0zm/qh0Lbcwq6XaP+VIy3AaTD3xb IO3xW+O4bbsoxrHPucLp00Zvc5YVr/Qzs708ow5wnYBWRx1OTaa+Nfu2jDWeA3nq61D3wimhqGUj HigftfNCxO2JtMvde3hW9jOn3KEc+VtIT+/mIyYQ4K0TnVyp59l4yLPZMvHW3BnzHP23oAocDjXN 4a4= =zmBG -----END PGP SIGNATURE----- --v0Wxhc7N2HTA47RioMmIROdIC2OPRMh8V-- From owner-freebsd-questions@freebsd.org Mon Dec 28 20:41:32 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6C5884C0A0B for ; Mon, 28 Dec 2020 20:41:32 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-wr1-x435.google.com (mail-wr1-x435.google.com [IPv6:2a00:1450:4864:20::435]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4Twq3dgNz4hNr for ; Mon, 28 Dec 2020 20:41:31 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-wr1-x435.google.com with SMTP id a12so12455588wrv.8 for ; Mon, 28 Dec 2020 12:41:31 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:cc:from:message-id:date:user-agent :mime-version:in-reply-to:content-transfer-encoding:content-language; bh=gqurZ01naF8zwEh90XxnQ6I8YMX6Fiw01WFpLj4J/wQ=; b=Y8F+vgdTm7E0eRA/uaIBaAp4SKaudhb776OPvA8gQDqagS9grUjCKZXZ/Ub2+L1jrM I1mVghJJmUiZ2nyDyzfwyubey8QaLm8SDy+602iCBqRgfEd4MHDz6LMUzgrGiH8bKmJ3 6R9lSxbskIWr6BPfncb+VtzQ82D+J3tskjvM5jdVVJ+FjaCcnEaZcPbZJ/juYKulmYnX codItgjrndEjOswozyfyrBw7mqpAmie8ptz64VaV8q+GlC0ZovApXO//R77p2dsP3XkV Nqgbm1vPjsVeoluRISbSyEmk0HV4lTWVnEOgungl90Q45rNqha/ooHGlKD0arfUo/zEF UOnA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:cc:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=gqurZ01naF8zwEh90XxnQ6I8YMX6Fiw01WFpLj4J/wQ=; b=i86hdJkCNOC/lOhkAVzt6PjUEqhDKpabp+nPpW3GHJmRXPpvk19DRp5L5Rq9UEdidK LFhIvOuUgW6nAqY9+pfvzCOQ3m+Tp9+/vTK3TdEBUS/qrKQyZElkMLuWCss+f8eIPChZ BTSskRYVotbbzWfD4Lxin/+xNs+1V5mHuz8EHQ3CScqWySnG6258+58CSobgutFaRwe3 mXxjeKeXUb//jKLXXKf4J6dyLv2mAS5vUVzebgIbGVLlG0A71BcKe8DPbBt2rq4UQgFg XqZVwqgLXl1D/SHZHN2aWvPXH+74r2GCTDCnSn3kjBNqyWKw5BhHYX2Ta2XMULefWwUA 5DGQ== X-Gm-Message-State: AOAM530958kFZbUHH1Tt/AmPKZsgqUsSy5sehdu8BVemQZ368iw8/DNd hYD2gYVcQLtZ2x4yWWC9kgOoex7We9hXQQ== X-Google-Smtp-Source: ABdhPJw6tMxeuEEShc/8Uix+jsMhJCY2xtws6jtWgJDYKb5SxD9WpPpZLjoU3vUMyIo0k+2gCegKIA== X-Received: by 2002:adf:e452:: with SMTP id t18mr50527151wrm.177.1609188089616; Mon, 28 Dec 2020 12:41:29 -0800 (PST) Received: from [192.168.1.11] (79-66-147-78.dynamic.dsl.as9105.com. [79.66.147.78]) by smtp.gmail.com with ESMTPSA id u66sm612140wmg.2.2020.12.28.12.41.28 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Mon, 28 Dec 2020 12:41:28 -0800 (PST) Subject: Re: Changing pkgbase package names via PKG_VERSION variable To: Martin Jakob References: Cc: freebsd-questions@freebsd.org From: Graham Perrin Message-ID: <2772b844-c752-a305-1321-cc03c56fb75a@gmail.com> Date: Mon, 28 Dec 2020 20:41:27 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-GB X-Rspamd-Queue-Id: 4D4Twq3dgNz4hNr X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=Y8F+vgdT; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::435 as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmx.net]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::435:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; RECEIVED_SPAMHAUS_PBL(0.00)[79.66.147.78:received]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::435:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::435:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 20:41:32 -0000 On 28/12/2020 19:58, Martin Jakob wrote: > … After the switch to git, i tried to achieve something similar, but failed. … Does help? From owner-freebsd-questions@freebsd.org Mon Dec 28 21:13:11 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 065304C19AF for ; Mon, 28 Dec 2020 21:13:11 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) Received: from mout.gmx.net (mout.gmx.net [212.227.17.20]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4VdK4ZM9z4kmM for ; Mon, 28 Dec 2020 21:13:09 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1609189987; bh=Hdp1hwYy3O3xYNxhM9MjKPe8Zm1AWLh5HMhzAu+ls5s=; h=X-UI-Sender-Class:To:From:Subject:Date; b=e4qHzopWcyye3jN7XQEcJ9cM9gfjby4HTnue4u+jN3G+p6Q/lvHyI4jKaxNiAtpyA f1AvedDU2bnno48qTqyb24qwF8odeHuJmJNIew7MKnFodSScCVEVt8kGnNABpaSHpX o4IkqsI6Qsg6KzMRACrvRn8WIwIADYoG2WHw1CEg= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from [2.2.3.2] ([62.214.244.247]) by mail.gmx.com (mrgmx105 [212.227.17.168]) with ESMTPSA (Nemesis) id 1MacSY-1kIAy92jSU-00c6tm for ; Mon, 28 Dec 2020 22:13:07 +0100 To: freebsd-questions@freebsd.org From: CerebrosuS Subject: Project information - SMBv2+ Message-ID: Date: Mon, 28 Dec 2020 22:13:07 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: quoted-printable X-Provags-ID: V03:K1:L4kYqOkq1K2/G//L9SauCsRLbPFmu1O4MRooXDRXmREOFwZAJJE eQGho2RGNYrLf6ofvXbg3aCBx9Cmv4vcHdX3e8M4IFz3PRpq3/9xCHzW0bSVm3JKpTNmw2a 7NTEkBaq1+PCl7jH6CngTRsih8AbGZf9AY2Pt8pQbNwzBbFPVpmw+/OLjwmcG1Uy+kfy67I VsYFtOEt2fQuz7C7TONQQ== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:yfdBwyMG8R8=:4MH7Q4F/o55g0joCXPE5Yu dQ5PDeN/vsIMnkv/DcF5FtS/UDbxEdMlXDJNMgXrIeUoqFXeB+vFA0q+rHe1gHCnDpKfN+Zvl CQqArDiFs3VD3MMUOQej8C8WtlTrqaParwffSWVRabRg5ZtrYUUOhKRXIe40qPZzSusW0S2Pb IXHDAT+niuTuVPMISZItnjnONUbqQYBfEQpQ0Ft8JpNrHSiRS8mC8D4AWSGLNi7FKOjQ5QsqK LGVg4w6bBk1u7V7BLnD1pUMCLdffzm3PKvvu0w9wZgerw8fS8UC/LeeGhCHckGTZb9Md1pw5s rAk6FQZj3BYpYpIsDid4ms0uyc6Y7xCjBUSwr1iNK/1DtL/iCMvoILhSSWySx1FENSjJUU9oY jCCdXped1qj1oYLydGX+lQ+bNl/O8r24NcQBkkVmUb1BQqHSMzfVjg5wsuYgz+4fo0tT7Mttd xo+5OqwK3h9oXL3j7CZkIq7XUAZAKZvnoydE6Ir/iVGpCnnudhoGccin6wN/Dms0hI7HmgccI E/MUPmm8aOFGK7fnF1yQAovdmqCA7p9r34KHhTzwqpljBvgnmFBh0wk3Me9+njg9r6l5DmnOB BMFFsX5I8cblhliiLvUIK8ullRjYgO68r6rEPww/dzdXSdpG6W4nCIEjwBA2uYTYzbsiivKsO b0g7rar4+Z0SMC2XqIhEwreC6zwEcmExUP0HyLcW4VCZ9Hr1za/cmNjunC53qyfljR9ewmj50 GK/3OSuJoEbdgI7tAUv8jDPo5PG6lrM6wt9nLhD604FuW1Mh6YE1dSm0TeO3HMuDkEY6qdweX gT4MSYMvdHCehsll/EZVZrTKYTfedcmQ6/IlBSKaMQD7oUZ+PEFe2e7ZlzgW9ofVJfzkfCWaM CRb9Ef/GUW4ciXvwESkw== X-Rspamd-Queue-Id: 4D4VdK4ZM9z4kmM X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmx.net header.s=badeba3b8450 header.b=e4qHzopW; dmarc=pass (policy=none) header.from=gmx.net; spf=pass (mx1.freebsd.org: domain of CerebrosuS@gmx.net designates 212.227.17.20 as permitted sender) smtp.mailfrom=CerebrosuS@gmx.net X-Spamd-Result: default: False [-4.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmx.net]; R_SPF_ALLOW(-0.20)[+ip4:212.227.17.0/27]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmx.net:+]; DMARC_POLICY_ALLOW(-0.50)[gmx.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_LOW(-0.10)[212.227.17.20:from]; FROM_EQ_ENVFROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.17.20:from]; FREEMAIL_ENVFROM(0.00)[gmx.net]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[gmx.net:s=badeba3b8450]; RECEIVED_SPAMHAUS_PBL(0.00)[62.214.244.247:received]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmx.net:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[212.227.17.20:from:127.0.2.255]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.17.20:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 21:13:11 -0000 Hello at all, the community and developer at FreeBSD seem to know, that SMBv1 for clients is nearly over and that the included mount_smbfs doesn't support newer versions. So good, so far... So I can find multiple information about the situation, but no clear path on how FreeBSD community and developer will go on to solve this missing function. (Just got the information on: https://wiki.freebsd.org/MateuszPiotrowski/AccessingSmbSharesWithSambaClie= nt) This is what I am asking: - Is there a project existing for solving this problem (with whatever target)? - What is the way to go in future? Extend mount_smbfs or support the fuse-smbnetfs part to be stable and fast like mount_smbfs (buggy and laggy here)? - Who is mainly working on it, if a project already exist? I'am just interested, cause of not finding such information clearly. Is there maybe a general project management list / team to see what projects are going on in whatever state? I am a hobby developer mainly coming from chemical engineering side, having some time to help. I've already written some cross platform software but never related to network or on os-level. So I am motivated to invest some time in getting stuff into FreeBSD, but for me, there is a lack on information (see above). Thank you in advance for information and help. =2D- Mit freundlichen Gr=C3=BC=C3=9Fen / Best regards Christian Kr From owner-freebsd-questions@freebsd.org Mon Dec 28 23:22:11 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 48FD84C4898 for ; Mon, 28 Dec 2020 23:22:11 +0000 (UTC) (envelope-from dave@jetcafe.org) Received: from fedex2.jetcafe.org (fedex2.jetcafe.org [205.147.26.23]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA512 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "fedex2.jetcafe.org", Issuer "Let's Encrypt Authority X3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4YVB2lJsz4rxk for ; Mon, 28 Dec 2020 23:22:10 +0000 (UTC) (envelope-from dave@jetcafe.org) X-Envelope-To: freebsd-questions@freebsd.org Received: from bigus.dream-tech.com (bigus.jetcafe.org [205.147.26.7]) by fedex2.jetcafe.org (8.15.2/8.15.2) with ESMTPS id 0BSNM2m3032874 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Mon, 28 Dec 2020 15:22:02 -0800 (PST) (envelope-from dave@jetcafe.org) Date: Mon, 28 Dec 2020 15:22:02 -0800 From: Dave Hayes To: Rick Miller Cc: Victor Sudakov , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201228152202.4ba4fec9@bigus.dream-tech.com> In-Reply-To: References: <20201223025406.GA25600@admin.sibptus.ru> <20201223104459.GA36737@admin.sibptus.ru> <6cbaa416-0262-c85f-8e74-19a8ac95605d@gmail.com> <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spam-Score: -1 ( out of 6) ALL_TRUSTED,SHORTCIRCUIT X-Spam-Checker-Version: SpamAssassin version 3.4.4-jetcafeglobal X-Scanned-By: MIMEDefang 2.83 X-Rspamd-Queue-Id: 4D4YVB2lJsz4rxk X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of dave@jetcafe.org designates 205.147.26.23 as permitted sender) smtp.mailfrom=dave@jetcafe.org X-Spamd-Result: default: False [-1.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[jetcafe.org]; RBL_DBL_DONT_QUERY_IPS(0.00)[205.147.26.23:from]; NEURAL_SPAM_SHORT(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[205.147.26.23:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7397, ipnet:205.147.0.0/18, country:US]; FREEMAIL_CC(0.00)[sibptus.ru,gmail.com,freebsd.org]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 23:22:11 -0000 On Fri, 25 Dec 2020 08:58:56 -0500 Rick Miller wrote: > On Fri, Dec 25, 2020 at 3:43 AM Victor Sudakov wrote: > > Is it not possible to fetch a GENERIC kernel by loader.efi, then fetch > > an MFSROOT image as a separate file? This is the way I did the job > > during the pxelinux (old BIOS based netboot) times. > It seems you refer to loading a kernel and separate ramdisk or initrd. I've > heard it rumored there could be preliminary experimental code to accomplish > this, but don't have any evidence. Experimental? Eh...this idea seems to work for me as of 12.2-STABLE. I have successfully booted onto a ramdisk using a "Live DVD" in both BIOS and UEFI (I have a hybrid build for amd64) using just the techniques found in /usr/src/release/amd64/mkisoimages.sh and a larger setting of EFI_STAGING_SIZE. The system runs entirely on ramdisk, two in fact because I had to split off /usr due to EFI_STAGING_SIZE and not having any guidelines on the maximum setting for this make.conf tunable. So far, four machines have successfully booted on this strategy. There's four points of evidence for you. :D It would be nice for some "official" support, but what that means in this context is unclear to me. -- Dave Hayes - Consultant - LA CA, USA - dave@dream-tech.com >>>> *The opinions expressed above are entirely my own* <<<< There is no reality except the one contained within us. That is why so many people live such an unreal life. They take the images outside them for reality and never allow the world within to assert itself. From owner-freebsd-questions@freebsd.org Mon Dec 28 23:25:50 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6511F4C4B88 for ; Mon, 28 Dec 2020 23:25:50 +0000 (UTC) (envelope-from doug@fledge.watson.org) Received: from cyrus.watson.org (cyrus.watson.org [204.107.128.30]) by mx1.freebsd.org (Postfix) with ESMTP id 4D4YZP3p1Cz4rhT for ; Mon, 28 Dec 2020 23:25:49 +0000 (UTC) (envelope-from doug@fledge.watson.org) Received: from fledge.watson.org (fledge.watson.org [198.74.231.63]) by cyrus.watson.org (Postfix) with ESMTPS id 4D1D792DD0 for ; Mon, 28 Dec 2020 23:25:48 +0000 (UTC) Received: from fledge.watson.org (doug@localhost [127.0.0.1]) by fledge.watson.org (8.16.1/8.16.1) with ESMTPS id 0BSNPm2E080509 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO) for ; Mon, 28 Dec 2020 23:25:48 GMT (envelope-from doug@fledge.watson.org) Received: from localhost (doug@localhost) by fledge.watson.org (8.16.1/8.16.1/Submit) with ESMTP id 0BSNPmpC080506 for ; Mon, 28 Dec 2020 23:25:48 GMT (envelope-from doug@fledge.watson.org) Date: Mon, 28 Dec 2020 23:25:48 +0000 (UTC) From: doug Reply-To: doug@safeport.com To: freebsd-questions@FreeBSD.org Subject: Observations on virtual memory operations Message-ID: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> MIME-Version: 1.0 Content-Type: text/plain; format=flowed; charset=US-ASCII X-Rspamd-Queue-Id: 4D4YZP3p1Cz4rhT X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of doug@fledge.watson.org has no SPF policy when checking 204.107.128.30) smtp.mailfrom=doug@fledge.watson.org X-Spamd-Result: default: False [1.90 / 15.00]; HAS_REPLYTO(0.00)[doug@safeport.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[204.107.128.30:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_SPAM_SHORT(1.00)[1.000]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[204.107.128.30:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_NONE(0.00)[]; NEURAL_SPAM_LONG(0.90)[0.901]; DMARC_NA(0.00)[watson.org]; R_SPF_NA(0.00)[no SPF record]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:11288, ipnet:204.107.128.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 23:25:50 -0000 I have two servers running jails that "routinely" run out of swapspace with no demand paging activity. To try and get a handle on VM/swapspace management I have been tracking swapinfo vs memory use as measured by top. The numbers do not exactly add up but I assume that is not involved in my issue. The system: real memory = 8589934592 (8192 MB) avail memory = 8248696832 (7866 MB) In top the sum of Active, Inactive, Laundry, Wired, Buf and Free is almost constant between 8704 and 8706 MB. Wired+Buf is fairly constant around 2200MB. Free has no relation to anything as long as the system is working (e.g., what you would expect). The other day I caught the system at 73% swapspace used. At this level the system was in a near thrashing state in that typing a key got it echoed in 10 <--> 30 seconds. There was about 600MB of swapspace at this point. I would think there is no way to debug this except as a thought experiment. My other thought is it would be nice if after perhaps 5,000 -> 10,000 'out of swap space message' logging could stop. I read a google post suggesting this can be handled by logging the console output to a file. Does anyone have experience with this? Right now we are surviving by email warnings when the system gets to 50% swap used and monitoring, From owner-freebsd-questions@freebsd.org Mon Dec 28 23:37:13 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 53CA14C4D68 for ; Mon, 28 Dec 2020 23:37:13 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from mail.nomadlogic.org (mail.nomadlogic.org [174.136.98.114]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mail.nomadlogic.org", Issuer "Let's Encrypt Authority X3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4YqX3CWyz4skR for ; Mon, 28 Dec 2020 23:37:12 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from [192.168.1.160] (cpe-24-24-163-126.socal.res.rr.com [24.24.163.126]) by mail.nomadlogic.org (OpenSMTPD) with ESMTPSA id a758e86b (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Mon, 28 Dec 2020 23:37:05 +0000 (UTC) Subject: Re: Observations on virtual memory operations To: doug@safeport.com, freebsd-questions@FreeBSD.org References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> From: Pete Wright Message-ID: <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> Date: Mon, 28 Dec 2020 15:36:59 -0800 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: 4D4YqX3CWyz4skR X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pete@nomadlogic.org designates 174.136.98.114 as permitted sender) smtp.mailfrom=pete@nomadlogic.org X-Spamd-Result: default: False [-3.27 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[174.136.98.114:from]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; ARC_NA(0.00)[]; DMARC_NA(0.00)[nomadlogic.org]; SPAMHAUS_ZRD(0.00)[174.136.98.114:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-0.97)[-0.971]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:25795, ipnet:174.136.96.0/20, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 28 Dec 2020 23:37:13 -0000 On 12/28/20 3:25 PM, doug wrote: > I have two servers running jails that "routinely" run out of swapspace > with > no demand paging activity. To try and get a handle on VM/swapspace > management I have been tracking swapinfo vs memory use as measured by > top. > The numbers do not exactly add up but I assume that is not involved in my > issue. > > > The other day I caught the system at 73% swapspace used. At this level > the > system was in a near thrashing state in that typing a key got it > echoed in > 10 <--> 30 seconds. There was about 600MB of swapspace at this point. I > would think there is no way to debug this except as a thought experiment. The first thing that comes to mind is do you have the ability to hook any metrics/monitoring onto this system.  For example, I use collectd on my systems to report overall CPU/memory metrics as well as per-process memory metrics. Alternatively you could write a simple shell script that run's "ps" and parses the output of memory utilization on a per-process basis. either of the above approaches should give you some insight into where the memory leak is coming from (assuming you already do not know). one trick i use is to invoke a process with "limits" to ensure it does not exceed a certain amount of memory that I allocate to it. for example with firefox i do this: $ limits -m 6g -v 6g /usr/local/bin/firefox that should at least buy you enough time to investigate why the process needs so much memory and see what you can do about it. -p -- Pete Wright pete@nomadlogic.org @nomadlogicLA From owner-freebsd-questions@freebsd.org Tue Dec 29 02:08:38 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 90F1A4CC341 for ; Tue, 29 Dec 2020 02:08:38 +0000 (UTC) (envelope-from corey.stephan@marquette.edu) Received: from mx0b-0020b801.pphosted.com (mx0a-0020b801.pphosted.com [148.163.148.69]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.pphosted.com", Issuer "Thawte RSA CA 2018" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4dBF0H49z54qH for ; Tue, 29 Dec 2020 02:08:36 +0000 (UTC) (envelope-from corey.stephan@marquette.edu) Received: from pps.filterd (m0094259.ppops.net [127.0.0.1]) by mx0b-0020b801.pphosted.com (8.16.0.43/8.16.0.43) with SMTP id 0BT27njt031236 for ; Mon, 28 Dec 2020 20:08:34 -0600 Received: from nam10-bn7-obe.outbound.protection.outlook.com (mail-bn7nam10lp2106.outbound.protection.outlook.com [104.47.70.106]) by mx0b-0020b801.pphosted.com with ESMTP id 35p1fxg1dm-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Mon, 28 Dec 2020 20:08:33 -0600 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=fnRYo7JAofyhU4BBkV9Txmptmqy9/Zeo6NZnVHAHxz6yYckBpd3HquP51Cmw7Vtk0z57U8uvMbGzzK7s/u/n9ToWUVHinf+pkI7zQkCtHrFamMM3M9aWxe9ZM5vqChmeazNojuosI7JJ8uSZBCot7a0AGU4SDLDCEYOf91h4EcGzvkMw/7S/xek4i8fgVI3r+i8moVlR/CGUaJ8P6qlQwAN463KjtTBdCG+Zc0gkWL7blApDiRh6659AcCpo3TiEprUNk5pfFDh+1GVRYBWaLdI2PLwBH9P9F4brbYHdFKx75yEzs6tECjNRbd/4RJeUZhfROxV23Mu+MUNY/oIGXA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=QDuptLrio4aiU4PiYPaRzb7rKbxE+pCuZ4PEFucDKas=; b=ZsQxb9WIWlwU2k83IoCAXkkecquyqIiwv/Tq52L9qXfss4UvrvjaGcoWJzmF3JFzgSFvWoeK0GXTwRflJs/2QCbORzbkc7yzY5x8l84YeGQLBu0oeH/09dyusncYWbtUs8pHUTZmv4FK7NZjMxvFTtwqTZ1FXh2cN65j4RSmZv5aEn4xDPuu0LKVJAYfoM6dDWcxb2HnVh7Jnl6LQ2yihaKBFyl3mRSiDEtTDRDV9x+pt0bhY3A3iAYrk2arKxuxz97Qx7fLfD2hHNEWPj2GcwNT0CGtI7CkwMNvNLoYjH/CrIVoJlhIIBXvUGymqp2NIxBRX2Oi7aS2pMsf1suihg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=marquette.edu; dmarc=pass action=none header.from=marquette.edu; dkim=pass header.d=marquette.edu; arc=none Received: from DM6PR01MB4747.prod.exchangelabs.com (2603:10b6:5:6c::23) by DM6PR01MB4923.prod.exchangelabs.com (2603:10b6:5:56::28) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3700.31; Tue, 29 Dec 2020 02:08:32 +0000 Received: from DM6PR01MB4747.prod.exchangelabs.com ([fe80::5cb3:6db3:d37:d48a]) by DM6PR01MB4747.prod.exchangelabs.com ([fe80::5cb3:6db3:d37:d48a%6]) with mapi id 15.20.3700.031; Tue, 29 Dec 2020 02:08:31 +0000 From: "Stephan, Corey" To: "freebsd-questions@freebsd.org" Subject: Re: Raspberry Pi 4 8GB: Boot Hang, (Simple) Workaround? Thread-Topic: Raspberry Pi 4 8GB: Boot Hang, (Simple) Workaround? Thread-Index: AQHW3L4pSBN/uA54c0WP5DEzkg3JLg== Date: Tue, 29 Dec 2020 02:08:31 +0000 Message-ID: References: Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-originating-ip: [65.30.129.133] x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 79bee40d-ad15-4e59-4776-08d8ab9ea419 x-ms-traffictypediagnostic: DM6PR01MB4923: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:5236; x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: OccXA/xJ1b7tpvDyyxe3r3PeMtANmDorODZ5EyWfOS2KT6xkAHv4scwZXnoQmHFnSoL/JUBVil3KXCHT8hO6I3z1y/MRxwiiBh7fByEP7Vfa1+15zXJP+toxnYtN0S90X0FnOpvqFZaxTtV4Ix0xsJrmPya0t9/KFceO1mMwYVSRlSyk+7Xj4f+FXJbPcFIH0jKvUUJ2bITRHauzjU6MEUVK7AsdKsdEYxwnP4WfhX7wSnwEDO4jqQqj0e0hD5+USkEKGCZEQZQOpPSazIWgAxmZvs7x8jmqxjXbw9MMnvLP80liE+9kk7KZSx2Qf3ja1wOapcuz/4YS5bBwOjb9WB6BUSHJF6y9FYpi9kRmBimBx0CeiczVRcICEW86CWAa06wcuUZFaUaQSpwkKrw7uE8kcOh564Abpft4QbTxH4O2ANPK7P2R3i7uclfw5/gZ50DtI6URppJBJ4AwDti7fw== x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:DM6PR01MB4747.prod.exchangelabs.com; PTR:; CAT:NONE; SFS:(4636009)(396003)(136003)(366004)(346002)(39850400004)(376002)(33656002)(8936002)(55016002)(8676002)(9686003)(86362001)(7696005)(478600001)(786003)(75432002)(966005)(186003)(66446008)(26005)(5660300002)(2906002)(76116006)(6506007)(66556008)(6916009)(316002)(45080400002)(91956017)(83380400001)(64756008)(66946007)(53546011)(71200400001)(52536014)(66476007); DIR:OUT; SFP:1101; x-ms-exchange-antispam-messagedata: =?us-ascii?Q?rlcgsj7GetaTklk9iZH4lA9sfAogcPrE7N6eGElJkY8keDw5qDz4hl/ufo5t?= =?us-ascii?Q?rKM2joxKN/0XrgoooXH4lJZnCRL5bQI2YNnB3tp+htWPG1CDvC+/zTaTFb1Y?= =?us-ascii?Q?nnx64jzz3W7CvREvFIXD23JNUil0D9DZ5H9WVEcfGsaHw6qRPgOpwo7A6InT?= =?us-ascii?Q?lqYD10iufkOTgiiivEYDnvZvdkmUxlYR6NjdfQEhKl+RTIfW54tp7YhFD6cS?= =?us-ascii?Q?zhyfSs6jPvATlBp615lq9utA0Sl4MWJZm64RFmxOESW3uTUXD6XstKcDOliC?= =?us-ascii?Q?mb1Udr9zcsPV4OhNtijxt5SZsk5Y2zi2M2PZkbkqyNAnbFD9W6KTkKtmyTmr?= =?us-ascii?Q?7/ElckdPPfos0DCWakoafPZxQyEJaDnoQtivOyshNZJwjKtsn7DOv14un320?= =?us-ascii?Q?KZh0g535VCu9XtK+/xDU43aemrooJpAzLrV7+CPOoQGS/9PuNUZoHK+4Sxtw?= =?us-ascii?Q?NsQBEmz5ZWecd7/UmfFz3RECZc4qUcYZ4ttPRGP66G0N4ITMZRwm+8tXQyf9?= =?us-ascii?Q?goEgHXktuuQBy2iPHLC0mjGPyRou2pUPCpAa12CYvbt9z+qxFJfEZ6P3nw4t?= =?us-ascii?Q?zh0i+CydkiSea6vqs3oX5EsYIBsNby05gn7VpYAqoGIHUlaVr3CL8uHm1xwY?= =?us-ascii?Q?nUSycGmUskMzC1EkMGjxtJpOBZgCEx7127107DOKZif8ngItCRnDYOrTAw4U?= =?us-ascii?Q?O93xBGNIXcmcNK7TL1rQw5VXopBhf7Syn3tLeCdS3p1yfjBzCSPJWf0PONdW?= =?us-ascii?Q?6458RZYUbiF4QfsgckxSQiVkP+4H57cd1YbjXF43eGwZnll8QAhp4tQ9AZvp?= =?us-ascii?Q?PCTCrOsa2gEk5TdsPhmE1n7wqtL+iiC8hr0UVxQdPOPWLb2ku7tLxVJ8x0xk?= =?us-ascii?Q?6FlZ7V/1iRwz3rUgvzSuvwcqWGS3tKafS4SkWVinZQLeYNMsjc8lH69Hfcp/?= =?us-ascii?Q?rE6SVPzWrF1qrJPWuGcaOyX0CSwhUh2eRAlHpDMOG+zgELtc9E/Le0+mDcRY?= =?us-ascii?Q?5pGm?= x-ms-exchange-transport-forked: True Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: quoted-printable MIME-Version: 1.0 X-OriginatorOrg: marquette.edu X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: DM6PR01MB4747.prod.exchangelabs.com X-MS-Exchange-CrossTenant-Network-Message-Id: 79bee40d-ad15-4e59-4776-08d8ab9ea419 X-MS-Exchange-CrossTenant-originalarrivaltime: 29 Dec 2020 02:08:31.8128 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: abe32f68-c72d-420d-b5bd-750c63a268e4 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: Wjh6qqxCOnt/V55tIbBMLvBg12avSTNr795Cyy5mKar3Yja+2wyYhutIgFAQClBFTi+wou2jAABXCYs3PcCDwsmitKAjavvhZFCcwfU/470= X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR01MB4923 X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.343, 18.0.737 definitions=2020-12-29_03:2020-12-28, 2020-12-28 signatures=0 X-Proofpoint-Spam-Details: rule=outbound_notspam policy=outbound score=0 spamscore=0 priorityscore=1501 clxscore=1015 mlxlogscore=999 bulkscore=0 impostorscore=0 mlxscore=0 adultscore=0 lowpriorityscore=0 suspectscore=0 phishscore=0 malwarescore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2009150000 definitions=main-2012290010 X-Rspamd-Queue-Id: 4D4dBF0H49z54qH X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; arc=pass (microsoft.com:s=arcselector9901:i=1); dmarc=none; spf=pass (mx1.freebsd.org: domain of corey.stephan@marquette.edu designates 148.163.148.69 as permitted sender) smtp.mailfrom=corey.stephan@marquette.edu X-Spamd-Result: default: False [-1.30 / 15.00]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[148.163.148.69:from]; RCVD_COUNT_FIVE(0.00)[5]; HAS_XOIP(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:148.163.148.69]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[marquette.edu]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[148.163.148.69:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[148.163.148.69:from]; TO_DN_EQ_ADDR_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:26211, ipnet:148.163.148.0/22, country:US]; SUBJECT_ENDS_QUESTION(1.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 02:08:38 -0000 Pardon me, folks. I am new to these mailing lists. The situation is =0A= resolved. In case someone else should wonder about the Pi 4 8GB and =0A= FreeBSD, as of December 28, 2020, here is what I did.=0A= =0A= First, I carefully read the following in the recent archives of =0A= #freebsd-arm:=0A= =0A= https://lists.freebsd.org/pipermail/freebsd-arm/2020-December/022776.html= =0A= =0A= https://lists.freebsd.org/pipermail/freebsd-arm/2020-November/022701.html= =0A= =0A= Next, I ran the following steps to replace the incompatible boot files =0A= in the FreeBSD image:=0A= =0A= (1) Burn the most recent FreeBSD 13-CURRENT image for the RPI3 to my SD =0A= card with Etcher.io, making sure to uncheck the automatic unmount option=0A= =0A= (2) fdisk -l=0A= to find the relevant MSDOS partition, which in my case was /dev/sdd1=0A= =0A= (3) mkdir /media/d1=0A= =0A= (4) mount /dev/sdd1 /media/d1=0A= =0A= (5) Copy and paste the outside files linked in the discussion above into = =0A= /media/d1=0A= =0A= To be explicit, these are the 3 files that need to be replaced:=0A= start4.elf=0A= fixup4.dat=0A= u_boot.bin=0A= =0A= (6) sync=0A= =0A= (7) umount /dev/sdd1=0A= =0A= (8) Insert SD card into Pi and boot=0A= =0A= The Raspberry Pi 4 8GB now works wonderfully. Thank you for =0A= pre-configuring SSH, folks.=0A= =0A= Cheers,=0A= Corey=0A= =0A= On 12/27/20 8:07 PM, Stephan, Corey wrote:=0A= > Hello, fellow open source fans. I am attempting to install FreeBSD on a= =0A= > new Raspberry Pi 4 8GB, but I simply cannot get the device to boot. The= =0A= > latest Raspberry Pi OS (Raspbian), NOOBS, etc. all work. The Pi's=0A= > firmware and BIOS are up-to-date. The SD card is new, stable, and passes= =0A= > verification tests.=0A= > =0A= > Tried: 13.0-CURRENT from Dec-10, 13.0-CURRENT from Dec-03, 12.2-RELEASE,= =0A= > 12.2-STABLE, and 12.1-RELEASE images for the Raspberry Pi 3 (RPI3 images= =0A= > are recommended in the FreeBSD Wiki:=0A= > https://urldefense.proofpoint.com/v2/url?u=3Dhttps-3A__wiki.freebsd.org_a= rm_Raspberry-2520Pi&d=3DDwICAg&c=3DS1d2Gs1Y1NQV8Lx35_Qi5FnTH2uYWyh_OhOS94Iq= YCo&r=3DiNvzbjK5Ohtsok8SlKu57qxvToiGa0FLnH3ASaHDLEg&m=3DAYWabcHnGlOl2dinRxV= vxBustQgQKcgNLf3Drq0z-KQ&s=3DELaX5Y7uZrhgL3TDNjmiOqCcx24nsWz5fKMGTUocrOI&e= =3D )=0A= > =0A= > FreeBSD 12-series does not show a boot screen at all, but I more-or-less= =0A= > expected as such, since the RPI4 8GB is known to be WIP in 13-CURRENT.=0A= > With 13.0-CURRENT, I reach the boot screen, but I am greeted with the=0A= > following 2 error messages:=0A= > =0A= > Error 00000044=0A= > =0A= > This device requires newer software.=0A= > =0A= > I have read in the FreeBSD subreddit that this has to do with the=0A= > FreeBSD SD card image's bootloader being out of date.=0A= > =0A= > Does anyone have FreeBSD working on the RPI4 8GB?=0A= > =0A= > Other: The only advice about this that I have read involves rebuilding=0A= > the FreeBSD SD card image. That is above my knowledge. Moreover, of=0A= > course, I am sure that the aim of everyone here is to bring FreeBSD to=0A= > this popular testing and learning platform :)=0A= > =0A= > Thank you in advance, everyone. Cheers,=0A= > Corey=0A= > _______________________________________________=0A= > freebsd-questions@freebsd.org mailing list=0A= > https://urldefense.proofpoint.com/v2/url?u=3Dhttps-3A__lists.freebsd.org_= mailman_listinfo_freebsd-2Dquestions&d=3DDwICAg&c=3DS1d2Gs1Y1NQV8Lx35_Qi5Fn= TH2uYWyh_OhOS94IqYCo&r=3DiNvzbjK5Ohtsok8SlKu57qxvToiGa0FLnH3ASaHDLEg&m=3DAY= WabcHnGlOl2dinRxVvxBustQgQKcgNLf3Drq0z-KQ&s=3DF_LJ9jphDBKE5szcWV_UGykNZzkyX= 8-Bft8oBJtSg30&e=3D=0A= > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.o= rg"=0A= > =0A= From owner-freebsd-questions@freebsd.org Tue Dec 29 02:27:20 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 56E584CCF41 for ; Tue, 29 Dec 2020 02:27:20 +0000 (UTC) (envelope-from vas@sibptus.ru) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4dbq3khYz55vW for ; Tue, 29 Dec 2020 02:27:19 +0000 (UTC) (envelope-from vas@sibptus.ru) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=In-Reply-To:Message-ID:Subject:To:From:Date; bh=SMW5z/p9++n4dA5YKIqxri1HudOe3AN23Fkb4od4+j8=; b=iqO7IIV0/octhnZIjQ6kOoCmIr ZSrv9j+rebxscBSmA1YPJmrHUkp3eukjKitzAxUqTHcybqZAZ+4KrLvc08azBvY00eoYcx3dXPkLE enFqYC5aqKhFS8xjfoGHDuRtKYhrIvUzM1pOGmOLSid5U5NFP0pie4U2uC/xgGuK6nZQ=; Received: from vas by admin.sibptus.ru with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ku4jC-000Olw-FX; Tue, 29 Dec 2020 09:27:14 +0700 Date: Tue, 29 Dec 2020 09:27:14 +0700 From: Victor Sudakov To: Dave Hayes Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201229022714.GA95031@admin.sibptus.ru> References: <20201223025406.GA25600@admin.sibptus.ru> <20201223104459.GA36737@admin.sibptus.ru> <6cbaa416-0262-c85f-8e74-19a8ac95605d@gmail.com> <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="mP3DRpeJDSE+ciuQ" Content-Disposition: inline In-Reply-To: <20201228152202.4ba4fec9@bigus.dream-tech.com> X-PGP-Key: http://admin.sibptus.ru/~vas/ X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 X-Rspamd-Queue-Id: 4D4dbq3khYz55vW X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sibptus.ru header.s=20181118 header.b=iqO7IIV0; dmarc=pass (policy=none) header.from=sibptus.ru; spf=pass (mx1.freebsd.org: domain of vas@sibptus.ru designates 2001:19f0:5001:21dc::10 as permitted sender) smtp.mailfrom=vas@sibptus.ru X-Spamd-Result: default: False [-4.10 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:19f0:5001:21dc::10:from]; R_DKIM_ALLOW(-0.20)[sibptus.ru:s=20181118]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; NEURAL_SPAM_SHORT(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[2001:19f0:5001:21dc::10:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[sibptus.ru:+]; DMARC_POLICY_ALLOW(-0.50)[sibptus.ru,none]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:20473, ipnet:2001:19f0:5000::/38, country:US]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 02:27:20 -0000 --mP3DRpeJDSE+ciuQ Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Dave Hayes wrote: >=20 > Experimental? Eh...this idea seems to work for me as of 12.2-STABLE.=20 >=20 > I have successfully booted onto a ramdisk using a "Live DVD" in both BIOS > and UEFI (I have a hybrid build for amd64) using just the techniques foun= d in > /usr/src/release/amd64/mkisoimages.sh and a larger setting of EFI_STAGING= _SIZE. >=20 > The system runs entirely on ramdisk, two in fact because I had to split o= ff > /usr due to EFI_STAGING_SIZE and not having any guidelines on the maximum > setting for this make.conf tunable. >=20 > So far, four machines have successfully booted on this strategy. There's = four > points of evidence for you. :D Was this happening over network (PXE boot) or from a physical medium like USB drive/CD-ROM ? Your phrase 'using a "Live DVD"' probably means a local medium, then I don't understand why you had to modify anything. IMHO the standard "Live DVD" works fine under UEFI without any modifications? --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --mP3DRpeJDSE+ciuQ Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJf6pQCAAoJEA2k8lmbXsY0ODMH/2aMS5JvSaNn2adbehs9eRyd os2771/k7iiA8kUsKATUXcdpjFgZNDD1p0ckldd4DNln5sO/uZNougGtrGn2D5UE cNBe1HLRSRu/JhkT8SwJ0cj5VFklrTnbjLPHKlZVJfHxi2z6+MZF9mnqPiLVwvhz qC3VvL3FMk0XUOia6f6BoJxJlEJrl+VdWvM3KUROg3r/rn0DB2M5rVdSSwc9fi4P 9fKFp2lgfClTvacCc6YBVtN3bpoxHCbp8aH3riCGlzqsDpG7gorcfKR5pJ7ip0ky Nnpd4oMgsKs3OtjtacDnh/qn8vDG4p0+q0bVUtgIZnbanKtwsGOBLMNNlGC+Vb8= =rz0t -----END PGP SIGNATURE----- --mP3DRpeJDSE+ciuQ-- From owner-freebsd-questions@freebsd.org Tue Dec 29 03:13:10 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D352A4CE209 for ; Tue, 29 Dec 2020 03:13:10 +0000 (UTC) (envelope-from dave@jetcafe.org) Received: from fedex2.jetcafe.org (fedex2.jetcafe.org [205.147.26.23]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA512 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "fedex2.jetcafe.org", Issuer "Let's Encrypt Authority X3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4fcj4zqbz581L for ; Tue, 29 Dec 2020 03:13:09 +0000 (UTC) (envelope-from dave@jetcafe.org) X-Envelope-To: freebsd-questions@freebsd.org Received: from bigus.dream-tech.com (bigus.jetcafe.org [205.147.26.7]) by fedex2.jetcafe.org (8.15.2/8.15.2) with ESMTPS id 0BT3D7h6048380 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Mon, 28 Dec 2020 19:13:07 -0800 (PST) (envelope-from dave@jetcafe.org) Date: Mon, 28 Dec 2020 19:13:06 -0800 From: Dave Hayes To: Victor Sudakov Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201228191306.3edcdab1@bigus.dream-tech.com> In-Reply-To: <20201229022714.GA95031@admin.sibptus.ru> References: <20201223025406.GA25600@admin.sibptus.ru> <20201223104459.GA36737@admin.sibptus.ru> <6cbaa416-0262-c85f-8e74-19a8ac95605d@gmail.com> <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> <20201229022714.GA95031@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spam-Score: -1 ( out of 5.1) ALL_TRUSTED,SHORTCIRCUIT X-Spam-Checker-Version: SpamAssassin version 3.4.4-jetcafeglobal X-Scanned-By: MIMEDefang 2.83 X-Rspamd-Queue-Id: 4D4fcj4zqbz581L X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of dave@jetcafe.org designates 205.147.26.23 as permitted sender) smtp.mailfrom=dave@jetcafe.org X-Spamd-Result: default: False [-1.64 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[jetcafe.org]; RBL_DBL_DONT_QUERY_IPS(0.00)[205.147.26.23:from]; NEURAL_SPAM_SHORT(0.66)[0.656]; SPAMHAUS_ZRD(0.00)[205.147.26.23:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:7397, ipnet:205.147.0.0/18, country:US]; MAILMAN_DEST(0.00)[freebsd-questions]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 03:13:10 -0000 On Tue, 29 Dec 2020 09:27:14 +0700 Victor Sudakov wrote: > Was this happening over network (PXE boot) or from a physical medium > like USB drive/CD-ROM ? Actually both. However, this thread implied that the mfsBSD/ramdisk techniques did not work, and I wanted to provide a datapoint to the contrary. We have one installation which gets the ISO image over FTP and boots from that, but it's probably not grabbing two separate images using loader.efi like you also suggest. > Your phrase 'using a "Live DVD"' probably means a local medium, then I > don't understand why you had to modify anything. IMHO the standard "Live > DVD" works fine under UEFI without any modifications? Perhaps it works. I've been maintaining a DVD build longer than that Live DVD has existed, so I have a set methodology to boot from a DVD. Hence I have never really tried the Live DVD as a long term solution to booting servers which are relatively immune to rootkits. -- Dave Hayes - Consultant - LA CA, USA - dave@dream-tech.com >>>> *The opinions expressed above are entirely my own* <<<< Possession of a system of knowledge, or an interest in it, or in discovering one, shouldn't be assumed to confer any license or capacity to operate it. Individual criticisms of a system, incapacity to operate it, or dissatisfaction with it should not be confused with any shortcoming of the system itself. From owner-freebsd-questions@freebsd.org Tue Dec 29 03:42:14 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C8CBD4CE9F1 for ; Tue, 29 Dec 2020 03:42:14 +0000 (UTC) (envelope-from vas@sibptus.ru) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4gGG0wbgz59ND for ; Tue, 29 Dec 2020 03:42:13 +0000 (UTC) (envelope-from vas@sibptus.ru) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=In-Reply-To:Message-ID:Subject:To:From:Date; bh=OL2ZK6xKED5pKxi5URIcA5S0NJvwk/I7tY/ycj3eguE=; b=owwgyKShbVCEKc/eRfI/Jhdp+v qsO7CuIewqWuF82zazBY2L3USWBhOXOzeZ2nWzuLw5B1hkAxBJ1hFejIjdVOq9i7b0FtaHIRha0WR g8tskZ5w26OcRyEBDH2HvBPKEhTse/DpyYrKKfa9cb7EeDmsaUPYjaduW1QuM5CM5Ygo=; Received: from vas by admin.sibptus.ru with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ku5tj-000PjT-Mz; Tue, 29 Dec 2020 10:42:11 +0700 Date: Tue, 29 Dec 2020 10:42:11 +0700 From: Victor Sudakov To: Dave Hayes Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201229034211.GA98610@admin.sibptus.ru> References: <20201223104459.GA36737@admin.sibptus.ru> <6cbaa416-0262-c85f-8e74-19a8ac95605d@gmail.com> <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> <20201229022714.GA95031@admin.sibptus.ru> <20201228191306.3edcdab1@bigus.dream-tech.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="dDRMvlgZJXvWKvBx" Content-Disposition: inline In-Reply-To: <20201228191306.3edcdab1@bigus.dream-tech.com> X-PGP-Key: http://admin.sibptus.ru/~vas/ X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 X-Rspamd-Queue-Id: 4D4gGG0wbgz59ND X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sibptus.ru header.s=20181118 header.b=owwgyKSh; dmarc=pass (policy=none) header.from=sibptus.ru; spf=pass (mx1.freebsd.org: domain of vas@sibptus.ru designates 2001:19f0:5001:21dc::10 as permitted sender) smtp.mailfrom=vas@sibptus.ru X-Spamd-Result: default: False [-6.10 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:19f0:5001:21dc::10:from]; R_DKIM_ALLOW(-0.20)[sibptus.ru:s=20181118]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx:c]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; SPAMHAUS_ZRD(0.00)[2001:19f0:5001:21dc::10:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[sibptus.ru:+]; DMARC_POLICY_ALLOW(-0.50)[sibptus.ru,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:20473, ipnet:2001:19f0:5000::/38, country:US]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 03:42:14 -0000 --dDRMvlgZJXvWKvBx Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Dave Hayes wrote: > > Was this happening over network (PXE boot) or from a physical medium > > like USB drive/CD-ROM ? >=20 > Actually both. However, this thread implied that the mfsBSD/ramdisk techn= iques > did not work, and I wanted to provide a datapoint to the contrary. >=20 > We have one installation which gets the ISO image over FTP and boots from= that, Can you please elaborate on that? Is this installation using UEFI or legacy mode loader? What tools are used? pxelinux/memdisk or anything else? > but it's probably not grabbing two separate images using loader.efi like = you > also suggest. Well, grabbing two separate images using loader.efi almost works... Almost. --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --dDRMvlgZJXvWKvBx Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJf6qWTAAoJEA2k8lmbXsY0VMYH/2/E4pjDxqK8f3c372thT/sf +niW1iDhAUrMYc2u8lB45bi/CG5DhKk3tva4fqIdwoCdi9YvGVnR76oKP/zOOnzR qU6S50w/yCS79lvAbkn1Episi/0VadfSw0WXOaBEohZ3jtY3G1WasM7C8G9hzZdQ hFlF49fbuAbIKo7PosArGgZwj4kA15Zs24wNv6puJciTFUq9ZVndjqZCgirEn1B+ f7c52CjnsVMtPEqC9eWaoPgZmbIf+GiuCywQXtbieVbc3l3o6maqK/mRvTQDRrLD xWwInKhD6QVWXoaISw+kl+WfYr8AbEB7xO2UW03s3AXBM+kI86pgCP1nW8DrKbw= =/SNa -----END PGP SIGNATURE----- --dDRMvlgZJXvWKvBx-- From owner-freebsd-questions@freebsd.org Tue Dec 29 06:58:00 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 026DF4D2CBD for ; Tue, 29 Dec 2020 06:58:00 +0000 (UTC) (envelope-from dave@jetcafe.org) Received: from fedex2.jetcafe.org (fedex2.jetcafe.org [205.147.26.23]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA512 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "fedex2.jetcafe.org", Issuer "Let's Encrypt Authority X3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4lc66LbDz3N8d for ; Tue, 29 Dec 2020 06:57:58 +0000 (UTC) (envelope-from dave@jetcafe.org) X-Envelope-To: freebsd-questions@freebsd.org Received: from bigus.dream-tech.com (bigus.jetcafe.org [205.147.26.7]) by fedex2.jetcafe.org (8.15.2/8.15.2) with ESMTPS id 0BT6vvEH007373 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Mon, 28 Dec 2020 22:57:57 -0800 (PST) (envelope-from dave@jetcafe.org) Date: Mon, 28 Dec 2020 22:57:56 -0800 From: Dave Hayes To: Victor Sudakov Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201228225756.30870717@bigus.dream-tech.com> In-Reply-To: <20201229034211.GA98610@admin.sibptus.ru> References: <20201223104459.GA36737@admin.sibptus.ru> <6cbaa416-0262-c85f-8e74-19a8ac95605d@gmail.com> <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> <20201229022714.GA95031@admin.sibptus.ru> <20201228191306.3edcdab1@bigus.dream-tech.com> <20201229034211.GA98610@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spam-Score: -1 ( out of 6) ALL_TRUSTED,SHORTCIRCUIT X-Spam-Checker-Version: SpamAssassin version 3.4.4-jetcafeglobal X-Scanned-By: MIMEDefang 2.83 X-Rspamd-Queue-Id: 4D4lc66LbDz3N8d X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of dave@jetcafe.org designates 205.147.26.23 as permitted sender) smtp.mailfrom=dave@jetcafe.org X-Spamd-Result: default: False [-1.30 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[205.147.26.23:from]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx:c]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[jetcafe.org]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_SPAM_SHORT(1.00)[0.996]; SPAMHAUS_ZRD(0.00)[205.147.26.23:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7397, ipnet:205.147.0.0/18, country:US]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 06:58:00 -0000 On Tue, 29 Dec 2020 10:42:11 +0700 Victor Sudakov wrote: > Dave Hayes wrote: > > > Was this happening over network (PXE boot) or from a physical medium > > > like USB drive/CD-ROM ? > > > > Actually both. However, this thread implied that the mfsBSD/ramdisk > > techniques did not work, and I wanted to provide a datapoint to the > > contrary. > > > > We have one installation which gets the ISO image over FTP and boots from > > that, > > Can you please elaborate on that? Is this installation using UEFI or > legacy mode loader? What tools are used? pxelinux/memdisk or anything else? This particular installation is a Dell DRAC that has the capability of booting given an http url for a bootable iso. There actually is still some problem booting the hybrid disk in BIOS mode, but UEFI works just fine. Highly effective on an isolated network. I don't think this is quite what you are after, though I could be mistaken. I did try the PXEBOOT idea on the exact same hardware platform and was unable to get it to work, back at FreeBSD 10->11. > > but it's probably not grabbing two separate images using loader.efi like you > > also suggest. > Well, grabbing two separate images using loader.efi almost works... Almost. Do you know of any technical reading that can get one up to speed on the low level details of UEFI booting and how it is different from BIOS? One problem in debugging all these methods is the ever-present lack of documentation. :/ -- Dave Hayes - Consultant - LA CA, USA - dave@dream-tech.com >>>> *The opinions expressed above are entirely my own* <<<< A man stopped Nasrudin and asked him what day of the week it was. "Couldn't tell you," said the Mulla. "I'm a stranger in these parts. I don't know what days of the week they have here." From owner-freebsd-questions@freebsd.org Tue Dec 29 07:40:27 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1E2924D3D25 for ; Tue, 29 Dec 2020 07:40:27 +0000 (UTC) (envelope-from vas@sibptus.ru) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4mY56cCHz3Q9J for ; Tue, 29 Dec 2020 07:40:25 +0000 (UTC) (envelope-from vas@sibptus.ru) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=In-Reply-To:Message-ID:Subject:To:From:Date; bh=pfXevhd1ERWdHtJmYWnExNvPxZRQQ4DueLumBa2MGs4=; b=eN2c2FADzlY7SYUeko2GheDW9Q dGQiIJDSJU6qiW7o7MSGxMI9Fh2+neRzQCz7mkCqV8vgpnLZ4i1cygtY5c9swrpJa4UymEYZp2jpM QkEqX177PpxWOawMYzd9/cAQ2JIJkGOnGO6tjXc2MQZLa04BnyfVayZuHOy/xg4u4BlU=; Received: from vas by admin.sibptus.ru with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1ku9c9-0002l2-Cb; Tue, 29 Dec 2020 14:40:17 +0700 Date: Tue, 29 Dec 2020 14:40:17 +0700 From: Victor Sudakov To: Dave Hayes Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201229074017.GA9211@admin.sibptus.ru> References: <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> <20201229022714.GA95031@admin.sibptus.ru> <20201228191306.3edcdab1@bigus.dream-tech.com> <20201229034211.GA98610@admin.sibptus.ru> <20201228225756.30870717@bigus.dream-tech.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="VbJkn9YxBvnuCH5J" Content-Disposition: inline In-Reply-To: <20201228225756.30870717@bigus.dream-tech.com> X-PGP-Key: http://admin.sibptus.ru/~vas/ X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 X-Rspamd-Queue-Id: 4D4mY56cCHz3Q9J X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sibptus.ru header.s=20181118 header.b=eN2c2FAD; dmarc=pass (policy=none) header.from=sibptus.ru; spf=pass (mx1.freebsd.org: domain of vas@sibptus.ru designates 2001:19f0:5001:21dc::10 as permitted sender) smtp.mailfrom=vas@sibptus.ru X-Spamd-Result: default: False [-6.10 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:19f0:5001:21dc::10:from]; R_DKIM_ALLOW(-0.20)[sibptus.ru:s=20181118]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; SPAMHAUS_ZRD(0.00)[2001:19f0:5001:21dc::10:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[sibptus.ru:+]; DMARC_POLICY_ALLOW(-0.50)[sibptus.ru,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:20473, ipnet:2001:19f0:5000::/38, country:US]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 07:40:27 -0000 --VbJkn9YxBvnuCH5J Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Dave Hayes wrote: > > > > Was this happening over network (PXE boot) or from a physical medium > > > > like USB drive/CD-ROM ? =20 > > >=20 > > > Actually both. However, this thread implied that the mfsBSD/ramdisk > > > techniques did not work, and I wanted to provide a datapoint to the > > > contrary. > > >=20 > > > We have one installation which gets the ISO image over FTP and boots = =66rom > > > that, =20 > >=20 > > Can you please elaborate on that? Is this installation using UEFI or > > legacy mode loader? What tools are used? pxelinux/memdisk or anything e= lse? >=20 > This particular installation is a Dell DRAC that has the capability of bo= oting > given an http url for a bootable iso. There actually is still some problem > booting the hybrid disk in BIOS mode, but UEFI works just fine. Highly > effective on an isolated network.=20 Ah, is this more like IPMI booting, where you can attach an ISO image to the IPMI console which has its own networking stack, management interface etc? >=20 > I don't think this is quite what you are after, though I could be mistake= n.=20 > I did try the PXEBOOT idea on the exact same hardware platform and > was unable to get it to work, back at FreeBSD 10->11.=20 I have pxelinux+pxeboot+mfsBSD working fine, but with legacy BIOS. > Do you know of any technical reading that can get one up to speed on the = low > level details of UEFI booting and how it is different from BIOS? One prob= lem in > debugging all these methods is the ever-present lack of documentation. :/= =20 No, I don't. My knowledge of the thing is very rudimentary. I know that the UEFI "BIOS" looks for the "efi" type partition in the GPT, or for the EF partition in the MBR, finds a EFI executable under some special path like /EFI/BOOT/BOOTX64.EFI, and this EFI executable is supposed to know how to load the main OS. Therefore my cheat sheet for making a UEFI bootable freebsd UFS volume is like this: gpart create -s gpt ada1 # will become ada0 gpart add -s200M -t efi ada1 gpart add -s2G -t freebsd-swap ada1 gpart add -t freebsd-ufs ada1 gpart bootcode -p /boot/boot1.efifat -i 1 ada1 =20 Instead of "gpart bootcode -p /boot/boot1.efifat -i 1 ada1" we can just as well run=20 "newfs_msdos /dev/ada1p1 ; mount_msdosfs /dev/ada1p1 /mnt ; rsync -r ... /m= nt" --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --VbJkn9YxBvnuCH5J Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJf6t1hAAoJEA2k8lmbXsY0uBIH/3moH1hCENw4qb1TLFCnx3ZT rpWypI+ilpn133h5vVzKmAo6zYSeDIMxoYlQRYSSKyt5lJAi6mLD6jH/nFmhvuOG MkzvEpLzefHb0i1/cyQg/M0Uga4xgEGH0F8ciLQaPNijwsHY8rPgJ+BaXaqZDhcS FkDPERFkkhL9mVBalOZtXWdazZWH8sitzFDbQI4/BcQa54z8Via0y4mA1ws92Rg/ VUcNteEIKSE6uyL9x+KAx6p+rMFQJ/Bc6g+gNiN2Coq4EI4Orz++iXsDlqftXJ6a A7txjC3wW3i8yLO5M++vWRN59knaMq5loGhcS1U6F15ISSd6nJEaQq65Gw2rdEA= =gBE7 -----END PGP SIGNATURE----- --VbJkn9YxBvnuCH5J-- From owner-freebsd-questions@freebsd.org Tue Dec 29 07:42:14 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7A1554D3C7A for ; Tue, 29 Dec 2020 07:42:14 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-io1-xd31.google.com (mail-io1-xd31.google.com [IPv6:2607:f8b0:4864:20::d31]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4mb95BKGz3QZB for ; Tue, 29 Dec 2020 07:42:13 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-io1-xd31.google.com with SMTP id i18so11455493ioa.1 for ; Mon, 28 Dec 2020 23:42:13 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=qmYzWHRLFjACZLSF3FwlMn8BGv5oJE3Fu/89sT8vSHI=; b=K9+vXXtBkvovgv2oDKvuTVJohUqz8wU6iWOiTsJ5mxJllIq+AVxc7I25AbSSqHusRT hi0uDrVRelNxIpmJ3DpYeNpb8A8kFAzTLpbEZ47s8gyfpFw7asA5JUYr2Aw1fgtdyKwP AtEH6NDbleKPoIH7I6n/NexgPHPJokv5oS5SWwBhpH45AoO0+hqaeM2TIhK0MM98OjFQ LL1SRdHzEEzyLbVwOlLG3Dq7UZQ29E4x5A+sROOkVALob6cjFJ3AZuAypfHeBqPTNa7L /ssTYI4zFZXVf+AMc1XApP91SY7uYOlxew3zaLh+IF30Hz1JZEN4cyczTMvfjbt0AFXr vMqw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=qmYzWHRLFjACZLSF3FwlMn8BGv5oJE3Fu/89sT8vSHI=; b=PfIsCl9JUQDXGtGLKl/z4ehlkEAmfBqYlkyQcFtFc16Zj3Lchk7qQzW7f3/tmZsxzG wTEhL/aVaohrVttbwrOmqZX2fsNR+rgpH9FZEhY4dyB7rkRNBmz6PWrkgs/loZqlgNds PSIUPHmuiy71alj/8+QYqmdLRTQMfxESvzjWYrQNQkrdfK1RF9+DbaRH14UpzaANxEGv g+YonpsDqtnpBTLn0GmVGZzse0fM5djx2xeqlzqafb5NUyYXntHZ0Xt171PUNCSsUO0Z YRHBjvTXn8sYikZZLMaPlIS5te4GwelZeHsOo9OPzEDiL6jB/BvGJaHSwUZNn9VG/o7v TPxw== X-Gm-Message-State: AOAM530WhaBhXw/yHDqyWHjKGs6WOuVwu5e9tr/H4W07ZbW5DodF39qY ezXsiwYS/CFhYnbvr8yGMyQKTvLUHRG5WkSHeJP15aBr X-Google-Smtp-Source: ABdhPJx0A0EMZA+WNDwyYbl910ltWpt+/MoLXylNvxk1UTBN3beNMLGwzQ0pjtE5dQ0j2R1r9aLZaAF+EWZelv8cWMo= X-Received: by 2002:a05:6602:1608:: with SMTP id x8mr39100450iow.72.1609227732818; Mon, 28 Dec 2020 23:42:12 -0800 (PST) MIME-Version: 1.0 References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> In-Reply-To: <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> From: Michael Schuster Date: Tue, 29 Dec 2020 08:42:01 +0100 Message-ID: Subject: Re: Observations on virtual memory operations To: Pete Wright Cc: doug@safeport.com, freeBSD Mailing List X-Rspamd-Queue-Id: 4D4mb95BKGz3QZB X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=K9+vXXtB; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::d31 as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d31:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d31:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d31:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 07:42:14 -0000 On Tue, Dec 29, 2020, 00:37 Pete Wright wrote: > > > On 12/28/20 3:25 PM, doug wrote: > > I have two servers running jails that "routinely" run out of swapspace > > with > > no demand paging activity. To try and get a handle on VM/swapspace > > management I have been tracking swapinfo vs memory use as measured by > > top. > > The numbers do not exactly add up but I assume that is not involved in my > > issue. > > > > > > > The other day I caught the system at 73% swapspace used. At this level > > the > > system was in a near thrashing state in that typing a key got it > > echoed in > > 10 <--> 30 seconds. There was about 600MB of swapspace at this point. I > > would think there is no way to debug this except as a thought experiment. > > The first thing that comes to mind is do you have the ability to hook > any metrics/monitoring onto this system. For example, I use collectd on > my systems to report overall CPU/memory metrics as well as per-process > memory metrics. > > Alternatively you could write a simple shell script that run's "ps" and > parses the output of memory utilization on a per-process basis. > > either of the above approaches should give you some insight into where > the memory leak is coming from (assuming you already do not know). > > one trick i use is to invoke a process with "limits" to ensure it does > not exceed a certain amount of memory that I allocate to it. for example > with firefox i do this: > $ limits -m 6g -v 6g /usr/local/bin/firefox > > that should at least buy you enough time to investigate why the process > needs so much memory and see what you can do about it. > If the usual observation tools (and please note, I don't have too much specific knowledge here) don't tell you what you need to know, have a look at DTrace. Again, I have no (active) specific knowledge; personally, I would start with Brendan Gregg's tools (ask your favourite search engine)... Regards Michael From owner-freebsd-questions@freebsd.org Tue Dec 29 12:55:57 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EC1CB4BD453 for ; Tue, 29 Dec 2020 12:55:57 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4vY90d9pz4WRb for ; Tue, 29 Dec 2020 12:55:56 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from bell.riseup.net (bell-pn.riseup.net [10.0.1.178]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4D4vY55LJtzDqKF for ; Tue, 29 Dec 2020 04:55:53 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1609246554; bh=gNZ9rxWhHrY+GRfkiCA7z8OWvRV95WNrvu0XOfibMMU=; h=Date:From:To:Subject:From; b=SBObpqsDgyDLkD1O5hg4oqIr6dnUtwDGV9zILY4xmhQVgeUqsJjJhVlUn/hoLiz1b 0oFNt3ZrSiiAjj8oJivWLZrfeBqcE/7e7FO60i5xnq3c/AvRrvWSljjf4RrfESTpC4 qdQa3ostRHJ79mHRTjbpsbyiYSuS0Ud4XBrgLj2k= X-Riseup-User-ID: 29C9F4131980004564BBEA0549C51B4EBFD2284AF8D5347F44275A336D4B0CE0 Received: from [127.0.0.1] (localhost [127.0.0.1]) by bell.riseup.net (Postfix) with ESMTPSA id 4D4vY21PvCzJnM7 for ; Tue, 29 Dec 2020 04:55:49 -0800 (PST) Date: Tue, 29 Dec 2020 15:55:37 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: graphics on amd radeon vega Message-ID: MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="6GGv+tyRjgQ7ppYp" Content-Disposition: inline X-Rspamd-Queue-Id: 4D4vY90d9pz4WRb X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=SBObpqsD; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of oskarsh@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=oskarsh@riseup.net X-Spamd-Result: default: False [-6.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; HAS_ATTACHMENT(0.00)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:~,4:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,multipart/mixed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 12:55:58 -0000 --6GGv+tyRjgQ7ppYp Content-Type: multipart/mixed; protected-headers=v1; boundary="8qgHJvmCwkOXuh0w" Content-Disposition: inline Date: Tue, 29 Dec 2020 15:55:37 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: graphics on amd radeon vega --8qgHJvmCwkOXuh0w Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Hello! I'm using FreeBSD 12.1-RELEASE-p10 (amd64) on Lenovo S340. There is an AMD Ryzen CPU with Radeon Vega Mobile Gfx as it's printed in dmesg. The problem is I cannot use amdgpu drivers. I built them from ports, I wrote kld_list=3D"/boot/modules/amdgpu.ko" in /etc/rc.conf, I added myself in "video" group. When I boot the laptop I can notice interface is laggy. Video in mpv is lagging, switching windows in wm is lagging and so on. I checked glxheads information, it prints GL_RENDERER is "llvmpipe". As I understand it means X11 uses default llvm drivers. I checked Xorg.0.logs, there are these lines: ... [ 9.738] (EE) open /dev/dri/card0: No such file or directory [ 9.738] (WW) Falling back to old probe method for modesetting [ 9.738] (EE) open /dev/dri/card0: No such file or directory [ 9.738] (WW) Falling back to old probe method for scfb ... which also shows something is wrong with loading drivers, as I understand. Experimenting I ended up with radeonkms module in rc.conf but I see no difference, everything is the same with radeon and amdgpu drivers. I attached graphics_on_vega.tar.gz archive which contains: graphics_on_vega/devinfo that's `devinfo -vr` output graphics_on_vega/dmesg that's `dmesg` output graphics_on_vega/hw.model that's `sysctl hw.model` output graphics_on_vega/pciconf that's `pciconf -lvbce` output graphics_on_vega/pkg_info that's `pkg info` output graphics_on_vega/Xorg.0.log that's `cat /var/log/Xorg.0.log` output Is it a problem with my understandings how to set up drivers, with Radeon Vega GPUs or with drivers themselves? Should I file a bug report to freebsd-x11@freebsd.org? --=20 Oskar Sharipov site (might be unpaid and cancelled): oskarsh.ru e-mail (replace asterisk with dot): oskarsh at riseup * net secondary e-mail (same): oskar * sharipov at tutanota * org gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 --8qgHJvmCwkOXuh0w-- --6GGv+tyRjgQ7ppYp Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iHUEARYKAB0WIQRJJMXN6/nibGTfWk0+WR6AK2efSAUCX+snSQAKCRA+WR6AK2ef SOZHAQD6CgSHM5xg5vQ1ZqrnlQ4wqF9QXMRWQY7pBTbZbxUS+AD+JkxtldY6YaZU 10iPiiVvioyDx2fXWrL5WYLOIFuiqA0= =F+QJ -----END PGP SIGNATURE----- --6GGv+tyRjgQ7ppYp-- From owner-freebsd-questions@freebsd.org Tue Dec 29 13:03:25 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8E5804BDA4A for ; Tue, 29 Dec 2020 13:03:25 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4vjl6GPvz4X05 for ; Tue, 29 Dec 2020 13:03:23 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from bell.riseup.net (bell-pn.riseup.net [10.0.1.178]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4D4vjd6lv2zDqKF for ; Tue, 29 Dec 2020 05:03:17 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1609246999; bh=FuF/dZg4UbcGTa3DeJgbxsUI2JNrl0CZDg4zeOjLfYw=; h=Date:From:To:Subject:References:In-Reply-To:From; b=gfA1Izfrg5jmMQgHkuj63zRu24qRszjSHxOQ4pQSZCaEx/OUiGLqqh0kDaG9vWcLA nufsCkVieW4LJf5KNk2MHxc3ptCjl7hmVS+uIyxbcutjX2kpycV/lFAlNQFzdodqrR bTBnHULjtqbpcDp9sh7Z4cyzjo5wya7jmjyNdqrM= X-Riseup-User-ID: 0A0F1B6EC0816B69E1BF8FE922B020DD724475BB698C94857D280E22EEB5BFCC Received: from [127.0.0.1] (localhost [127.0.0.1]) by bell.riseup.net (Postfix) with ESMTPSA id 4D4vjR726MzJnS0 for ; Tue, 29 Dec 2020 05:03:07 -0800 (PST) Date: Tue, 29 Dec 2020 16:03:03 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: Re: graphics on amd radeon vega Message-ID: References: MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="7eONtfCMZgtK0KXg" Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4D4vjl6GPvz4X05 X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=gfA1Izfr; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of oskarsh@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=oskarsh@riseup.net X-Spamd-Result: default: False [-6.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; HAS_ATTACHMENT(0.00)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:+,4:+,5:+,6:+,7:+,8:+,9:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; SH_EMAIL_DBL_DONT_QUERY_IPS(0.00)[0.0.0.0:email]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,multipart/mixed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DBL_PROHIBIT(0.00)[0.0.0.0:email]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 13:03:25 -0000 --7eONtfCMZgtK0KXg Content-Type: multipart/mixed; protected-headers=v1; boundary="yvKPtJ8e/9/fHVzf" Content-Disposition: inline Date: Tue, 29 Dec 2020 16:03:03 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: Re: graphics on amd radeon vega --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable =20 > I attached graphics_on_vega.tar.gz archive which contains: >=20 > graphics_on_vega/devinfo that's `devinfo -vr` output > graphics_on_vega/dmesg that's `dmesg` output > graphics_on_vega/hw.model that's `sysctl hw.model` output > graphics_on_vega/pciconf that's `pciconf -lvbce` output > graphics_on_vega/pkg_info that's `pkg info` output > graphics_on_vega/Xorg.0.log that's `cat /var/log/Xorg.0.log` output >=20 I got that the archive was removed from a list. I'm attaching files to this mail then. --=20 Oskar Sharipov site (might be unpaid and cancelled): oskarsh.ru e-mail (replace asterisk with dot): oskarsh at riseup * net secondary e-mail (same): oskar * sharipov at tutanota * org gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename=devinfo nexus0 cryptosoft0 apic0 vtvga0 I/O memory addresses: 0xa0000-0xaffff ram0 I/O memory addresses: 0x0-0x9f7ff 0x100000-0x9afffff 0x9e00000-0x9efffff 0x9f0b000-0x973f8fff 0x97df9000-0xae00efff 0xaf7ff000-0xaf7fffff 0x100000000-0x1ceffffff acpi0 Interrupt request lines: 0x9 I/O ports: 0x10-0x1f 0x72-0x73 0x80 0x92 0xb0-0xb1 0x400-0x4cf 0x4d0-0x4d1 0x4d6 0xc00-0xc01 0xc14 0xc50-0xc52 0xc6c 0xc6f 0xcd0-0xcdb I/O memory addresses: 0xe0000-0xfffff 0xfde00000-0xfdefffff 0xfec00000-0xfec01fff 0xfee00000-0xfee00fff 0xff800000-0xffffffff cpu0 pnpinfo _HID=none _UID=0 at handle=\_PR_.C000 ACPI I/O ports: 0x414 acpi_perf0 acpi_throttle0 hwpstate0 cpufreq0 cpu1 pnpinfo _HID=none _UID=0 at handle=\_PR_.C001 ACPI I/O ports: 0x414 acpi_perf1 acpi_throttle1 hwpstate1 cpu2 pnpinfo _HID=none _UID=0 at handle=\_PR_.C002 ACPI I/O ports: 0x414 acpi_perf2 acpi_throttle2 hwpstate2 cpu3 pnpinfo _HID=none _UID=0 at handle=\_PR_.C003 ACPI I/O ports: 0x414 acpi_perf3 acpi_throttle3 hwpstate3 unknown pnpinfo _HID=none _UID=0 at handle=\_PR_.C004 unknown pnpinfo _HID=none _UID=0 at handle=\_PR_.C005 unknown pnpinfo _HID=none _UID=0 at handle=\_PR_.C006 unknown pnpinfo _HID=none _UID=0 at handle=\_PR_.C007 pcib0 pnpinfo _HID=PNP0A08 _UID=1 at handle=\_SB_.PCI0 I/O ports: 0xcf8-0xcff pci0 PCI domain 0 bus numbers: 0 hostb0 pnpinfo vendor=0x1022 device=0x15d0 subvendor=0x17aa subdevice=0x380c class=0x060000 at slot=0 function=0 dbsf=pci0:0:0:0 unknown pnpinfo vendor=0x1022 device=0x15d1 subvendor=0x17aa subdevice=0x380b class=0x080600 at slot=0 function=2 dbsf=pci0:0:0:2 hostb1 pnpinfo vendor=0x1022 device=0x1452 subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=1 function=0 dbsf=pci0:0:1:0 pcib1 pnpinfo vendor=0x1022 device=0x145d subvendor=0x1022 subdevice=0x1234 class=0x060400 at slot=1 function=2 dbsf=pci0:0:1:2 handle=\_SB_.PCI0.GPP1 I/O memory addresses: 0xc0800000-0xc08fffff PCI domain 0 bus numbers: 1 pci1 pcib1 bus numbers: 1 sdhci_pci0 pnpinfo vendor=0x1217 device=0x8621 subvendor=0x17aa subdevice=0x3821 class=0x080501 at slot=0 function=0 dbsf=pci0:1:0:0 handle=\_SB_.PCI0.GPP1.DEV0 Interrupt request lines: 0x103 pcib1 memory window: 0xc0800000-0xc08007ff 0xc0801000-0xc0801fff pcib2 pnpinfo vendor=0x1022 device=0x145d subvendor=0x1022 subdevice=0x1234 class=0x060400 at slot=1 function=3 dbsf=pci0:0:1:3 handle=\_SB_.PCI0.GPP2 I/O memory addresses: 0xc0200000-0xc03fffff PCI domain 0 bus numbers: 2 pci2 pcib2 bus numbers: 2 unknown pnpinfo vendor=0x168c device=0x0042 subvendor=0x17aa subdevice=0x0901 class=0x028000 at slot=0 function=0 dbsf=pci0:2:0:0 pcib2 memory window: 0xc0200000-0xc03fffff pcib3 pnpinfo vendor=0x1022 device=0x15d3 subvendor=0x1022 subdevice=0x1234 class=0x060400 at slot=1 function=7 dbsf=pci0:0:1:7 handle=\_SB_.PCI0.GPP6 I/O memory addresses: 0xc0700000-0xc07fffff PCI domain 0 bus numbers: 3 pci3 pcib3 bus numbers: 3 nvme0 pnpinfo vendor=0x1cc4 device=0x5008 subvendor=0x1cc4 subdevice=0x5008 class=0x010802 at slot=0 function=0 dbsf=pci0:3:0:0 Interrupt request lines: 0x104 0x105 0x106 0x107 0x108 pcib3 memory window: 0xc0700000-0xc0703fff hostb2 pnpinfo vendor=0x1022 device=0x1452 subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=8 function=0 dbsf=pci0:0:8:0 pcib4 pnpinfo vendor=0x1022 device=0x15db subvendor=0x1022 subdevice=0x0000 class=0x060400 at slot=8 function=1 dbsf=pci0:0:8:1 handle=\_SB_.PCI0.GP17 I/O ports: 0x1000-0x1fff I/O memory addresses: 0xb0000000-0xc01fffff 0xc0400000-0xc06fffff PCI domain 0 bus numbers: 4 pci4 pcib4 bus numbers: 4 vgapci0 pnpinfo vendor=0x1002 device=0x15d8 subvendor=0x17aa subdevice=0x3802 class=0x030000 at slot=0 function=0 dbsf=pci0:4:0:0 handle=\_SB_.PCI0.GP17.VGA_ pcib4 I/O port window: 0x1000-0x10ff pcib4 memory window: 0xc0600000-0xc067ffff pcib4 prefetch window: 0xb0000000-0xbfffffff 0xc0000000-0xc01fffff drm0 drmn0 acpi_video0 hdac0 pnpinfo vendor=0x1002 device=0x15de subvendor=0x17aa subdevice=0x380f class=0x040300 at slot=0 function=1 dbsf=pci0:4:0:1 Interrupt request lines: 0x109 pcib4 memory window: 0xc06c8000-0xc06cbfff hdacc0 pnpinfo vendor=0x1002 device=0xaa01 revision=0x07 stepping=0x00 at cad=0 hdaa0 pnpinfo type=0x01 subsystem=0x00aa0100 at nid=1 pcm0 at nid=3 unknown pnpinfo vendor=0x1022 device=0x15df subvendor=0x17aa subdevice=0x3810 class=0x108000 at slot=0 function=2 dbsf=pci0:4:0:2 handle=\_SB_.PCI0.GP17.PSP_ pcib4 memory window: 0xc0500000-0xc05fffff 0xc06cc000-0xc06cdfff xhci0 pnpinfo vendor=0x1022 device=0x15e5 subvendor=0x17aa subdevice=0x3802 class=0x0c0330 at slot=0 function=3 dbsf=pci0:4:0:3 handle=\_SB_.PCI0.GP17.XHC0 Interrupt request lines: 0x10a pcib4 memory window: 0xc0400000-0xc04fffff usbus0 uhub0 ums0 pnpinfo vendor=0x046d product=0xc05b devclass=0x00 devsubclass=0x00 devproto=0x00 sernum="" release=0x5400 mode=host intclass=0x03 intsubclass=0x01 intprotocol=0x02 at bus=0 hubaddr=1 port=2 devaddr=2 interface=0 ugen=ugen0.2 ubt0 pnpinfo vendor=0x0cf3 product=0xe500 devclass=0xe0 devsubclass=0x01 devproto=0x01 sernum="" release=0x0001 mode=host intclass=0xe0 intsubclass=0x01 intprotocol=0x01 at bus=0 hubaddr=1 port=6 devaddr=4 interface=0 ugen=ugen0.4 urndis0 pnpinfo vendor=0x2717 product=0xff80 devclass=0x00 devsubclass=0x00 devproto=0x00 sernum="22221bf3" release=0x0414 mode=host intclass=0xe0 intsubclass=0x01 intprotocol=0x03 at bus=0 hubaddr=1 port=3 devaddr=5 interface=0 ugen=ugen0.5 unknown pnpinfo vendor=0x1022 device=0x15e2 subvendor=0x17aa subdevice=0x3813 class=0x048000 at slot=0 function=5 dbsf=pci0:4:0:5 handle=\_SB_.PCI0.GP17.ACP_ pcib4 memory window: 0xc0680000-0xc06bffff hdac1 pnpinfo vendor=0x1022 device=0x15e3 subvendor=0x17aa subdevice=0x3814 class=0x040300 at slot=0 function=6 dbsf=pci0:4:0:6 handle=\_SB_.PCI0.GP17.AZAL Interrupt request lines: 0x10b pcib4 memory window: 0xc06c0000-0xc06c7fff hdacc1 pnpinfo vendor=0x10ec device=0x0257 revision=0x00 stepping=0x01 at cad=0 hdaa1 pnpinfo type=0x01 subsystem=0x17aa380d at nid=1 pcm1 at nid=20,33,18 pcm2 at nid=25 intsmb0 pnpinfo vendor=0x1022 device=0x790b subvendor=0x17aa subdevice=0x381c class=0x0c0500 at slot=20 function=0 dbsf=pci0:0:20:0 handle=\_SB_.PCI0.SMBS I/O ports: 0xb00-0xb0f smbus0 isab0 pnpinfo vendor=0x1022 device=0x790e subvendor=0x17aa subdevice=0x381b class=0x060100 at slot=20 function=3 dbsf=pci0:0:20:3 handle=\_SB_.PCI0.LPC0 isa0 sc0 vga0 fdc0 ppc0 uart0 uart1 hostb3 pnpinfo vendor=0x1022 device=0x15e8 subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=0 dbsf=pci0:0:24:0 hostb4 pnpinfo vendor=0x1022 device=0x15e9 subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=1 dbsf=pci0:0:24:1 hostb5 pnpinfo vendor=0x1022 device=0x15ea subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=2 dbsf=pci0:0:24:2 hostb6 pnpinfo vendor=0x1022 device=0x15eb subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=3 dbsf=pci0:0:24:3 hostb7 pnpinfo vendor=0x1022 device=0x15ec subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=4 dbsf=pci0:0:24:4 hostb8 pnpinfo vendor=0x1022 device=0x15ed subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=5 dbsf=pci0:0:24:5 hostb9 pnpinfo vendor=0x1022 device=0x15ee subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=6 dbsf=pci0:0:24:6 hostb10 pnpinfo vendor=0x1022 device=0x15ef subvendor=0x0000 subdevice=0x0000 class=0x060000 at slot=24 function=7 dbsf=pci0:0:24:7 acpi_sysresource0 pnpinfo _HID=PNP0C02 _UID=0 at handle=\_SB_.PCI0.MEMR hpet0 pnpinfo _HID=PNP0103 _UID=0 at handle=\_SB_.PCI0.HPET Interrupt request lines: 0x100 0x101 0x102 I/O memory addresses: 0xfed00000-0xfed003ff atdma0 pnpinfo _HID=PNP0200 _UID=0 at handle=\_SB_.PCI0.LPC0.DMAC DMA request lines: 4 I/O ports: 0x0-0xf 0x81-0x8f 0xc0-0xdf fpupnp0 pnpinfo _HID=PNP0C04 _UID=0 at handle=\_SB_.PCI0.LPC0.COPR I/O ports: 0xf0-0xfe unknown pnpinfo _HID=PNP0000 _UID=0 at handle=\_SB_.PCI0.LPC0.PIC_ I/O ports: 0x20-0x21 0xa0-0xa1 atrtc0 pnpinfo _HID=PNP0B00 _UID=0 at handle=\_SB_.PCI0.LPC0.RTC_ Interrupt request lines: 0x8 I/O ports: 0x70-0x71 unknown pnpinfo _HID=PNP0800 _UID=0 at handle=\_SB_.PCI0.LPC0.SPKR I/O ports: 0x61 attimer0 pnpinfo _HID=PNP0100 _UID=0 at handle=\_SB_.PCI0.LPC0.TMR_ Interrupt request lines: 0x0 I/O ports: 0x40-0x43 atkbdc0 pnpinfo _HID=FUJ7401 _UID=0 at handle=\_SB_.PCI0.LPC0.KBC0 Interrupt request lines: 0x1 I/O ports: 0x60 0x64 atkbd0 psm0 acpi_sysresource1 pnpinfo _HID=PNP0C02 _UID=1 at handle=\_SB_.PCI0.LPC0.SYSR acpi_sysresource2 pnpinfo _HID=PNP0C01 _UID=0 at handle=\_SB_.PCI0.LPC0.MEM_ acpi_ec0 pnpinfo _HID=PNP0C09 _UID=0 at handle=\_SB_.PCI0.LPC0.EC0_ I/O ports: 0x62 0x66 unknown pnpinfo _HID=LIC0001 _UID=0 at handle=\_SB_.PCI0.LPC0.EC0_.ITSD unknown pnpinfo _HID=VPC2004 _UID=0 at handle=\_SB_.PCI0.LPC0.EC0_.VPC0 battery0 pnpinfo _HID=PNP0C0A _UID=0 at handle=\_SB_.PCI0.LPC0.BAT1 acpi_acad0 pnpinfo _HID=ACPI0003 _UID=0 at handle=\_SB_.PCI0.LPC0.ACAD unknown pnpinfo _HID=PNP0501 _UID=4 at handle=\_SB_.PCI0.UAR1 (disabled) unknown pnpinfo _HID=PNP0501 _UID=2 at handle=\_SB_.PCI0.UAR2 (disabled) unknown pnpinfo _HID=PNP0501 _UID=3 at handle=\_SB_.PCI0.UAR3 (disabled) unknown pnpinfo _HID=PNP0501 _UID=1 at handle=\_SB_.PCI0.UAR4 (disabled) pci_link0 pnpinfo _HID=PNP0C0F _UID=1 at handle=\_SB_.LNKA pci_link1 pnpinfo _HID=PNP0C0F _UID=2 at handle=\_SB_.LNKB pci_link2 pnpinfo _HID=PNP0C0F _UID=3 at handle=\_SB_.LNKC pci_link3 pnpinfo _HID=PNP0C0F _UID=4 at handle=\_SB_.LNKD pci_link4 pnpinfo _HID=PNP0C0F _UID=5 at handle=\_SB_.LNKE pci_link5 pnpinfo _HID=PNP0C0F _UID=6 at handle=\_SB_.LNKF pci_link6 pnpinfo _HID=PNP0C0F _UID=7 at handle=\_SB_.LNKG pci_link7 pnpinfo _HID=PNP0C0F _UID=8 at handle=\_SB_.LNKH acpi_lid0 pnpinfo _HID=PNP0C0D _UID=0 at handle=\_SB_.LID_ acpi_button0 pnpinfo _HID=PNP0C0C _UID=0 at handle=\_SB_.PWRB unknown pnpinfo _HID=AMDI0060 _UID=0 at handle=\_SB_.SPI1 (disabled) unknown pnpinfo _HID=AMDI0030 _UID=0 at handle=\_SB_.GPIO I/O memory addresses: 0xfed81500-0xfed818ff unknown pnpinfo _HID=AMDI0020 _UID=0 at handle=\_SB_.FUR0 I/O memory addresses: 0xfedc7000-0xfedc7fff 0xfedc9000-0xfedc9fff unknown pnpinfo _HID=UTK0001 _UID=0 at handle=\_SB_.FUR0.UART (disabled) unknown pnpinfo _HID=AMDI0020 _UID=1 at handle=\_SB_.FUR1 I/O memory addresses: 0xfedc8000-0xfedc8fff 0xfedca000-0xfedcafff unknown pnpinfo _HID=UTK0001 _UID=1 at handle=\_SB_.FUR1.UART (disabled) unknown pnpinfo _HID=AMDI0020 _UID=2 at handle=\_SB_.FUR2 I/O memory addresses: 0xfedcc000-0xfedccfff 0xfedce000-0xfedcefff unknown pnpinfo _HID=AMDI0020 _UID=3 at handle=\_SB_.FUR3 I/O memory addresses: 0xfedcd000-0xfedcdfff 0xfedcf000-0xfedcffff unknown pnpinfo _HID=AMDI0011 _UID=0 at handle=\_SB_.I2CA (disabled) unknown pnpinfo _HID=STK0001 _UID=0 at handle=\_SB_.I2CA.WTP1 (disabled) unknown pnpinfo _HID=STK0001 _UID=0 at handle=\_SB_.I2CA.MTP1 (disabled) unknown pnpinfo _HID=STK0002 _UID=0 at handle=\_SB_.I2CA.WTP2 (disabled) unknown pnpinfo _HID=STK0002 _UID=0 at handle=\_SB_.I2CA.MTP2 (disabled) unknown pnpinfo _HID=STK0003 _UID=0 at handle=\_SB_.I2CA.WTP3 (disabled) unknown pnpinfo _HID=STK0003 _UID=0 at handle=\_SB_.I2CA.MTP3 (disabled) unknown pnpinfo _HID=STK0004 _UID=0 at handle=\_SB_.I2CA.WTP4 (disabled) unknown pnpinfo _HID=STK0004 _UID=0 at handle=\_SB_.I2CA.MTP4 (disabled) unknown pnpinfo _HID=STK0005 _UID=0 at handle=\_SB_.I2CA.MTP5 (disabled) unknown pnpinfo _HID=NXP8013 _UID=1 at handle=\_SB_.I2CA.NFC1 (disabled) unknown pnpinfo _HID=PNP0C50 _UID=1 at handle=\_SB_.I2CA.TPNL (disabled) unknown pnpinfo _HID=PNP0C50 _UID=5 at handle=\_SB_.I2CA.TPDD (disabled) unknown pnpinfo _HID=AMDI0011 _UID=1 at handle=\_SB_.I2CB (disabled) unknown pnpinfo _HID=STK00012 _UID=0 at handle=\_SB_.I2CB.WT21 (disabled) unknown pnpinfo _HID=STK00012 _UID=0 at handle=\_SB_.I2CB.MT21 (disabled) unknown pnpinfo _HID=STK00022 _UID=0 at handle=\_SB_.I2CB.WT22 (disabled) unknown pnpinfo _HID=STK00022 _UID=0 at handle=\_SB_.I2CB.MT22 (disabled) unknown pnpinfo _HID=STK00032 _UID=0 at handle=\_SB_.I2CB.WT23 (disabled) unknown pnpinfo _HID=STK00032 _UID=0 at handle=\_SB_.I2CB.MT23 (disabled) unknown pnpinfo _HID=STK00042 _UID=0 at handle=\_SB_.I2CB.WT24 (disabled) unknown pnpinfo _HID=STK00042 _UID=0 at handle=\_SB_.I2CB.MT24 (disabled) unknown pnpinfo _HID=STK00052 _UID=0 at handle=\_SB_.I2CB.MT25 (disabled) unknown pnpinfo _HID=NXP8013 _UID=2 at handle=\_SB_.I2CB.NFC1 (disabled) unknown pnpinfo _HID=PNP0C50 _UID=2 at handle=\_SB_.I2CB.TPNL (disabled) unknown pnpinfo _HID=PNP0C50 _UID=6 at handle=\_SB_.I2CB.TPDD (disabled) ig4iic_acpi0 pnpinfo _HID=AMDI0010 _UID=2 at handle=\_SB_.I2CC Interrupt request lines: 0xe I/O memory addresses: 0xfedc4000-0xfedc4fff iicbus0 unknown pnpinfo _HID=STK00013 _UID=0 at handle=\_SB_.I2CC.WT31 (disabled) unknown pnpinfo _HID=STK00013 _UID=0 at handle=\_SB_.I2CC.MT31 (disabled) unknown pnpinfo _HID=STK00023 _UID=0 at handle=\_SB_.I2CC.WT32 (disabled) unknown pnpinfo _HID=STK00023 _UID=0 at handle=\_SB_.I2CC.MT32 (disabled) unknown pnpinfo _HID=STK00033 _UID=0 at handle=\_SB_.I2CC.WT33 (disabled) unknown pnpinfo _HID=STK00033 _UID=0 at handle=\_SB_.I2CC.MT33 (disabled) unknown pnpinfo _HID=STK00043 _UID=0 at handle=\_SB_.I2CC.WT34 (disabled) unknown pnpinfo _HID=STK00043 _UID=0 at handle=\_SB_.I2CC.MT34 (disabled) unknown pnpinfo _HID=STK00053 _UID=0 at handle=\_SB_.I2CC.MT35 (disabled) unknown pnpinfo _HID=NXP8013 _UID=3 at handle=\_SB_.I2CC.NFC1 (disabled) unknown pnpinfo _HID=PNP0C50 _UID=3 at handle=\_SB_.I2CC.TPNL (disabled) unknown pnpinfo _HID=PNP0C50 _UID=7 at handle=\_SB_.I2CC.TPDD (disabled) ig4iic_acpi1 pnpinfo _HID=AMDI0010 _UID=3 at handle=\_SB_.I2CD Interrupt request lines: 0x6 I/O memory addresses: 0xfedc5000-0xfedc5fff iicbus1 iichid0 at addr=0x15 hidbus0 hms0 pnpinfo page=0x0001 usage=0x0002 bus=0x18 vendor=0x04f3 product=0x304b version=0x0004 at index=0 hmt0 pnpinfo page=0x000d usage=0x0005 bus=0x18 vendor=0x04f3 product=0x304b version=0x0004 at index=1 hconf0 pnpinfo page=0x000d usage=0x000e bus=0x18 vendor=0x04f3 product=0x304b version=0x0004 at index=2 hidraw0 pnpinfo page=0x0000 usage=0x0000 bus=0x18 vendor=0x04f3 product=0x304b version=0x0004 at index=255 unknown pnpinfo _HID=STK00014 _UID=0 at handle=\_SB_.I2CD.WT41 (disabled) unknown pnpinfo _HID=STK00014 _UID=0 at handle=\_SB_.I2CD.MT41 (disabled) unknown pnpinfo _HID=STK00024 _UID=0 at handle=\_SB_.I2CD.WT42 (disabled) unknown pnpinfo _HID=STK00024 _UID=0 at handle=\_SB_.I2CD.MT42 (disabled) unknown pnpinfo _HID=STK00034 _UID=0 at handle=\_SB_.I2CD.WT43 (disabled) unknown pnpinfo _HID=STK00034 _UID=0 at handle=\_SB_.I2CD.MT43 (disabled) unknown pnpinfo _HID=STK00044 _UID=0 at handle=\_SB_.I2CD.WT44 (disabled) unknown pnpinfo _HID=STK00044 _UID=0 at handle=\_SB_.I2CD.MT44 (disabled) unknown pnpinfo _HID=STK00054 _UID=0 at handle=\_SB_.I2CD.MT45 (disabled) unknown pnpinfo _HID=NXP8013 _UID=4 at handle=\_SB_.I2CD.NFC1 (disabled) unknown pnpinfo _HID=PNP0C50 _UID=4 at handle=\_SB_.I2CD.TPNL (disabled) unknown pnpinfo _HID=SYNA3255 _UID=8 at handle=\_SB_.I2CD.TPDA (disabled) unknown pnpinfo _HID=SYNA3390 _UID=8 at handle=\_SB_.I2CD.TPDB (disabled) unknown pnpinfo _HID=ELAN469A _UID=8 at handle=\_SB_.I2CD.TPDC (disabled) acpi_iichid0 pnpinfo _HID=ELAN469D _UID=8 at handle=\_SB_.I2CD.TPDD ig4iic_acpi2 pnpinfo _HID=AMDI0010 _UID=0 at handle=\_SB_.I2CE Interrupt request lines: 0xa I/O memory addresses: 0xfedc2000-0xfedc2fff iicbus2 ig4iic_acpi3 pnpinfo _HID=AMDI0010 _UID=1 at handle=\_SB_.I2CF Interrupt request lines: 0xb I/O memory addresses: 0xfedc3000-0xfedc3fff iicbus3 unknown pnpinfo _HID=AMDI0040 _UID=0 at handle=\_SB_.EMM0 (disabled) unknown pnpinfo _HID=PNP0C14 _UID=0 at handle=\_SB_.WMI4 acpi_sysresource3 pnpinfo _HID=PNP0C02 _UID=144 at handle=\_SB_.AWR0 acpi_sysresource4 pnpinfo _HID=PNP0C02 _UID=128 at handle=\_SB_.AWR0.ABR0 acpi_sysresource5 pnpinfo _HID=PNP0C02 _UID=129 at handle=\_SB_.AWR0.ABR1 acpi_sysresource6 pnpinfo _HID=PNP0C02 _UID=130 at handle=\_SB_.AWR0.ABR2 acpi_sysresource7 pnpinfo _HID=PNP0C02 _UID=131 at handle=\_SB_.AWR0.ABR3 acpi_sysresource8 pnpinfo _HID=PNP0C02 _UID=132 at handle=\_SB_.AWR0.ABR4 acpi_sysresource9 pnpinfo _HID=PNP0C02 _UID=133 at handle=\_SB_.AWR0.ABR5 acpi_sysresource10 pnpinfo _HID=PNP0C02 _UID=134 at handle=\_SB_.AWR0.ABR6 unknown pnpinfo _HID=MSFT0101 _UID=0 at handle=\_SB_.TPM2 I/O memory addresses: 0xaeb23000-0xaeb26fff 0xaeb27000-0xaeb2afff unknown pnpinfo _HID=none _UID=0 at handle=\_SB_.PRWL acpi_timer0 pnpinfo unknown ACPI I/O ports: 0x408-0x40b --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename=dmesg Content-Transfer-Encoding: quoted-printable ---<>--- Copyright (c) 1992-2019 The FreeBSD Project. Copyright (c) 1979, 1980, 1983, 1986, 1988, 1989, 1991, 1992, 1993, 1994 The Regents of the University of California. All rights reserved. FreeBSD is a registered trademark of The FreeBSD Foundation. FreeBSD 12.1-RELEASE-p10 GENERIC amd64 FreeBSD clang version 8.0.1 (tags/RELEASE_801/final 366581) (based on LLVM = 8.0.1) VT(vga): resolution 640x480 CPU: AMD Ryzen 3 3200U with Radeon Vega Mobile Gfx (2595.18-MHz K8-class = CPU) Origin=3D"AuthenticAMD" Id=3D0x810f81 Family=3D0x17 Model=3D0x18 Step= ping=3D1 Features=3D0x178bfbff Features2=3D0x7ed8320b AMD Features=3D0x2e500800 AMD Features2=3D0x35c233ff Structured Extended Features=3D0x209c01a9 XSAVE Features=3D0xf AMD Extended Feature Extensions ID EBX=3D0x1007 SVM: NP,NRIP,VClean,AFlush,DAssist,NAsids=3D32768 TSC: P-state invariant, performance statistics real memory =3D 8589934592 (8192 MB) avail memory =3D 6114369536 (5831 MB) Event timer "LAPIC" quality 600 ACPI APIC Table: FreeBSD/SMP: Multiprocessor System Detected: 4 CPUs FreeBSD/SMP: 1 package(s) x 2 core(s) x 2 hardware threads random: unblocking device. ioapic0: Changing APIC ID to 33 ioapic1: Changing APIC ID to 34 ioapic0 irqs 0-23 on motherboard ioapic1 irqs 24-55 on motherboard Launching APs: 1 3 2 Timecounter "TSC-low" frequency 1297591399 Hz quality 1000 Cuse v0.1.36 @ /dev/cuse random: entropy device external interface kbd1 at kbdmux0 000.000024 [4335] netmap_init netmap: loaded module [ath_hal] loaded module_register_init: MOD_LOAD (vesa, 0xffffffff8112f0f0, 0) error 19 random: registering fast source Intel Secure Key RNG random: fast provider: "Intel Secure Key RNG" [ath_dfs] loaded [ath_rate] loaded [ar9300] loaded [ar5212] loaded [ar5416] loaded [ar5211] loaded [ar5210] loaded [ath] loaded nexus0 vtvga0: on motherboard cryptosoft0: on motherboard acpi0: on motherboard Firmware Error (ACPI): Could not resolve [\134_SB.PCI0.GPP2.BCM5], AE_NOT_F= OUND (20181213/dswload2-312) ACPI Error: AE_NOT_FOUND, During name lookup/catalog (20181213/psobject-372) acpi0: Power Button (fixed) cpu0: on acpi0 hpet0: iomem 0xfed00000-0xfed003ff irq 0,8 on = acpi0 Timecounter "HPET" frequency 14318180 Hz quality 950 Event timer "HPET" frequency 14318180 Hz quality 450 Event timer "HPET1" frequency 14318180 Hz quality 450 Event timer "HPET2" frequency 14318180 Hz quality 450 atrtc0: port 0x70-0x71 on acpi0 atrtc0: registered as a time-of-day clock, resolution 1.000000s Event timer "RTC" frequency 32768 Hz quality 0 attimer0: port 0x40-0x43 on acpi0 Timecounter "i8254" frequency 1193182 Hz quality 0 Event timer "i8254" frequency 1193182 Hz quality 100 Timecounter "ACPI-fast" frequency 3579545 Hz quality 900 acpi_timer0: <32-bit timer at 3.579545MHz> port 0x408-0x40b on acpi0 acpi_ec0: port 0x62,0x66 on acpi0 pcib0: port 0xcf8-0xcff on acpi0 pci0: on pcib0 pci0: at device 0.2 (no driver attached) pcib1: at device 1.2 on pci0 pci1: on pcib1 sdhci_pci0: mem 0xc0801000-0xc0801fff,0xc0800000-0xc08007f= f irq 28 at device 0.0 on pci1 sdhci_pci0: 1 slot(s) allocated pcib2: at device 1.3 on pci0 pci2: on pcib2 pci2: at device 0.0 (no driver attached) pcib3: at device 1.7 on pci0 pci3: on pcib3 nvme0: mem 0xc0700000-0xc0703fff irq 48 at device 0.0= on pci3 pcib4: irq 43 at device 8.1 on pci0 pci4: on pcib4 vgapci0: port 0x1000-0x10ff mem 0xb0000000-0xbffff= fff,0xc0000000-0xc01fffff,0xc0600000-0xc067ffff irq 52 at device 0.0 on pci4 vgapci0: Boot video device hdac0: mem 0xc06c8000-0xc06cbfff irq 53 at de= vice 0.1 on pci4 pci4: at device 0.2 (no driver attached) xhci0: mem 0xc0400000-0xc04fffff irq 55= at device 0.3 on pci4 xhci0: 64 bytes context size, 64-bit DMA xhci0: Unable to map MSI-X table=20 usbus0: waiting for BIOS to give up control xhci_interrupt: host controller halted usbus0 on xhci0 usbus0: 5.0Gbps Super Speed USB v3.0 pci4: at device 0.5 (no driver attached) hdac1: mem 0xc06c0000-0xc06c7fff irq 54 at de= vice 0.6 on pci4 isab0: at device 20.3 on pci0 isa0: on isab0 acpi_lid0: on acpi0 acpi_button0: on acpi0 ig4iic_acpi0: iomem 0xfedc4000-0xfedc4fff irq 1= 4 on acpi0 ig4iic_acpi0: controller error during attach-1 ig4iic_acpi1: iomem 0xfedc5000-0xfedc5fff irq 6= on acpi0 ig4iic_acpi2: iomem 0xfedc2000-0xfedc2fff irq 1= 0 on acpi0 ig4iic_acpi2: controller error during attach-1 ig4iic_acpi3: iomem 0xfedc3000-0xfedc3fff irq 1= 1 on acpi0 ig4iic_acpi3: controller error during attach-1 acpi_iichid0: on acpi0 atkbdc0: port 0x60,0x64 irq 1 on acpi0 atkbd0: irq 1 on atkbdc0 kbd0 at atkbd0 atkbd0: [GIANT-LOCKED] battery0: on acpi0 acpi_acad0: on acpi0 hwpstate0: on cpu0 ZFS filesystem version: 5 ZFS storage pool version: features support (5000) Timecounters tick every 1.000 msec ugen0.1: <0x1022 XHCI root HUB> at usbus0 uhub0: <0x1022 XHCI root HUB, class 9/0, rev 3.00/1.00, addr 1> on usbus0 nvd0: NVMe namespace nvd0: 122104MB (250069680 512 byte sectors) hdacc0: at cad 0 on hdac0 hdaa0: at nid 1 on hdacc0 pcm0: at nid 3 on hdaa0 hdacc1: at cad 0 on hdac1 hdaa1: at nid 1 on hdacc1 pcm1: at nid 20,33 and 18 on hdaa1 pcm2: at nid 25 on hdaa1 iicbus0: on ig4iic_acpi0 iicbus1: on ig4iic_acpi1 iichid0 at addr 0x15 on iicbus1 iichid0: on iicbus1 iichid0: Interrupt setup failed. Fallback to sampling hidbus0: on iichid0 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 iicbus2: on ig4iic_acpi2 iicbus3: on ig4iic_acpi3 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hms0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hms0: 33 buttons and [XYWH] coordinates ID=3D1 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hmt0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hconf0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hmt0: Multitouch touchpad with 0 external buttons, click-pad hmt0: 5 contacts with [C] properties. Report range [0:0] - [3209:2097] hidraw0: on hidbus0 Trying to mount root from zfs:zroot/ROOT/default []... Root mount waiting for: usbus0 uhub0: 10 ports with 10 removable, self powered ugen0.2: at usbus0 Root mount waiting for: usbus0 ugen0.3: at usbus0 Root mount waiting for: usbus0 ugen0.4: at usbus0 [drm] radeon kernel modesetting enabled. acpi_video0: on vgapci0 =2E.. --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename="hw.model" Content-Transfer-Encoding: quoted-printable hw.model: AMD Ryzen 3 3200U with Radeon Vega Mobile Gfx =20 --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename=pciconf Content-Transfer-Encoding: quoted-printable hostb0@pci0:0:0:0: class=3D0x060000 card=3D0x380c17aa chip=3D0x15d01022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Root Complex' class =3D bridge subclass =3D HOST-PCI none0@pci0:0:0:2: class=3D0x080600 card=3D0x380b17aa chip=3D0x15d11022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 IOMMU' class =3D base peripheral subclass =3D IOMMU cap 0f[40] =3D unknown cap 05[64] =3D MSI supports 4 messages, 64 bit=20 cap 08[74] =3D HT MSI fixed address window enabled at 0xfee00000 hostb1@pci0:0:1:0: class=3D0x060000 card=3D0x00000000 chip=3D0x14521022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Family 17h (Models 00h-1fh) PCIe Dummy Host Bridge' class =3D bridge subclass =3D HOST-PCI pcib1@pci0:0:1:2: class=3D0x060400 card=3D0x12341022 chip=3D0x145d1022 rev= =3D0x00 hdr=3D0x01 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Zeppelin Switch Upstream (PCIE SW.US)' class =3D bridge subclass =3D PCI-PCI cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[58] =3D PCI-Express 2 root port max data 128(512) RO NS ARI disa= bled link x1(x1) speed 2.5(8.0) ASPM L1(L1) slot 0 power limit 0 mW cap 05[a0] =3D MSI supports 1 message, 64 bit=20 cap 0d[c0] =3D PCI Bridge card=3D0x12341022 cap 08[c8] =3D HT MSI fixed address window enabled at 0xfee00000 ecap 000b[100] =3D Vendor 1 ID 1 ecap 0001[150] =3D AER 2 0 fatal 0 non-fatal 0 corrected ecap 0019[270] =3D PCIe Sec 1 lane errors 0x1 ecap 000d[2a0] =3D ACS 1 ecap 001e[370] =3D unknown 1 pcib2@pci0:0:1:3: class=3D0x060400 card=3D0x12341022 chip=3D0x145d1022 rev= =3D0x00 hdr=3D0x01 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Zeppelin Switch Upstream (PCIE SW.US)' class =3D bridge subclass =3D PCI-PCI cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[58] =3D PCI-Express 2 root port max data 128(512) RO NS ARI disa= bled link x1(x1) speed 2.5(8.0) ASPM L1(L1) slot 0 power limit 0 mW cap 05[a0] =3D MSI supports 1 message, 64 bit=20 cap 0d[c0] =3D PCI Bridge card=3D0x12341022 cap 08[c8] =3D HT MSI fixed address window enabled at 0xfee00000 ecap 000b[100] =3D Vendor 1 ID 1 ecap 0001[150] =3D AER 2 0 fatal 0 non-fatal 0 corrected ecap 0019[270] =3D PCIe Sec 1 lane errors 0 ecap 000d[2a0] =3D ACS 1 ecap 001e[370] =3D unknown 1 pcib3@pci0:0:1:7: class=3D0x060400 card=3D0x12341022 chip=3D0x15d31022 rev= =3D0x00 hdr=3D0x01 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 PCIe GPP Bridge [6:0]' class =3D bridge subclass =3D PCI-PCI cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[58] =3D PCI-Express 2 root port max data 256(512) RO NS ARI enab= led link x2(x2) speed 8.0(8.0) ASPM L1(L1) slot 0 power limit 0 mW cap 05[a0] =3D MSI supports 1 message, 64 bit=20 cap 0d[c0] =3D PCI Bridge card=3D0x12341022 cap 08[c8] =3D HT MSI fixed address window enabled at 0xfee00000 ecap 000b[100] =3D Vendor 1 ID 1 ecap 0001[150] =3D AER 2 0 fatal 0 non-fatal 0 corrected ecap 0019[270] =3D PCIe Sec 1 lane errors 0 ecap 000d[2a0] =3D ACS 1 ecap 001e[370] =3D unknown 1 hostb2@pci0:0:8:0: class=3D0x060000 card=3D0x00000000 chip=3D0x14521022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Family 17h (Models 00h-1fh) PCIe Dummy Host Bridge' class =3D bridge subclass =3D HOST-PCI pcib4@pci0:0:8:1: class=3D0x060400 card=3D0x00001022 chip=3D0x15db1022 rev= =3D0x00 hdr=3D0x01 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Internal PCIe GPP Bridge 0 to Bus A' class =3D bridge subclass =3D PCI-PCI cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[58] =3D PCI-Express 2 root port max data 128(512) RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 1 message, 64 bit=20 cap 0d[c0] =3D PCI Bridge card=3D0x00001022 ecap 000b[100] =3D Vendor 1 ID 1 ecap 0019[270] =3D PCIe Sec 1 lane errors 0 ecap 000d[2a0] =3D ACS 1 intsmb0@pci0:0:20:0: class=3D0x0c0500 card=3D0x381c17aa chip=3D0x790b1022 r= ev=3D0x61 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'FCH SMBus Controller' class =3D serial bus subclass =3D SMBus isab0@pci0:0:20:3: class=3D0x060100 card=3D0x381b17aa chip=3D0x790e1022 rev= =3D0x51 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'FCH LPC Bridge' class =3D bridge subclass =3D PCI-ISA hostb3@pci0:0:24:0: class=3D0x060000 card=3D0x00000000 chip=3D0x15e81022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 0' class =3D bridge subclass =3D HOST-PCI hostb4@pci0:0:24:1: class=3D0x060000 card=3D0x00000000 chip=3D0x15e91022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 1' class =3D bridge subclass =3D HOST-PCI hostb5@pci0:0:24:2: class=3D0x060000 card=3D0x00000000 chip=3D0x15ea1022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 2' class =3D bridge subclass =3D HOST-PCI hostb6@pci0:0:24:3: class=3D0x060000 card=3D0x00000000 chip=3D0x15eb1022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 3' class =3D bridge subclass =3D HOST-PCI hostb7@pci0:0:24:4: class=3D0x060000 card=3D0x00000000 chip=3D0x15ec1022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 4' class =3D bridge subclass =3D HOST-PCI hostb8@pci0:0:24:5: class=3D0x060000 card=3D0x00000000 chip=3D0x15ed1022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 5' class =3D bridge subclass =3D HOST-PCI hostb9@pci0:0:24:6: class=3D0x060000 card=3D0x00000000 chip=3D0x15ee1022 re= v=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 6' class =3D bridge subclass =3D HOST-PCI hostb10@pci0:0:24:7: class=3D0x060000 card=3D0x00000000 chip=3D0x15ef1022 r= ev=3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2 Device 24: Function 7' class =3D bridge subclass =3D HOST-PCI sdhci_pci0@pci0:1:0:0: class=3D0x080501 card=3D0x382117aa chip=3D0x86211217= rev=3D0x01 hdr=3D0x00 vendor =3D 'O2 Micro, Inc.' device =3D 'SD/MMC Card Reader Controller' class =3D base peripheral subclass =3D SD host controller bar [10] =3D type Memory, range 32, base 0xc0801000, size 4096, enabl= ed bar [14] =3D type Memory, range 32, base 0xc0800000, size 2048, enabl= ed cap 01[6c] =3D powerspec 3 supports D0 D3 current D0 cap 05[48] =3D MSI supports 1 message, 64 bit, vector masks enabled wit= h 1 message cap 10[80] =3D PCI-Express 2 endpoint max data 128(128) RO NS link x1(x1) speed 2.5(2.5) ASPM L1(L0s/L1) ecap 0002[100] =3D VC 1 max VC0 ecap 0001[200] =3D AER 1 0 fatal 0 non-fatal 0 corrected ecap 0018[230] =3D LTR 1 none1@pci0:2:0:0: class=3D0x028000 card=3D0x090117aa chip=3D0x0042168c rev= =3D0x31 hdr=3D0x00 vendor =3D 'Qualcomm Atheros' device =3D 'QCA9377 802.11ac Wireless Network Adapter' class =3D network bar [10] =3D type Memory, range 64, base 0xc0200000, size 2097152, en= abled cap 01[40] =3D powerspec 3 supports D0 D3 current D0 cap 05[50] =3D MSI supports 8 messages, vector masks=20 cap 10[70] =3D PCI-Express 2 endpoint max data 128(256) RO link x1(x1) speed 2.5(2.5) ASPM L1(L0s/L1) ecap 0001[100] =3D AER 2 0 fatal 0 non-fatal 0 corrected ecap 0002[148] =3D VC 1 max VC0 ecap 0003[168] =3D Serial 1 0000000000000000 ecap 0018[178] =3D LTR 1 ecap 001e[180] =3D unknown 1 nvme0@pci0:3:0:0: class=3D0x010802 card=3D0x50081cc4 chip=3D0x50081cc4 rev= =3D0x01 hdr=3D0x00 vendor =3D 'Union Memory (Shenzhen)' class =3D mass storage subclass =3D NVM bar [10] =3D type Memory, range 64, base 0xc0700000, size 16384, enab= led cap 10[80] =3D PCI-Express 2 endpoint max data 256(256) FLR RO NS link x2(x2) speed 8.0(8.0) ASPM L1(L0s/L1) cap 11[d0] =3D MSI-X supports 9 messages, enabled Table in map 0x10[0x2000], PBA in map 0x10[0x3000] cap 05[e0] =3D MSI supports 8 messages, 64 bit=20 cap 01[f8] =3D powerspec 3 supports D0 D3 current D0 ecap 000b[100] =3D Vendor 1 ID 5462 ecap 0018[108] =3D LTR 1 ecap 001e[110] =3D unknown 1 ecap 000e[128] =3D ARI 1 ecap 0001[200] =3D AER 1 0 fatal 0 non-fatal 0 corrected ecap 0019[300] =3D PCIe Sec 1 lane errors 0 vgapci0@pci0:4:0:0: class=3D0x030000 card=3D0x380217aa chip=3D0x15d81002 re= v=3D0xc4 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD/ATI]' device =3D 'Picasso' class =3D display subclass =3D VGA bar [10] =3D type Prefetchable Memory, range 64, base 0xb0000000, siz= e 268435456, enabled bar [18] =3D type Prefetchable Memory, range 64, base 0xc0000000, siz= e 2097152, enabled bar [20] =3D type I/O Port, range 32, base 0x1000, size 256, enabled bar [24] =3D type Memory, range 32, base 0xc0600000, size 524288, ena= bled cap 09[48] =3D vendor (length 8) cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[64] =3D PCI-Express 2 legacy endpoint max data 128(256) FLR RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 4 messages, 64 bit=20 cap 11[c0] =3D MSI-X supports 3 messages Table in map 0x24[0x42000], PBA in map 0x24[0x43000] ecap 000b[100] =3D Vendor 1 ID 1 ecap 0015[200] =3D Resizable BAR 1 ecap 0019[270] =3D PCIe Sec 1 lane errors 0 ecap 000d[2a0] =3D ACS 1 ecap 000f[2b0] =3D ATS 1 ecap 0013[2c0] =3D unknown 1 ecap 001b[2d0] =3D unknown 1 ecap 0018[320] =3D LTR 1 PCI-e errors =3D Non-Fatal Error Detected Unsupported Request Detected hdac0@pci0:4:0:1: class=3D0x040300 card=3D0x380f17aa chip=3D0x15de1002 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD/ATI]' device =3D 'Raven/Raven2/Fenghuang HDMI/DP Audio Controller' class =3D multimedia subclass =3D HDA bar [10] =3D type Memory, range 32, base 0xc06c8000, size 16384, enab= led cap 09[48] =3D vendor (length 8) cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[64] =3D PCI-Express 2 legacy endpoint max data 128(256) FLR RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 1 message, 64 bit enabled with 1 message ecap 000b[100] =3D Vendor 1 ID 1 PCI-e errors =3D Non-Fatal Error Detected Unsupported Request Detected none2@pci0:4:0:2: class=3D0x108000 card=3D0x381017aa chip=3D0x15df1022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Family 17h (Models 10h-1fh) Platform Security Processor' class =3D encrypt/decrypt bar [18] =3D type Memory, range 32, base 0xc0500000, size 1048576, en= abled bar [24] =3D type Memory, range 32, base 0xc06cc000, size 8192, enabl= ed cap 09[48] =3D vendor (length 8) cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[64] =3D PCI-Express 2 endpoint max data 128(256) RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 2 messages, 64 bit=20 cap 11[c0] =3D MSI-X supports 2 messages Table in map 0x24[0x0], PBA in map 0x24[0x1000] ecap 000b[100] =3D Vendor 1 ID 1 PCI-e errors =3D Non-Fatal Error Detected Unsupported Request Detected xhci0@pci0:4:0:3: class=3D0x0c0330 card=3D0x380217aa chip=3D0x15e51022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven2 USB 3.1' class =3D serial bus subclass =3D USB bar [10] =3D type Memory, range 64, base 0xc0400000, size 1048576, en= abled cap 09[48] =3D vendor (length 8) cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[64] =3D PCI-Express 2 endpoint max data 128(256) RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 8 messages, 64 bit enabled with 1 message cap 11[c0] =3D MSI-X supports 8 messages Table in map 0x10[0xfe000], PBA in map 0x10[0xff000] ecap 000b[100] =3D Vendor 1 ID 1 PCI-e errors =3D Non-Fatal Error Detected Unsupported Request Detected none3@pci0:4:0:5: class=3D0x048000 card=3D0x381317aa chip=3D0x15e21022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Raven/Raven2/FireFlight/Renoir Audio Processor' class =3D multimedia bar [10] =3D type Memory, range 32, base 0xc0680000, size 262144, ena= bled cap 09[48] =3D vendor (length 8) cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[64] =3D PCI-Express 2 endpoint max data 128(256) RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 1 message, 64 bit=20 ecap 000b[100] =3D Vendor 1 ID 1 PCI-e errors =3D Non-Fatal Error Detected Unsupported Request Detected hdac1@pci0:4:0:6: class=3D0x040300 card=3D0x381417aa chip=3D0x15e31022 rev= =3D0x00 hdr=3D0x00 vendor =3D 'Advanced Micro Devices, Inc. [AMD]' device =3D 'Family 17h (Models 10h-1fh) HD Audio Controller' class =3D multimedia subclass =3D HDA bar [10] =3D type Memory, range 32, base 0xc06c0000, size 32768, enab= led cap 09[48] =3D vendor (length 8) cap 01[50] =3D powerspec 3 supports D0 D3 current D0 cap 10[64] =3D PCI-Express 2 endpoint max data 128(256) RO NS link x16(x16) speed 8.0(8.0) ASPM disabled(L0s/L1) cap 05[a0] =3D MSI supports 1 message, 64 bit enabled with 1 message ecap 000b[100] =3D Vendor 1 ID 1 PCI-e errors =3D Non-Fatal Error Detected Unsupported Request Detected --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename=pkg_info CoinMP-1.8.4_3 Optimization library with support for COIN-OR CLP, CBC, and CGL GentiumBasic-1102_1 Gentium Basic and Gentium Book Basic TrueType fonts GraphicsMagick-1.3.35,1 Fast image processing tools based on ImageMagick ImageMagick7-7.0.10.24 Image processing tools Inconsolata-LGC-20131024_2 Monospaced TrueType font with Cyrillic glyphs ORBit2-2.14.19_2 High-performance CORBA ORB with support for the C language aalib-1.4.r5_13 ASCII art library adwaita-icon-theme-3.28.0 GNOME Symbolic Icons alac-0.0.7,1 Apple Lossless Audio Codec alsa-lib-1.1.2_2 ALSA compatibility library alsa-plugins-1.1.1_6 ALSA compatibility library plugins aom-2.0.0_1 AV1 reference encoder/decoder appres-1.0.5 Program to list application's resources apr-1.7.0.1.6.1_1 Apache Portability Library argp-standalone-1.3_4 Standalone version of arguments parsing functions from GLIBC argyllcms-1.9.2_5 ICC compatible color management system aria2-1.35.0 Yet another download tool asciidoc-9.0.4 Text document format for writing short documents and man pages asciio-1.51.3_2 Perl/GTK application that lets you draw ASCII charts using a GUI aspell-0.60.8,1 Spelling checker with better suggestion logic than ispell assimp-5.0.1 Library to import various 3D model formats in a uniform manner at-spi2-atk-2.34.2 Assisted Technology Provider module for GTK+ at-spi2-core-2.36.0 Assistive Technology Service Provider Interface atk-2.36.0 GNOME accessibility toolkit (ATK) atkmm-2.28.0 C++ wrapper for ATK API library autoconf-2.69_3 Automatically configure source code on many Un*x platforms autoconf-wrapper-20131203 Wrapper script for GNU autoconf automake-1.16.2 GNU Standards-compliant Makefile generator avahi-app-0.7_3 Service discovery on a local network babl-0.1.78 Dynamic pixel format conversion library base64-1.5_1 Utility to encode and decode base64 files bash-5.0.18_2 GNU Project's Bourne Again SHell bash-completion-2.11,2 Programmable completion library for Bash bhyve-firmware-1.0_1 Collection of Firmware for bhyve binutils-2.33.1_2,1 GNU binary tools bison-3.6.4,1 Parser generator from FSF, (mostly) compatible with Yacc bitmap-1.0.9 Bitmap editor and converter utilities for X bittorrent-libutp-0.20130514_1 The uTorrent Transport Protocol library and sample utilities boehm-gc-8.0.4_1 Garbage collection and memory leak detection for C and C++ boost-libs-1.72.0_2 Free portable C++ libraries (without Boost.Python) brotli-1.0.9,1 Generic-purpose lossless compression algorithm ca_root_nss-3.58 Root certificate bundle from the Mozilla Project cabextract-1.9.1 Program to extract Microsoft cabinet (.CAB) files cairo-1.16.0,2 Vector graphics library with cross-device output support cairomm-1.12.2_4 C++ interface to cairo celt-0.11.3_3 The CELT ultra-low delay audio codec check-0.15.2 Unit test framework for C chromium-84.0.4147.135 Google web browser based on WebKit clucene-2.3.3.4_19 C++ port of Lucene cmake-3.18.4 Cross-platform Makefile generator cmdwatch-0.2.0_2 Watches the output from a command at specified intervals colord-1.3.5 Manage color profiles to accurately color input/output devices consolekit2-1.2.1_1 Framework for defining and tracking users cowsay-3.04_1 Configurable talking characters in ASCII art cppunit-1.14.0_8 C++ port of the JUnit framework for unit testing crosextrafonts-caladea-20130214_4 Font created by Google for ChromeOS to replace MS Cambria crosextrafonts-carlito-20130920_4 Font created by Google for ChromeOS to replace MS Calibri cscope-15.9 Interactive C program browser ctags-5.8 Feature-filled tagfile generator for vi and emacs clones cups-2.3.3_1 Common UNIX Printing System cups-filters-1.27.5_2 Additional backends, filters and other software for CUPS curl-7.73.0 Command line tool and library for transferring data with URLs cyrus-sasl-2.1.27_1 RFC 2222 SASL (Simple Authentication and Security Layer) dav1d-0.7.1 Small and fast AV1 decoder db5-5.3.28_7 Oracle Berkeley DB, revision 5.3 dbus-1.12.20_3 Message bus system for inter-application communication dbus-glib-0.110 GLib bindings for the D-BUS messaging system dconf-0.36.0 Configuration database system for GNOME dee-1.2.7_18 Model to synchronize multiple instances over DBus dejavu-2.37_1 Bitstream Vera Fonts clone with a wider range of characters desktop-file-utils-0.26 Couple of command line utilities for working with desktop entries dht-0.26 Mainline variant of Kademlia Distributed Hash Table (DHT) dialog4ports-0.1.6 Console Interface to configure ports djvulibre-3.5.27_2 DjVu base libraries and utilities dmidecode-3.2 Tool for dumping DMI (SMBIOS) contents in human-readable format doas-6.3_1 Simple sudo alternative to run commands as another user docbook-1.5 Meta-port for the different versions of the DocBook DTD docbook-sgml-4.5_1 DocBook SGML DTD docbook-to-man-1.0_2 DocBook SGML DTD into nroff/troff -man macros converter docbook-utils-0.6.14_13 Generates various output formats from DocBook SGML documents docbook-xml-5.0_3 DocBook XML DTD docbook-xsl-1.79.1_1,1 XSL DocBook stylesheets dotconf-1.3_1 Simple, powerful configuration-file parser double-conversion-3.1.5.19 Binary-decimal and decimal-binary routines for IEEE doubles doxygen-1.8.15_3,2 Documentation system for C, C++, and other languages drm-fbsd12.0-kmod-4.16.g20201016 DRM modules for the linuxkpi-based KMS components drm-kmod-g20190710 Metaport of DRM modules for the linuxkpi-based KMS components dsssl-docbook-modular-1.79_1,1 DSSSL stylesheets for the DocBook DTD by Norman Walsh elinks-0.11.7_13 Links text WWW browser with enhancements en-gimp-help-html-2.10.0 GIMP User Manual in English enchant-1.6.0_9 Dictionary/spellchecking framework enchant2-2.2.3_4 Dictionary/spellchecking framework encodings-1.0.5,1 X.Org Encoding fonts espeak-1.48.04_7 Software speech synthesizer etc_os-release-0.1_3 Operating system identification file evdev-proto-5.8 Input event device header files exiv2-0.27.3,1 Exif, IPTC, and XMP metadata manipulation library and tools expat-2.2.10 XML 1.0 parser written in C fdk-aac-2.0.1 Port of the Fraunhofer FDK AAC Codec Library feh-3.5 Image viewer that utilizes Imlib2 ffmpeg-4.3.1_1,1 Realtime audio/video encoder/converter and streaming server fftw3-3.3.8_6 Fast C routines to compute the Discrete Fourier Transform fftw3-float-3.3.8_6 Fast Discrete Fourier Transform (Single Precision C Routines) fidocadj-0.24.8 Easy to use graphical editor for electronics fig2dev-3.2.7_1 Tools to convert Xfig .fig files figlet-2.2.5 SysV banner-like program prints strings in large fancy ASCII art firebird25-client-2.5.8_6 Firebird-2 database client firefox-83.0_2,2 Web browser based on the browser portion of Mozilla flac-1.3.3 Free lossless audio codec font-adobe-100dpi-1.0.3_4 X.Org Adobe 100dpi font font-adobe-75dpi-1.0.3_4 X.Org Adobe 75dpi font font-adobe-utopia-100dpi-1.0.4_4 X.Org Adobe Utopia 100dpi font font-adobe-utopia-75dpi-1.0.4_4 X.Org Adobe Utopia 75dpi font font-adobe-utopia-type1-1.0.4_4 X.Org Adobe Utopia Type1 font font-alias-1.0.4 X.Org Font aliases font-arabic-misc-1.0.3_4 X.Org miscellaneous Arabic fonts font-bh-100dpi-1.0.3_4 X.Org Bigelow Holmes 100dpi font font-bh-75dpi-1.0.3_4 X.Org Bigelow Holmes 75dpi font font-bh-lucidatypewriter-100dpi-1.0.3_4 X.Org Bigelow Holmes Lucida TypeWriter 100dpi font font-bh-lucidatypewriter-75dpi-1.0.3_4 X.Org Bigelow Holmes Lucida TypeWriter 75dpi font font-bh-ttf-1.0.3_4 X.Org Bigelow & Holmes TTF font font-bh-type1-1.0.3_4 X.Org Bigelow Holmes Type1 font font-bitstream-100dpi-1.0.3_4 X.Org Bitstream Vera 100dpi font font-bitstream-75dpi-1.0.3_4 X.Org Bitstream Vera 75dpi font font-bitstream-type1-1.0.3_4 X.Org Bitstream Vera Type1 font font-cronyx-cyrillic-1.0.3_4 X.Org Cronyx Cyrillic font font-cursor-misc-1.0.3_4 X.Org miscellaneous Cursor fonts font-daewoo-misc-1.0.3_4 X.Org miscellaneous Daewoo fonts font-dec-misc-1.0.3_4 X.Org miscellaneous Dec fonts font-ibm-type1-1.0.3_4 X.Org IBM Type1 font font-isas-misc-1.0.3_4 X.Org miscellaneous ISAS fonts font-jis-misc-1.0.3_4 X.Org miscellaneous JIS fonts font-micro-misc-1.0.3_4 X.Org miscellaneous Micro fonts font-misc-cyrillic-1.0.3_4 X.Org miscellaneous Cyrillic font font-misc-ethiopic-1.0.4 X.Org miscellaneous Ethiopic font font-misc-meltho-1.0.3_4 X.Org miscellaneous Meltho font font-misc-misc-1.1.2_4 X.Org miscellaneous Misc fonts font-mutt-misc-1.0.3_4 X.Org miscellaneous Mutt fonts font-schumacher-misc-1.1.2_4 X.Org miscellaneous Schumacher fonts font-screen-cyrillic-1.0.4_4 X.Org Screen Cyrillic font font-sony-misc-1.0.3_4 X.Org miscellaneous Sony fonts font-sun-misc-1.0.3_4 X.Org miscellaneous Sun fonts font-winitzki-cyrillic-1.0.3_4 X.Org Winitzki Cyrillic font font-xfree86-type1-1.0.4_4 X.Org XFree86 Type1 font fontconfig-2.13.92_2,1 XML-based font configuration API for X Windows freefont-ttf-20120503_2 Free UCS Outline Fonts freeglut-3.0.0_2 Open source implementation of GLUT library freeimage-3.18.0_1 Simple C/C++ bitmap graphics library freetds-1.2.5,1 Sybase/Microsoft TDS protocol library freetype2-2.10.2 Free and portable TrueType font rendering engine fribidi-0.19.7 Free Implementation of the Unicode Bidirectional Algorithm ftgl-2.4.0,1 OpenGL FreeType fonts rendering library fusefs-libs3-3.9.3 FUSE library version 3 for filesystems implemented in userspace fusefs-sshfs-3.7.0_1 Mount remote directories over ssh gawk-5.1.0 GNU version of AWK scripting language gcc-9_4 Meta-port for the default version of the GNU Compiler Collection gcc9-9.3.0_1 GNU Compiler Collection 9 gccmakedep-1.0.3 Create dependencies in makefiles using 'gcc -M' gconf2-3.2.6_5 Configuration database system for GNOME gcr-3.28.0 Library for bits of crypto UI and parsing gdbm-1.18.1_1 GNU database manager gdk-pixbuf2-2.40.0 Graphic library for GTK+ gdl-3.34.0 Components intended to be shared between GNOME development tools gegl-0.4.24_4 Graph based image processing framework geoclue-2.5.5 D-Bus service that provides location information getopt-1.1.6 Replacement for getopt(1) that supports GNU-style long options gettext-runtime-0.21 GNU gettext runtime libraries and programs gettext-tools-0.21 GNU gettext development and translation tools gexiv2-0.12.1 GObject-based wrapper around Exiv2 library ghc-8.8.3_1 Compiler for the functional language Haskell ghostscript9-agpl-base-9.52_8 PostScript and PDF interpreter ghostscript9-agpl-x11-9.52 PostScript and PDF interpreter, X11 support giblib-1.2.4_13 Utility library that includes a wrapper for imlib2 giflib-5.2.1 Tools and library routines for working with GIF images gimageview-0.2.27_24 Yet another GTK+ based image viewer gimp-2.10.20,2 The "meta-port" for The Gimp gimp-app-2.10.20_4,1 GNU Image Manipulation Program gimp-gutenprint-5.3.3 Gutenprint Printer Drivers girara-0.3.4_1 GTK3 Interface Library for Zathura PDF Viewer git-2.28.0 Distributed source code management tool gl2ps-1.4.0 C library providing vector output for OpenGL applications glew-2.2.0 OpenGL Extension Wrangler Library glib-2.66.3,1 Some useful routines of C programming (current stable version) glib-networking-2.56.1_2 Network-related giomodules for glib glibmm-2.64.2,1 C++ interfaces for glib2 gmake-4.3_2 GNU version of 'make' utility gmp-6.2.1 Free library for arbitrary precision arithmetic gmpc-11.8.16_5,1 Full featured GTK2 client for musicpd gnome_subr-1.0 Common startup and shutdown subroutines used by GNOME scripts gnupg-2.2.21 Complete and free PGP implementation gnuplot-5.4.0 Command-line driven graphing utility gnutls-3.6.14 GNU Transport Layer Security library go-1.15,1 Go programming language gobject-introspection-1.56.1_1,1 Generate interface introspection data for GObject libraries googletest-1.10.0_1 Framework for writing C++ tests on a variety of platforms gpgme-1.14.0 Library to make access to GnuPG easier gpu-firmware-kmod-g20200503 Firmware modules for the linuxkpi-based KMS components gradle-6.6.1 Project automation tool graphene-1.10.0 Optimizations for speeding up vector operations graphite2-1.3.14 Rendering capabilities for complex non-Roman writing systems graphviz-2.44.1_1 Graph Visualization Software from AT&T and Bell Labs groff-1.22.4_3 Software typesetting package grub2-bhyve-0.40_8 Grub-emu loader for bhyve gsed-4.8 GNU stream editor gsettings-desktop-schemas-3.28.1 Collection of globally shared GSetting schemas gsfonts-8.11_8 Standard Fonts for Ghostscript gsl-2.6 The GNU Scientific Library - mathematical libs gsm-1.0.13_2 Audio converter and library for converting u-law to gsm encoding gstreamer1-1.16.2 Media applications framework gstreamer1-libav-1.16.2 GStreamer plug-in with many audio/video decoders/encoders gstreamer1-plugins-1.16.2 GStreamer written collection of plugins handling several media types gstreamer1-plugins-a52dec-1.16.2 GStreamer ATSC A/52 stream aka AC-3 (dvd audio) plugin gstreamer1-plugins-bad-1.16.2 GStreamer-plugins that need more quality, testing or documentation gstreamer1-plugins-core-1.16 Core set of typical audio and video GStreamer plugins gstreamer1-plugins-dts-1.16.2 GStreamer dts audio decode plugin gstreamer1-plugins-dvdread-1.16.2_1 GStreamer DVD access plugin with libdvdread gstreamer1-plugins-gl-1.16.2 GStreamer GL graphics plugin gstreamer1-plugins-good-1.16.2 GStreamer-plugins good-quality plug-ins gstreamer1-plugins-mpg123-1.16.2 GStreamer MPEG Layer 1, 2, and 3 plugin gstreamer1-plugins-ogg-1.16.2 GStreamer Ogg bitstream plugin gstreamer1-plugins-pango-1.16.2 GStreamer pango textoverlay plugin gstreamer1-plugins-png-1.16.2 GStreamer png plugin gstreamer1-plugins-resindvd-1.16.2_1 GStreamer resindvd DVD playback plugin gstreamer1-plugins-theora-1.16.2 GStreamer theora plugin gstreamer1-plugins-ugly-1.16.2 GStreamer-plugins set of good-quality plug-ins that might have distribution problems gstreamer1-plugins-vorbis-1.16.2 GStreamer vorbis encoder/decoder plugin gtk-update-icon-cache-3.24.20 Gtk-update-icon-cache utility from the Gtk+ toolkit gtk2-2.24.32 Gimp Toolkit for X11 GUI (previous stable version) gtk3-3.24.20 Gimp Toolkit for X11 GUI (current stable version) gtkmm30-3.24.2 C++ wrapper for Gtk+3 gtkspell3-3.0.10 GTK+ 3 spell checking component gutenprint-5.3.3 Gutenprint Printer Drivers hal-0.5.14_34 Hardware Abstraction Layer for simplifying device access harfbuzz-2.7.1 OpenType text shaping engine harfbuzz-icu-2.7.1 Harfbuzz ICU support hdf-szip-2.1.1 Lossless compression library for scientific data hdf5-1.10.6,1 Hierarchical Data Format library (from NCSA) help2man-1.47.16 Automatically generating simple manual pages from program output hicolor-icon-theme-0.17 High-color icon theme shell from the FreeDesktop project hs-ShellCheck-0.7.1 Shell script analysis tool hs-pandoc-2.9.2_1 Conversion between markup formats html2ps-1.0.b7_5,1 HTML to PostScript converter htop-3.0.2 Better top(1) - interactive process viewer hunspell-1.7.0_2 Improved spell-checker for Hungarian and other languages hwloc-1.11.11 Portable Hardware Locality software package hydrogen-1.0.0_1 Advanced drum machine hyphen-2.8.8 Library for high quality hyphenation and justification iceauth-1.0.8_2 ICE authority file utility for X iconv-2.0_4 Charset conversion library and utilities icu-67.1,1 International Components for Unicode (from IBM) iichid-0.0.3 Generic FreeBSD HID layer for I2C and USB devices ilmbase-2.5.3 ILM Base libraries a.k.a. Half, IlmThread, Imath, and Iex imake-1.0.8,1 Imake and other utilities from X.Org imlib2-1.7.0,2 The next generation graphics library for Enlightenment imv-4.1.0_4 Simple image viewer indexinfo-0.3.1 Utility to regenerate the GNU info page index inkscape-1.0.1_4 Full featured open source SVG editor intellij-2020.2.3 IntelliJ IDEA Community Edition intellij-fsnotifier-20160221_6 Replacement for IntelliJ's fsnotifier intltool-0.51.0_1 Tools to internationalize various kinds of data files iso-codes-4.2 Lists of the country, language, and currency iso names iso8879-1986_3 Character entity sets from ISO 8879:1986 (SGML) jackit-0.125.0_11 Low latency audio server jade-1.2.1_10 Object-oriented SGML/XML parser toolkit and DSSSL engine jansson-2.13.1 C library for encoding, decoding, and manipulating JSON data jasper-2.0.16_1 Implementation of the codec specified in the JPEG-2000 standard java-zoneinfo-2020.a Updated Java timezone definitions javavmwrapper-2.7.6 Wrapper script for various Java Virtual Machines jbig2dec-0.18 Decoder implementation of the JBIG2 image compression format jbigkit-2.1_1 Lossless compression for bi-level images such as scanned pages, faxes jlint-3.1.2_5 Java program analyzer and checker jpeg-turbo-2.0.6 SIMD-accelerated JPEG codec which replaces libjpeg jpegoptim-1.4.6 Utility to optimize jpeg files json-c-0.15 JSON (JavaScript Object Notation) implementation in C json-glib-1.4.4 JSON (RFC 4627) interface for Glib jsoncpp-1.9.4 JSON reader and writer library for C++ kicad-5.1.7,2 Schematic and PCB editing software kvazaar-2.0.0 H.265/HEVC encoder implemented in C ladspa-1.15 Linux Audio Developer's Simple Plugin API lame-3.100_2 Fast MP3 encoder kit lcms-1.19_6,1 Light Color Management System -- a color management library lcms2-2.11_1 Accurate, fast, and small-footprint color management engine leptonica-1.76.0_1 C library for efficient image processing and image analysis operations libFS-1.0.8 The FS library libGLU-9.0.1 OpenGL utility library libICE-1.0.10,1 Inter Client Exchange library for X11 libIDL-0.8.14_4 Library for creating trees of CORBA IDL files libSM-1.2.3,1 Session Management library for X11 libX11-1.6.12,1 X11 library libXScrnSaver-1.2.3_2 The XScrnSaver library libXau-1.0.9 Authentication Protocol library for X11 libXaw-1.0.13_3,2 X Athena Widgets library libXcomposite-0.4.5,1 X Composite extension library libXcursor-1.2.0 X client-side cursor loading library libXdamage-1.1.5 X Damage extension library libXdmcp-1.1.3 X Display Manager Control Protocol library libXext-1.3.4,1 X11 Extension library libXfixes-5.0.3_2 X Fixes extension library libXfont-1.5.4_2,2 X font library libXfont2-2.0.4 X font library libXft-2.3.3 Client-sided font API for X applications libXi-1.7.10,1 X Input extension library libXinerama-1.1.4_2,1 X11 Xinerama library libXmu-1.1.3,1 X Miscellaneous Utilities libraries libXpm-3.5.13 X Pixmap library libXrandr-1.5.2 X Resize and Rotate extension library libXrender-0.9.10_2 X Render extension library libXres-1.2.0_2 X Resource usage library libXt-1.2.0,1 X Toolkit library libXtst-1.2.3_2 X Test extension libXv-1.0.11_2,1 X Video Extension library libXvMC-1.0.12 X Video Extension Motion Compensation library libXxf86dga-1.1.5 X DGA Extension libXxf86vm-1.1.4_3 X Vidmode Extension liba52-0.7.4_3 Free library for decoding ATSC A/52 streams, aka AC-3 libabw-0.1.3 Library providing ability to interpret Abiword documents libao-1.2.0_5 Portable audio output library libarchive-3.4.3,1 Library to create and read several streaming archive formats libass-0.14.0 Portable ASS/SSA subtitle renderer libassuan-2.5.3 IPC library used by GnuPG and gpgme libatomic_ops-7.6.10 Atomic operations access library libb64-1.2.1 Library for fast Base64 encoding and decoding libcddb-1.3.2_4 Library to access data on a CDDB server libcdr01-0.1.6 Library and tools for parsing Corel Draw file format libcmis-0.5.2_1 Client library for the CMIS interface libconfig-1.7.2_1 Simple library for manipulating structured configuration files libcroco-0.6.13 CSS2 parsing library libdaemon-0.14_1 Lightweight C library that eases the writing of UNIX daemons libdbusmenu-qt5-0.9.3.160420160218_10 Qt5 implementation of the DBusMenu protocol libdca-0.0.6_1 Free DTS Coherent Acoustics decoder libde265-1.0.2_5 Open source h.265 video codec libdmx-1.1.4_2 DMX extension library libdrm-2.4.102,1 Userspace interface to kernel Direct Rendering Module services libdvbpsi-1.3.3 Library for MPEG TS and DVB PSI tables decoding and generation libdvdcss-1.4.2 Portable abstraction library for DVD decryption libdvdnav-6.1.0 Videolan version of the libdvdnav project libdvdread-6.1.0 Videolan version of the libdvdread project libe-book-0.1.3_18 Library for import of reflowable e-book formats libebml-1.4.0 EBML (Extensible Binary Meta Language), sort of binary version of XML libedit-3.1.20191231,1 Command line editor library libepoll-shim-0.0.20200602 Small epoll implementation using kqueue libepoxy-1.5.4 Library to handle OpenGL function pointer management libepubgen-0.1.0_9 Library for generating documents in ePub format liberation-fonts-ttf-2.1.1,2 Liberation fonts from Red Hat to replace MS TTF fonts libetonyek01-0.1.9_6,1 Library to interpret and import Apple Keynote presentations libevdev-1.5.9_1 Linux Event Device library libevent-2.1.12 API for executing callback functions on events or timeouts libexif-0.6.21_5 Library to read digital camera file meta-data libexttextcat-3.4.5 Language guessing by N-Gram-Based Text Categorization libffi-3.3_1 Foreign Function Interface libffi321-3.2.1_2 Foreign Function Interface (stripped down compat version) libfontenc-1.1.4 The fontenc Library libfreehand-0.1.2_18 Library for interpreting and importing Adobe/Macromedia drawings libgcrypt-1.8.5 General purpose cryptographic library based on the code from GnuPG libgd-2.3.0,1 Graphics library for fast creation of images libgit2-1.0.1 Portable, pure C implementation of the Git core libglade2-2.6.4_10 GNOME glade library libgltf-0.0.2_21 C++ Library for rendering OpenGL models stored in glTF format libgpg-error-1.38 Common error values for all GnuPG components libgsf-1.14.47_1 Extensible I/O abstraction for dealing with structured file formats libgudev-233 GObject bindings for libudev libheif-1.6.2 Libheif is an ISO/IEC 23008-12:2017 HEIF file format de- and encoder libiconv-1.16 Character set conversion library libid3tag-0.15.1b_2 ID3 tags library (part of MAD project) libidn-1.35 Internationalized Domain Names command line tool libidn2-2.3.0_1 Implementation of IDNA2008 internationalized domain names libinotify-20180201_2 Kevent based inotify compatible library libinput-1.15.6 Generic input library libjpeg-turbo-2.0.4 SIMD-accelerated JPEG codec library, provides libTurboJPEG libksba-1.4.0 Library to make X.509 certificates liblangtag-0.6.2 Interface library to access tags for identifying languages liblo-0.31_1 Lightweight Open Sound Control implementation liblqr-1-0.4.2 Easy to use C/C++ seam carving library liblrdf-0.6.1 Library for manipulating RDF files describing LADSPA plugins libltdl-2.4.6 System independent dlopen wrapper liblz4-1.9.2_1,1 LZ4 compression library, lossless and very fast libmad-0.15.1b_7 Libmad library (part of MAD project) libmatroska-1.6.0 Extensible Multimedia Container Format libmetalink-0.1.3 Metalink library written in C language libmng-1.0.10_3 Multiple-image Network Graphics (MNG) reference library libmpd-11.8.17_2 Abstraction around libmpdclient libmpdclient-2.18 API library for interfacing MPD libmspack-0.10.1 Library for Microsoft compression formats libmspub01-0.1.4_16 Library and tools for parsing Microsoft Publisher file format libmtdev-1.1.5_2 Multitouch Protocol Translation Library libmwaw03-0.3.15 Import library for some old mac text documents libmypaint-1.5.1_1 Brush library from the MyPaint project libmysofa-1.1 SOFA (Spatially Oriented Format for Acoustics) file reader libnatpmp-20150609 NAT-PMP lightweight library libnghttp2-1.41.0 HTTP/2.0 C Library libnotify-0.7.8 Library for desktop notifications libnsgif-0.2.1 NetSurf GIF Decoder libnumbertext-1.0.5_1 Number to number name and money text conversion libraries libodfgen01-0.1.7_3 Library for generating documents in Open Document Format (ODF) libogg-1.3.4,4 Ogg bitstream library libopusenc-0.2.1 High-level API for encoding .opus files liborcus-0.15.4 Standalone file import filter library for spreadsheet documents libpagemaker-0.0.4_10 Library and tools for parsing Aldus/Adobe PageMaker documents libpaper-1.1.24.4 Library providing routines for paper size management libpci-3.7.0 PCI configuration space I/O made easy libpciaccess-0.16 Generic PCI access library libplacebo-2.72.0 Reusable library for GPU-accelerated video/image rendering libpotrace-1.16 Library for transforming bitmaps into vector graphics libproxy-0.4.15 Library that provides automatic proxy configuration management libpthread-stubs-0.4 Weak aliases for pthread functions libqrencode-4.0.2 C library for encoding data in a QR Code symbol libqxp-0.0.0_16 Library for parsing QuarkXPress documents libraqm-0.6.0 Library that encapsulates complex text layout logic libraw-0.19.5 Library for manipulating raw images libreoffice-6.4.6 Full integrated office productivity suite librevenge-0.0.4_13 Base library for writing document import filters librsvg2-2.40.21 Library for parsing and rendering SVG vector-graphic files librtmp-2.4.20190330 RTMP stream library libsamplerate-0.1.9 Secret Rabbit Code: a Sample Rate Converter for audio libsecret-0.18.6_1 Library to access the secret service API libsexy-0.1.11_10 Extension widgets for GTK+ libsigc++-2.10.4 Callback Framework for C++ libsigsegv-2.12 Handling page faults in user mode libslang2-2.3.2_2 Routines for rapid alpha-numeric terminal applications development libsndfile-1.0.29.p.20200620 Reading and writing files containing sampled sound (like WAV or AIFF) libsodium-1.0.18 Library to build higher-level cryptographic tools libsoup-2.62.3 SOAP (Simple Object Access Protocol) implementation in C libsoxr-0.1.3_2 High quality, one-dimensional sample-rate conversion library libspectre-0.2.9 Small library for rendering Postscript documents libspiro-20190731,1 Library to convert clothoid splines into Bezier splines libssh-0.9.4 Library implementing the SSH2 protocol libssh2-1.9.0_3,3 Library implementing the SSH2 protocol libstaroffice-0.0.7 Library to build a filter for old StarOffice's documents libsynaptics-0.14.6.c Library to access the Xorg/XFree86 Synaptics TouchPad Driver libsysctlmibinfo2-2.0.0_2 API to get sysctl MIB info version 2 libsysinfo-0.0.3_2 GNU libc's sysinfo port for FreeBSD libtasn1-4.16.0 ASN.1 structure parser library libtextstyle-0.21 Text styling library libtheora-1.1.1_7 Theora video codec for the Ogg multimedia streaming system libtool-2.4.6_1 Generic shared library support script libudev-devd-0.4.2 libudev-compatible interface for devd libunistring-0.9.10_1 Unicode string library libunwind-20200331_1 Generic stack unwinding library libusrsctp-0.9.3.0.856 Portable SCTP userland stack libuv-1.40.0 Multi-platform support library with a focus on asynchronous I/O libv4l-1.18.0 Video4Linux library libva-2.9.0 VAAPI wrapper and dummy driver libvdpau-1.4 VDPAU wrapper and tracing library libvisio01-0.1.7_2 Library and tools for parsing the visio file format structure libvolume_id-0.81.1 Library to provide file system type information libvorbis-1.3.7_2,3 Audio compression codec library libvpx-1.9.0 VP8/VP9 reference encoder/decoder libwacom-1.4.1 Adds tablet support to libinput libwmf-0.2.8.4_15 Tools and library for converting Microsoft WMF (windows metafile) libwpd010-0.10.3_4 Tools for importing and exporting WordPerfect(tm) documents libwpg03-0.3.3_1 Library and tools to work with WordPerfect Graphics (WPG) files libwps-0.4.11 Microsoft file word processor format import filter library libx264-0.160.3011 H.264/MPEG-4 AVC Video Encoding (Library) libxcb-1.13.1 The X protocol C-language Binding (XCB) library libxkbcommon-0.10.0_2 Keymap handling library for toolkits and window systems libxkbfile-1.1.0 XKB file library libxml++-2.40.1,1 XML API for C++ libxml2-2.9.10_1 XML parser library for GNOME libxshmfence-1.3 Shared memory 'SyncFence' synchronization primitive libxslt-1.1.34_1 The XSLT C library for GNOME libxspf-1.2.0_2 XSPF parsing library libyaml-0.2.5 YAML 1.1 parser and emitter written in C libzmf-0.0.2_21 Library that parses the file format of Zoner Callisto/Draw documents libzmq4-4.3.1_1 ZeroMQ core library (Version 4) linux_base-c7-7.8.2003_1 Base set of packages needed in Linux mode (Linux CentOS 7.8.2003) linuxlibertine-g-20120116_2 Linux Libertine G and Linux Biolinum G fonts liveMedia-2020.06.25,2 LIVE.COM Streaming Media llvm-90 Meta-port for the default version of the LLVM Toolchain llvm10-10.0.1_3 LLVM and Clang llvm80-8.0.1_4 LLVM and Clang llvm90-9.0.1_1 LLVM and Clang logisim-2.7.1 Educational tool for designing and simulating logic circuits lp_solve-5.5.2.5 Linear Programming Solver lsof-4.93.2_12,8 Lists information about open files (similar to fstat(1)) lua51-5.1.5_9 Small, compilable scripting language providing easy access to C code lua52-5.2.4 Small, compilable scripting language providing easy access to C code lua53-5.3.6 Powerful, efficient, lightweight, embeddable scripting language lynx-2.8.9.1_1,1 Non-graphical, text-based World-Wide Web client lzo2-2.10_1 Portable speedy, lossless data compression library m4-1.4.18_1,1 GNU M4 makedepend-1.0.6,1 Dependency generator for makefiles mesa-demos-8.4.0_2 OpenGL demos distributed with Mesa mesa-dri-20.2.0_1 OpenGL hardware acceleration drivers for DRI2+ mesa-libs-20.2.0_1 OpenGL libraries that support GLX and EGL clients meson-0.56.0 High performance build system metis-5.1.0_8 Package for unstructured graph partitioning microsoft-gsl-3.0.1 Guidelines Support Library mime-support-3.62 MIME Media Types list miniupnpc-2.1_2 UPnP IGD client lightweight library minizip-1.2.11 Zip library and programs from Zlib distribution mixertui-1.4_1 Audio Mixer with a Terminal User Interface mkfontscale-1.2.1 Creates an index of scalable font files for X mous-2.0.1_4 Simple yet powerful audio player mp4v2-2.0.0 Library and tools to read, create, and modify mp4 files mpc-1.1.0_2 Library of complex numbers with arbitrarily high precision mpfr-4.1.0 Library for multiple-precision floating-point computations mpg123-1.26.3 Command-line player for MPEG Layer 1, 2, and 3 audio files mpv-0.32.0_5,1 Free and open-source general-purpose video player munge-0.5.14_1 Authentication service for creating and validating credentials mupdf-1.17.0,1 Lightweight PDF viewer and toolkit musicpc-0.33_1 Command line client for the musicpd musicpd-0.21.25 Remote-controllable music daemon mutt-2.0.3 Small but powerful text based program for read/writing e-mail mypaint-brushes-1.3.1 Brushes used by MyPaint and other software using libmypaint mysql57-client-5.7.31 Multithreaded SQL database (client) mythes-1.2.4_7 Simple thesaurus library nasm-2.15.05,1 General-purpose multi-platform x86 and amd64 assembler ncurses-6.2.20201128 Library for terminal-independent, full-screen output neofetch-7.1.0 Fast, highly customizable system info script netpbm-10.91.01 Toolkit for conversion of images between different formats nettle-3.6 Low-level cryptographic library ngspice_rework-shlib-32 Mixed-signal circuit simulator derived from Spice and Cider ninja-1.10.1,2 Small build system closest in spirit to Make nmap-7.80 Port scanning utility for large networks norm-1.5r6_1 NACK-Oriented Reliable Multicast (NORM) noto-basic-2.0 Google Noto Fonts family (Basic and Emoji) npth-1.6 New GNU Portable Threads nspr-4.29 Platform-neutral API for system level and libc like functions nss-3.59 Libraries to support development of security-enabled applications openal-soft-1.20.1_2 Software implementation of the OpenAL specification openblas-0.3.12,1 Optimized BLAS library based on GotoBLAS2 opencascade-7.4.0_7 Open CASCADE Technology, 3D modeling & numerical simulation opencl-2.2_2 Open Computing Language (OpenCL) specifications V2.2 (header files) opencv-core-3.4.1_35 Open Source Computer Vision library openexr-2.5.3 High dynamic-range (HDR) image file format openh264-2.1.1,2 Cisco implementation of H.264 codec openjdk11-11.0.8+10.1 Java Development Kit 11 openjdk12-12.0.2+10.4_1 Java Development Kit 12 openjdk14-14.0.2+12.1 Java Development Kit 14 openjdk8-8.265.01.1 Java Development Kit 8 openjpeg-2.3.1 Open-source JPEG 2000 codec openjpeg15-1.5.2_1 Open-source JPEG 2000 codec openldap-client-2.4.51 Open source LDAP client implementation openmpi-4.0.5 High Performance Message Passing Library openpgm-5.2.122_6 Implementation of the PGM reliable multicast protocol opus-1.3.1 IETF audio codec opus-tools-0.2 Encode, inspect, and decode Opus files opusfile-0.12 Opus playback library orc-0.4.31 Library and toolset to operate arrays of data oss-4.2.b2019_2 Open Sound System from 4Front Technologies p11-kit-0.23.21 Library for loading and enumerating of PKCS#11 modules p5-Algorithm-Diff-1.1903 Perl interface to compute differences between two objects p5-Authen-NTLM-1.09_1 Perl5 NTLM authentication module p5-Authen-SASL-2.16_1 Perl5 module for SASL authentication p5-Cairo-1.107 Perl bindings to the cairo graphics library p5-Carp-Clan-6.08 Report errors from perspective of caller of a "clan" of modules p5-Check-ISA-0.09 DWIM, correct checking of an object's class p5-Class-ISA-0.36_1 Report the search path for a class's ISA tree p5-Clone-0.45 Recursively copy Perl datatypes p5-Compress-Bzip2-2.24 Perl5 interface to bzip2 compression library p5-ConfigReader-Simple-1.293 Simple configuration file parser p5-Cpanel-JSON-XS-4.23 JSON::XS for Cpanel, fast and correct serialising p5-Data-Compare-1.2200_1 Compare Perl data structures p5-Data-OptList-0.110 Parse and validate simple name/value option pairs p5-Data-TreeDumper-0.40_2 Dumps a data structure in a tree fashion p5-Data-TreeDumper-Renderer-GTK-0.02_6 GTK renderer for Data::TreeDumper p5-Devel-Size-0.83 Perl extension for finding the memory usage of Perl variables p5-Digest-HMAC-1.03_1 Perl5 interface to HMAC Message-Digest Algorithms p5-Directory-Scratch-0.18 Easy-to-use self-cleaning scratch space p5-Directory-Scratch-Structured-0.04_1 Creates temporary files and directories from a structured description p5-EV-4.33,1 Perl interface to libev, a high performance full-featured event loop p5-Encode-Locale-1.05 Determine the locale encoding p5-Error-0.17029 Error/exception handling in object-oriented programming style p5-Eval-Context-0.09.11_3 Evaluate Perl code in context wrapper p5-Exporter-Tiny-1.002002 Exporter with features of Sub::Exporter but only core dependencies p5-ExtUtils-Depends-0.8000 Easily build XS extensions that depend on XS extensions p5-ExtUtils-PkgConfig-1.16 Simplistic interface to pkg-config p5-File-Find-Rule-0.34 Alternative interface to File::Find p5-File-HomeDir-1.006 Get home directory for self or other users p5-File-Listing-6.04_1 Parse directory listings p5-File-Slurp-9999.27 Perl5 module for single call read & write file routines p5-File-Which-1.23 Portable implementation of which(1) in Perl p5-GSSAPI-0.28_1 Perl extension providing access to the GSSAPIv2 library p5-Glib-1.3293 Interface to Glib and GObject libraries p5-Graph-Easy-0.76 Render graphs as ASCII, HTML, SVG, or Graphviz p5-Gtk2-1.24993_1 Perl module for Gtk+ 2.x graphical user interface library p5-HTML-Lint-2.32 Check for HTML errors in string or file with Perl p5-HTML-Parser-3.72 Perl5 module for parsing HTML documents p5-HTML-SimpleLinkExtor-1.272 Simple HTML link extractor p5-HTML-Tagset-3.20_1 Some useful data table in parsing HTML p5-HTTP-Cookies-6.08 HTTP Cookie jars p5-HTTP-Daemon-6.12 Simple HTTP server class p5-HTTP-Date-6.05 Conversion routines for the HTTP protocol date formats p5-HTTP-Message-6.25 Representation of HTTP style messages p5-HTTP-Negotiate-6.01_1 Implementation of the HTTP content negotiation algorithm p5-HTTP-SimpleLinkChecker-1.167 Check the HTTP response code for a link p5-HTTP-Size-1.151 Get the byte size of an internet resource p5-Hash-Slice-0.03 Make a hash from a deep slice of another hash p5-IO-HTML-1.001_1 Open an HTML file with automatic charset detection p5-IO-Socket-INET6-2.72_1 Perl module with object interface to AF_INET6 domain sockets p5-IO-Socket-SSL-2.068 Perl5 interface to SSL sockets p5-LWP-MediaTypes-6.04 Guess media type for a file or a URL p5-LWP-Protocol-https-6.09 Provide https support for LWP::UserAgent p5-List-MoreUtils-0.428 Provide the stuff missing in List::Util p5-List-MoreUtils-XS-0.430 Provide compiled List::MoreUtils functions p5-Locale-gettext-1.07 Message handling functions p5-Locale-libintl-1.32 Internationalization library for Perl p5-Mail-Sendmail-0.80 Perl module implementing a simple, platform-independent mailer p5-Module-Build-0.4231 Build and install Perl modules p5-Module-Util-1.09_2 Perl module name tools and transformations p5-Mojolicious-8.58 High-level MVC web framework written in Perl p5-Mozilla-CA-20200520 Perl extension for Mozilla CA cert bundle in PEM format p5-Net-HTTP-6.19 Low-level HTTP client p5-Net-SSLeay-1.88 Perl5 interface to SSL p5-Number-Compare-0.03_1 Numeric comparisons p5-Package-Generator-1.106_1 Quickly and easily construct new packages p5-Pango-1.227_1 Perl module for layout and render i18n text p5-Params-Util-1.07_2 Utility functions to aid in parameter checking p5-Path-Class-0.37 Cross-platform path specification manipulation p5-Path-Tiny-0.114 File path utility p5-Readonly-2.05 Facility for creating read-only scalars, arrays, hashes p5-SGMLSpm-1.03_2 Perl module for postprocessing the output from sgmls and nsgmls p5-Socket6-0.29 IPv6 related part of the C socket.h defines and structure manipulators p5-Sort-Naturally-1.03_1 Sort lexically, but sort numeral parts numerically p5-String-Random-0.31,1 Perl interface to generate "random" strings p5-Sub-Exporter-0.987_1 Sophisticated exporter for custom-built routines p5-Sub-Install-0.928_1 Install subroutines into packages easily p5-Term-Size-0.207_1 Perl5 module to handle window size changes p5-Text-Diff-1.45 Perl module to perform diffs on files and record sets p5-Text-Glob-0.11 Match globbing patterns against text p5-Text-Tabs+Wrap-2013.0523_1 Line wrapping to form simple paragraphs p5-Text-Template-1.59 Expand template text with embedded Perl p5-Text-Unidecode-1.30 US-ASCII transliterations of Unicode text p5-TimeDate-2.33,1 Perl5 module containing a better/faster date parser for absolute dates p5-Try-Tiny-0.30 Minimal try/catch with proper localization of $@ p5-URI-1.76 Perl5 interface to Uniform Resource Identifier (URI) references p5-Unicode-EastAsianWidth-12.0 East Asian Width properties p5-WWW-RobotRules-6.02_1 Database of robots.txt-derived permissions p5-XML-Parser-2.44 Perl extension interface to James Clark's XML parser, expat p5-YAML-Tiny-1.73 Read/Write YAML files with as little code as possible p5-common-sense-3.75 Perl common defaults with lower memory usage p5-libwww-6.47 Perl5 library for WWW access pango-1.42.4_4 Open-source framework for the layout and rendering of i18n text pangomm-2.40.1_4 C++ wrapper for Pango par_format-1.52_1 Paragraph reformatter for email parallel-20200822 Shell tool for executing jobs in parallel password-store-1.7.3_2 Stores, retrieves, generates, and synchronizes passwords securely pciids-20200721 Database of all known IDs used in PCI devices pcre-8.44 Perl Compatible Regular Expressions library pcre2-10.35 Perl Compatible Regular Expressions library, version 2 pdf2svg-0.2.3_24 Convert PDF to SVG perl5-5.32.0 Practical Extraction and Report Language perl5.30-5.30.3 Practical Extraction and Report Language pinentry-1.1.0_6 Collection of simple PIN or passphrase entry dialogs pinentry-curses-1.1.0 Curses version of the GnuPG password dialog pixman-0.40.0 Low-level pixel manipulation library pkg-1.15.10 Package manager pkgconf-1.7.3,1 Utility to help to configure compiler and linker flags pktstat-1.8.5_1 Network traffic viewer pmd-6.29.0 Static analysis tool for Java source code png-1.6.37 Library for manipulating PNG images pngcrush-1.8.13 Optimizer for PNG files pnglite-0.1.17_1 Lightweight PNG C library policykit-0.9_10 Framework for controlling access to system-wide components polkit-0.116 Framework for controlling access to system-wide components poppler-0.89.0_1 PDF rendering library poppler-data-0.4.9_5 Poppler encoding data poppler-glib-0.89.0_1 GLib bindings to poppler poppler-utils-20.08.0_1 Poppler's xpdf-workalike command line utilities popt-1.18_1 Getopt(3) like library with a number of enhancements, from Redhat portaudio-19.6.0_4,1 Portable cross-platform Audio API portdowngrade-1.7 Sets a port back to a previous version portmaster-3.19_25 Manage your ports without external databases or languages postgresql12-client-12.4 PostgreSQL database (client) potrace-1.16 Transforms bitmaps into vector graphics pprof-g20200905 Tool for visualization and analysis of profiling data protobuf-3.12.4,1 Data interchange format library pslib-0.4.6 C-library for generating multi page PostScript documents psutils-1.17_5 Utilities for manipulating PostScript documents pulseaudio-13.0_1 Sound server for UNIX pwcview-1.4.1_7 The Video4Linux PWC webcam viewer pwgen-2.08,2 Small, powerful, GPL'ed password generator py27-cairo-1.18.1_1 Python 2 bindings for Cairo py27-gimp-2.10.20_4 GNU Image Manipulation Program py27-gobject-2.28.6_9 Python bindings for GObject py27-gtk2-2.24.0_5 Set of Python bindings for GTK+ py27-pycparser-2.20 C parser in Python py27-setuptools-44.0.0 Python packages installer py37-Babel-2.8.0 Collection of tools for internationalizing Python applications py37-CommonMark-0.9.1 Python parser for the CommonMark Markdown spec py37-Jinja2-2.11.2 Fast and easy to use stand-alone template engine py37-MarkupSafe-1.1.1 Implements XML/HTML/XHTML Markup safe string for Python py37-alabaster-0.7.6 Modified Kr Sphinx theme py37-asn1crypto-1.4.0 ASN.1 library with a focus on performance and a pythonic API py37-autopep8-1.4.4 Automatically formats Python code to conform to the PEP 8 style guide py37-beaker-1.11.0 Session and Caching library with WSGI Middleware py37-cairo-1.18.1_1 Python 2 bindings for Cairo py37-certifi-2020.11.8 Mozilla SSL certificates py37-cffi-1.14.3 Foreign Function Interface for Python calling C code py37-chardet-3.0.4_3 Universal encoding detector for Python 2 and 3 py37-cryptography-2.6.1 Cryptographic recipes and primitives for Python developers py37-cython-0.29.21 Compiler for Writing C Extensions for the Python Language py37-docutils-0.15.2 Python Documentation Utilities py37-dot2tex-2.11.3 Graphviz to LaTeX converter py37-evdev-0.8.1_1 Bindings to the Linux input handling subsystem py37-future-0.18.2 Clean single-source support for Python 3 and 2 py37-gmpy-1.17_1 Python Extension that Wraps the GMP Library py37-gobject3-3.28.3_2 Python 3.7 bindings for GObject py37-idna-2.10 Internationalized Domain Names in Applications (IDNA) py37-imagesize-1.1.0 Python image size library py37-libxml2-2.9.10_1 Python interface for XML parser library for GNOME py37-lxml-4.6.2 Pythonic binding for the libxml2 and libxslt libraries py37-lz4-2.1.10 Python binding for the LZ4 compression library py37-mako-1.0.14 Super-fast templating language in Python py37-mpmath-1.1.0 Python Library for Arbitrary-precision Floating-point Arithmetic py37-mypy-0.790 Optional static typing for Python py37-mypy_extensions-0.4.3 Experimental type system extensions for programs py37-numpy-1.16.6,1 The New Numeric Extension to Python py37-olefile-0.46 Python module to read MS OLE2 files py37-openssl-19.0.0 Python interface to the OpenSSL library py37-packaging-20.4 Core utilities for Python packages py37-pillow-7.0.0 Fork of the Python Imaging Library (PIL) py37-pip-19.1.1 Tool for installing and managing Python packages py37-pkgconfig-1.5.1,1 Interface Python with pkg-config py37-psutil-5.7.3 Process utilities module for Python py37-pycodestyle-2.6.0 Python style guide checker py37-pycparser-2.20 C parser in Python py37-pyflakes-2.2.0 Passive checker of Python programs py37-pyglet-1.5.11 Cross-platform windowing and multimedia library py37-pygments-2.7.1 Syntax highlighter written in Python py37-pyparsing-2.4.7 General parsing module for Python py37-pysocks-1.7.1 Python SOCKS module py37-pystemmer-2.0.0.1 Snowball Stemming Algorithms for Information Retrieval py37-pytz-2020.1,1 World Timezone Definitions for Python py37-pyudev-0.22.0 Pure Python libudev binding py37-recommonmark-0.5.0_2 CommonMark bridge for docutils and Sphinx py37-requests-2.22.0_2 HTTP library written in Python for human beings py37-scour-0.38.1 Scour SVG Optimizer py37-setuptools-44.0.0 Python packages installer py37-setuptools_scm-4.1.2_1 Setuptools plugin to manage your versions by scm tags py37-six-1.15.0 Python 2 and 3 compatibility utilities py37-snowballstemmer-1.2.1 Snowball stemming library collection for Python py37-sphinx-3.3.1,1 Python documentation generator py37-sphinxcontrib-applehelp-1.0.2 Extension which outputs Apple help books py37-sphinxcontrib-devhelp-1.0.2 Sphinx extension which outputs Devhelp document py37-sphinxcontrib-htmlhelp-1.0.3 Sphinx extension which renders HTML help files py37-sphinxcontrib-jsmath-1.0.1 Sphinx extension which renders display math in HTML via JavaScript py37-sphinxcontrib-qthelp-1.0.3 Sphinx extension which outputs QtHelp document py37-sphinxcontrib-serializinghtml-1.1.4 Sphinx extension which outputs serialized HTML files (json and pickle) py37-sqlite3-3.7.9_7 Standard Python binding to the SQLite3 library (Python 3.7) py37-sympy-1.6 Python Library For Symbolic Mathematics py37-tkinter-3.7.9_6 Python bindings to the Tk widget set (Python 3.7) py37-toml-0.10.1 Python library for parsing and creating TOML py37-typed-ast-1.4.1 Fork of Python ast modules with type comment support py37-typing-extensions-3.7.4.3 Backported and Experimental Type Hints for Python 3.5+ py37-urllib3-1.25.11,1 HTTP library with thread-safe connection pooling, file post, and more py37-wxPython40-4.0.7_1 GUI toolkit for the Python programming language pygobject3-common-3.28.3_2 Common files for the Python bindings for GObject pypy-7.3.0_1 Fast, compliant implementation of the Python language pypy3-7.3.0_1 Fast, compliant implementation of the Python language python27-2.7.18_1 Interpreted object-oriented programming language python37-3.7.9_1 Interpreted object-oriented programming language python38-3.8.6_1 Interpreted object-oriented programming language qpdf-10.0.1 Command-line tools for transforming and inspecting PDF documents qr-code-generator-1.6.0 High-quality QR Code generator library qt5-5.15.0 Cross-platform application and UI framework (metaport) qt5-3d-5.15.0 Qt3D module qt5-assistant-5.15.0 Qt 5 documentation browser qt5-buildtools-5.15.0 Qt build tools qt5-charts-5.15.0 Qt 5 charts module qt5-concurrent-5.15.0 Qt multi-threading module qt5-connectivity-5.15.0 Qt connectivity (Bluetooth/NFC) module qt5-core-5.15.0_2 Qt core non-graphical module qt5-datavis3d-5.15.0 Qt 5 3D data visualization module qt5-dbus-5.15.0 Qt D-Bus inter-process communication module qt5-declarative-5.15.0_1 Qt declarative framework for dynamic user interfaces qt5-designer-5.15.0 Qt 5 graphical user interface designer qt5-doc-5.12.2 Qt 5 documentation qt5-examples-5.15.0 Qt 5 examples sourcecode qt5-gamepad-5.15.0_1 Qt 5 Gamepad Module qt5-graphicaleffects-5.15.0 Qt Quick graphical effects qt5-gui-5.15.0_1 Qt graphical user interface module qt5-help-5.15.0 Qt online help integration module qt5-imageformats-5.15.0 Qt plugins for additional image formats qt5-l10n-5.15.0 Qt localized messages qt5-linguist-5.15.0 Qt 5 translation tool qt5-linguisttools-5.15.0 Qt localization tools qt5-location-5.15.0 Qt location module qt5-multimedia-5.15.0 Qt audio, video, radio and camera support module qt5-network-5.15.0 Qt network module qt5-networkauth-5.15.0 Qt network auth module qt5-opengl-5.15.0 Qt 5-compatible OpenGL support module qt5-pixeltool-5.15.0 Qt 5 screen magnifier qt5-printsupport-5.15.0 Qt print support module qt5-qdbus-5.15.0 Qt command-line interface to D-Bus qt5-qdbusviewer-5.15.0 Qt 5 graphical interface to D-Bus qt5-qdoc-5.15.0 Qt documentation generator qt5-qdoc-data-5.15.0 QDoc configuration files qt5-qev-5.15.0 Qt QWidget events introspection tool qt5-qmake-5.15.0 Qt Makefile generator qt5-qtdiag-5.15.0 Tool for reporting diagnostic information about Qt and its environment qt5-qtpaths-5.15.0 Command line client to QStandardPaths qt5-qtplugininfo-5.15.0 Qt5 plugin metadata dumper qt5-quick3d-5.15.0 Set of controls for building complete interfaces in Qt Quick3D qt5-quickcontrols-5.15.0 Set of controls for building complete interfaces in Qt Quick qt5-quickcontrols2-5.15.0 Set of controls for building complete interfaces in Qt Quick qt5-quicktimeline-5.15.0 Set of controls for building complete interfaces in Qt Quick Timeline qt5-remoteobjects-5.15.0 Qt5 SXCML module qt5-script-5.15.0 Qt 4-compatible scripting module qt5-scripttools-5.15.0 Qt Script additional components qt5-scxml-5.15.0 Qt5 SXCML module qt5-sensors-5.15.0 Qt sensors module qt5-serialbus-5.15.0 Qt functions to access industrial bus systems qt5-serialport-5.15.0 Qt functions to access serial ports qt5-speech-5.15.0 Accessibilty features for Qt5 qt5-sql-5.15.0 Qt SQL database integration module qt5-sqldrivers-ibase-5.15.0 Qt InterBase/Firebird database plugin qt5-sqldrivers-mysql-5.15.0 Qt MySQL database plugin qt5-sqldrivers-odbc-5.15.0 Qt Open Database Connectivity plugin qt5-sqldrivers-pgsql-5.15.0 Qt PostgreSQL database plugin qt5-sqldrivers-sqlite2-5.15.0 Qt SQLite 2 database plugin qt5-sqldrivers-sqlite3-5.15.0 Qt SQLite 3 database plugin qt5-sqldrivers-tds-5.15.0 Qt TDS Database Connectivity database plugin qt5-svg-5.15.0 Qt SVG support module qt5-testlib-5.15.0 Qt unit testing module qt5-uiplugin-5.15.0 Custom Qt widget plugin interface for Qt Designer qt5-uitools-5.15.0 Qt Designer UI forms support module qt5-virtualkeyboard-5.15.0 Qt 5 Virtual Keyboard Module qt5-wayland-5.15.0 Qt5 wrapper for Wayland qt5-webchannel-5.15.0 Qt 5 library for integration of C++/QML with HTML/js clients qt5-webengine-5.15.0_4 Qt 5 library to render web content qt5-webglplugin-5.15.0 Qt QPA plugin for running an application via a browser using streamed WebGL commands qt5-webkit-5.212.0.a4_3 QtWebKit with a more modern WebKit code base qt5-websockets-5.15.0 Qt implementation of WebSocket protocol qt5-websockets-qml-5.15.0 Qt implementation of WebSocket protocol (QML bindings) qt5-webview-5.15.0 Qt component for displaying web content qt5-widgets-5.15.0 Qt C++ widgets module qt5-x11extras-5.15.0 Qt platform-specific features for X11-based systems qt5-xml-5.15.0 Qt SAX and DOM implementations qt5-xmlpatterns-5.15.0_1 Qt support for XPath, XQuery, XSLT and XML Schema qtchooser-66_4 Qt tool wrapper rabbitmq-c-0.8.0 RabbitMQ C AMQP client library range-v3-0.10.0 Experimental range library for C++11/14/17 raptor2-2.0.15_14 RDF Parser Toolkit for Redland rasqal-0.9.33_1 High-level interface for RDF re2-20200401 Fast C++ regex library readline-8.0.4 Library for editing command lines as they are typed redland-1.0.17_4 High-level interface for RDF rhash-1.4.0 Utility and library for computing and checking of file hashes riscv64-binutils-2.33.1_4,1 GNU binary tools riscv64-gcc-8.3.0 Cross GNU Compiler Collection for riscv64 riscv64-xtoolchain-gcc-0.4_1 Pre seeded toolchain to cross build FreeBSD base rsync-3.2.3 Network file distribution/synchronization utility rtmpdump-2.4.20190330 RTMP streams download utility ru-hunspell-20131101 Russian hunspell dictionaries ruby-2.6.6_1,1 Object-oriented interpreted scripting language rxvt-unicode-9.22_1 Clone of the terminal emulator rxvt modified to support Unicode scrot-1.4 SCReenshOT - command line screen capture utility sdcv-0.5.2_4 Text-based utility for work with dictionaries in StarDict's format sdl-1.2.15_15,2 Cross-platform multimedia development API sdl2-2.0.12_1 Cross-platform multimedia development API sdocbook-xml-1.1_2,2 "Simplified" DocBook XML DTD sekrit-twc-zimg-2.9.3 Scaling, colorspace conversion, and dithering library serf-1.3.9_5 Serf HTTP client library sessreg-1.1.2 Manage utmp/wtmp entries for non-init X clients setxkbmap-1.3.2 Set the keyboard using the X Keyboard Extension shaderc-2020.0 GLSL/HLSL to SPIR-V shader compiler shared-mime-info-2.0 MIME types database from the freedesktop.org project shntool-3.0.10_2 Multi-purpose WAVE data processing and reporting utility shrinkpdf-20191221 Simple wrapper around Ghostscript to reduce the file size of PDFs sipcalc-1.1.6 IP subnet calculator with IPv6 support slock-1.4_2 Simple X screen locker slurm-wlm-20.02.1_2 Simple Linux Utility for Resource Management smartmontools-7.1_3 S.M.A.R.T. disk monitoring tools smproxy-1.0.6 Session Manager Proxy snappy-1.1.8 Fast compressor/decompressor library sndio-1.7.0 Small audio and MIDI framework from the OpenBSD project sox-14.4.2_4 SOund eXchange - universal sound sample translator speech-dispatcher-0.8.8 Common interface to speech synthesis speex-1.2.0,1 Audio compression format designed for speech speexdsp-1.2.0 Audio compression format designed for speech spidermonkey60-60.9.0_4 Standalone JavaScript based from Mozilla 60-esr sqlite-2.8.17_5 SQL database engine in a C library sqlite3-3.33.0,1 SQL database engine in a C library suitesparse-5.8.1 Set of packages for sparse matrix calculation svt-vp9-0.2.2 Scalable VP9 encoder swig-4.0.2 Generate wrappers for calling C/C++ code from other languages syncthing-1.8.0_1 Encrypted file sync tool sysctlbyname-improved-kmod-20191124_1 Internal sysctl node to implement an improved sysctlbyname(3) clone sysctlinfo-kmod-20191005_1 Interface to visit the sysctl MIB-tree and to get the nodes info t1lib-5.1.2_5,1 Type 1 font rasterization library for Unix/X11 taglib-1.12.b.1 Library for manipulating ID3 tags and Ogg comments tbb-2020.3 Library that provides thread building blocks tcl86-8.6.10 Tool Command Language teckit-2.5.7 Toolkit for converting data between 8-bit legacy encodings and Unicode telegram-1.4.1.g20161227_6 Command-line interface for Telegram telegram-desktop-2.4.4 Telegram Desktop messaging app tesseract-4.1.1_2 Commercial quality open source OCR engine tesseract-data-4.0.0 Trained language data for the Tesseract OCR engine tex-basic-engines-20150521 Basic TeX Engines tex-dvipsk-5.995_2 Convert a TeX DVI file to PostScript tex-formats-20150521_2 Formats for basic TeX engines and the 'latex' command tex-jadetex-3.13_3 TeX backend for Jade, DSSSL processor for SGML/XML documents tex-kpathsea-6.2.1_2 Path searching library for TeX tex-ptexenc-1.3.3_2 Library for Japanese pTeX and its tools tex-synctex-1.17.0_1 Synchronization TeXnology parser library tex-web2c-20150521_3 TeX implementation translating WEB to C tex-xmltex-1.9_2 Non-validating XML parser, written in TeX texinfo-6.7_4,1 Typeset documentation system with multiple format output texlive-base-20150521_60 TeX Live Typesetting System, base binaries texlive-texmf-20150523_4 TeX Live Typesetting System, texmf Tree texlive-tlmgr-20150523_2 TeXLive manager modules tidy4-20000804_3 Fixes and tidies up HTML files tiff-4.1.0 Tools and library routines for working with TIFF images tk86-8.6.10_1 Graphical toolkit for Tcl tl-expected-1.0.0 C++11/14/17 std::expected with functional-style extensions tmux-3.1c Terminal Multiplexer tor-0.4.3.6 Anonymizing overlay network for TCP tpm-emulator-0.7.4_2 Trusted Platform Module (TPM) emulator tradcpp-0.5.3 Traditional (K&R-style) C preprocessor transmission-gtk-3.00_3 Meta-port for Transmission BitTorrent client tree-1.8.0 Display a tree-view of directories with optional color or HTML output trousers-0.3.14_3 Open-source TCG Software Stack twemoji-color-font-ttf-12.0.1 Color emoji font using Twitter Unicode 10 twm-1.0.11 Tab Window Manager for the X Window System twolame-0.4.0 MPEG Audio Layer 2 encoder uchardet-0.0.7 Universal charset detection library uefi-edk2-bhyve-0.2_1,1 UEFI-EDK2 firmware for bhyve uefi-edk2-bhyve-csm-0.2_1,1 UEFI-EDK2 firmware for bhyve with CSM unbound-1.11.0 Validating, recursive, and caching DNS resolver unique-1.1.6_7 Library for single instance applications unixODBC-2.3.7 ODBC library suite for Unix unoconv-0.7 Convert any document from and to any LibreOffice supported format uriparser-0.9.1 URI parsing library urlview-0.9.20131021_1 URL extractor/launcher urwfonts-ttf-1.0.7b18_8 Unicode TrueType fonts from URW extended by Valek Filippov urxvt-font-size-1.3 Perl extension for rxvt-unicode terminal emulator to change font size v4l-utils-1.18.0 Video4Linux utilities v4l_compat-1.18.0 Video4Linux IOCTL header files vala-0.48.10,1 Programming language and compiler that converts Vala code into C code valgrind-devel-3.17.0.g20200723,1 Memory debugging and profiling tool vid.stab-0.98.2 Video stabilization library vim-8.2.1382 Improved version of the vi editor vlc-3.0.11_1,4 Qt based multimedia player and streaming server vm-bhyve-1.4.2 Management system for bhyve virtual machines vtk8-8.2.0 Visualization toolkit vulkan-headers-1.2.135.0 Headers for the Vulkan graphics API vulkan-loader-1.2.135.0 Driver loader for the Vulkan graphics API wavpack-5.3.0 Audio codec for lossless, lossy, and hybrid compression wayland-1.18.0_4 Wayland composite "server" webcamd-5.7.1.1_1 Port of Linux USB webcam and DVB drivers into userspace webfonts-0.30_14 TrueType core fonts for the Web webkit2-gtk3-2.28.4 Opensource browser engine using the GTK+ 3 toolkit weblint++-1.15_3 HTML validator and sanity checker webp-1.1.0 Google WebP image format conversion tool webrtc-audio-processing-0.3.1_2 AudioProcessing module from WebRTC project wget-1.20.3 Retrieve files from the Net via HTTP(S) and FTP wireguard-1.0.20200827 Fast, modern and secure VPN Tunnel wireguard-go-0.0.20200320 WireGuard implementation in Go woff2-1.0.2_4 Library and converter tools for the WOFF 2.0 web font format wx30-gtk3-3.0.5.1 The wxWidgets GUI toolkit with GTK+ bindings x11perf-1.6.1 X11 server performance test program x265-3.2.1_4 H.265/High Efficiency Video Coding (HEVC) format xapian-core-1.4.17,1 Probabilistic text search database engine xauth-1.1 X authority file utility xautolock-2.2_1 Activate xlock after a user defined time of inactivity xbacklight-1.2.3 Program to adjust backlight brightness xbanish-1.7 Banish the mouse cursor when typing xbitmaps-1.1.2 X.Org bitmaps data xcalc-1.1.0 Scientific calculator for X xcb-util-0.4.0_2,1 Module with libxcb/libX11 extension/replacement libraries xcb-util-image-0.4.0_1 Port of Xlib's XImage and XShmImage functions xcb-util-keysyms-0.4.0_1 Standard X key constants and conversion to/from keycodes xcb-util-renderutil-0.3.9_1 Convenience functions for the Render extension xcb-util-wm-0.4.1_3 Framework for window manager implementation xclip-0.13 Interface to X selections ("the clipboard") from the command line xclock-1.0.9 Analog and digital clock for X xcmsdb-1.0.5 Device Color Characterization utility for X xconsole-1.0.7_1 Monitor system console messages with X xcursor-themes-1.0.6 X.org cursors themes xcursorgen-1.0.7 Create an X cursor file from a collection of PNG images xdg-utils-1.1.3_1 Tools to allow all applications to integrate with the free desktop xdm-1.1.12_3 X.Org X display manager xdpyinfo-1.3.2_3 Display information utility for X xdriinfo-1.0.6_3 Query configuration information of DRI drivers xev-1.2.4 Print contents of X events xf86-input-keyboard-1.9.0_4 X.Org keyboard input driver xf86-input-libinput-0.30.0 X.Org libinput input driver xf86-input-mouse-1.9.3_3 X.Org mouse input driver xf86-input-synaptics-1.9.1_6 X.Org synaptics input driver xf86-video-scfb-0.0.5_2 X.Org syscons display driver xf86-video-vesa-2.4.0_3 X.Org vesa display driver xf86dga-1.0.3_1 Test program for the XFree86-DGA extension xgamma-1.0.6 Gamma correction through the X server xgc-1.0.5 X graphics demo xhost-1.0.8 Server access control program for X xinit-1.4.1,1 X Window System initializer xinput-1.6.3 Very useful utility for configuring and testing XInput devices xkbcomp-1.4.3 Compile XKB keyboard description xkbevd-1.1.4 XKB event daemon xkbutils-1.0.4_2 XKB utility demos xkeyboard-config-2.30 X Keyboard Configuration Database xkill-1.0.5 Utility for killing a client by its X resource xlsatoms-1.1.3 List interned atoms defined on a server xlsclients-1.1.4 List client applications running on a display xmessage-1.0.5 Display message or query in a X window xmlcatmgr-2.2_2 SGML and XML catalog manager xmlcharent-0.3_2 XML character entities xmlsec1-1.2.29 XML Security Library xmodmap-1.0.10 Utility for modifying keymaps and pointer button mappings in X xorg-7.7_3 X.Org complete distribution metaport xorg-apps-7.7_4 X.org apps meta-port xorg-cf-files-1.0.6 X.org cf files for use with imake builds xorg-docs-1.7.1,1 X.org documentation files xorg-drivers-7.7_6 X.org drivers meta-port xorg-fonts-7.7_1 X.org fonts meta-port xorg-fonts-100dpi-7.7 X.Org 100dpi bitmap fonts xorg-fonts-75dpi-7.7 X.Org 75dpi bitmap fonts xorg-fonts-cyrillic-7.7 X.Org Cyrillic bitmap fonts xorg-fonts-miscbitmaps-7.7 X.Org miscellaneous bitmap fonts xorg-fonts-truetype-7.7_1 X.Org TrueType fonts xorg-fonts-type1-7.7 X.Org Type1 fonts xorg-libraries-7.7_4 X.org libraries meta-port xorg-macros-1.19.2 X.Org development aclocal macros xorg-server-1.20.8_3,1 X.Org X server and related programs xorgproto-2020.1 X Window System unified protocol definitions xpdfopen-0.86 Command line utility for PDF viewers xpr-1.0.5 Utility for printing an X window dump xprop-1.2.4 Property displayer for X xrandr-1.5.1 Primitive command line interface to the RandR extension xrdb-1.2.0 X server resource database utility xrefresh-1.0.6 Refresh all or part of an X screen xset-1.2.4_3 User preference utility for X xsetroot-1.1.2 Root window parameter setting utility for X xterm-360 Terminal emulator for the X Window System xtrans-1.4.0 Abstract network code for X xvid-1.3.7,1 Opensource MPEG-4 codec, based on OpenDivx xvinfo-1.1.4 Print out X-Video extension adaptor information xwd-1.0.7 Dump an image of an X window xwininfo-1.1.5 Window information utility for X xwud-1.0.5 Image displayer for X xxhash-0.8.0 Extremely fast non-cryptographic hash algorithm yajl-2.1.0 Portable JSON parsing and serialization library in ANSI C yasm-1.3.0 Complete rewrite of the NASM assembler youtube_dl-2020.12.07 Program for downloading videos from various services zathura-0.4.5 Customizable lightweight pdf viewer zathura-djvu-0.2.9_1 DjVu support for zathura zathura-pdf-poppler-0.3.0_1 Poppler render PDF plugin for Zathura PDF viewer zathura-ps-0.2.6_4 PostScript support for Zathura PDF viewer zip-3.0_1 Create/update ZIP files compatible with PKZIP zsh-5.8 The Z shell zsh-autosuggestions-0.6.4 Fish-like autosuggestions for Zsh zsh-syntax-highlighting-0.7.1,1 Fish shell syntax highlighting for Zsh zstd-1.4.5_1 Fast real-time compression algorithm zziplib-0.13.71_1 Library to provide transparent read access to zipped files --yvKPtJ8e/9/fHVzf Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename="Xorg.0.log" Content-Transfer-Encoding: quoted-printable [ 9.712]=20 X.Org X Server 1.20.8 X Protocol Version 11, Revision 0 [ 9.712] Build Operating System: FreeBSD 12.1-RELEASE-p8 amd64=20 [ 9.712] Current Operating System: FreeBSD piggy 12.1-RELEASE-p10 FreeB= SD 12.1-RELEASE-p10 GENERIC amd64 [ 9.712] Build Date: 25 August 2020 01:09:42AM [ 9.712] =20 [ 9.712] Current version of pixman: 0.40.0 [ 9.712] Before reporting problems, check http://wiki.x.org to make sure that you have the latest version. [ 9.712] Markers: (--) probed, (**) from config file, (=3D=3D) default = setting, (++) from command line, (!!) notice, (II) informational, (WW) warning, (EE) error, (NI) not implemented, (??) unknown. [ 9.712] (=3D=3D) Log file: "/var/log/Xorg.0.log", Time: Mon Dec 28 22:= 02:57 2020 [ 9.713] (=3D=3D) Using config directory: "/usr/local/etc/X11/xorg.conf= =2Ed" [ 9.714] (=3D=3D) Using system config directory "/usr/local/share/X11/x= org.conf.d" [ 9.715] (=3D=3D) No Layout section. Using the first Screen section. [ 9.715] (=3D=3D) No screen section available. Using defaults. [ 9.715] (**) |-->Screen "Default Screen Section" (0) [ 9.715] (**) | |-->Monitor "" [ 9.715] (=3D=3D) No monitor specified for screen "Default Screen Secti= on". Using a default monitor configuration. [ 9.715] (=3D=3D) Automatically adding devices [ 9.715] (=3D=3D) Automatically enabling devices [ 9.715] (=3D=3D) Not automatically adding GPU devices [ 9.715] (=3D=3D) Max clients allowed: 256, resource mask: 0x1fffff [ 9.721] (=3D=3D) FontPath set to: /usr/local/share/fonts/misc/, /usr/local/share/fonts/TTF/, /usr/local/share/fonts/OTF/, /usr/local/share/fonts/Type1/, /usr/local/share/fonts/100dpi/, /usr/local/share/fonts/75dpi/, catalogue:/usr/local/etc/X11/fontpath.d [ 9.721] (=3D=3D) ModulePath set to "/usr/local/lib/xorg/modules" [ 9.721] (II) The server relies on udev to provide the list of input de= vices. If no devices become available, reconfigure udev or disable AutoAddDevices. [ 9.721] (II) Loader magic: 0x42e020 [ 9.721] (II) Module ABI versions: [ 9.721] X.Org ANSI C Emulation: 0.4 [ 9.721] X.Org Video Driver: 24.1 [ 9.721] X.Org XInput driver : 24.1 [ 9.721] X.Org Server Extension : 10.0 [ 9.721] (--) PCI:*(4@0:0:0) 1002:15d8:17aa:3802 rev 196, Mem @ 0xb0000= 000/268435456, 0xc0000000/2097152, 0xc0600000/524288, I/O @ 0x00001000/256,= BIOS @ 0x????????/65536 [ 9.722] (II) LoadModule: "glx" [ 9.722] (II) Loading /usr/local/lib/xorg/modules/extensions/libglx.so [ 9.725] (II) Module glx: vendor=3D"X.Org Foundation" [ 9.725] compiled for 1.20.8, module version =3D 1.0.0 [ 9.725] ABI class: X.Org Server Extension, version 10.0 [ 9.725] (=3D=3D) Matched ati as autoconfigured driver 0 [ 9.725] (=3D=3D) Matched modesetting as autoconfigured driver 1 [ 9.725] (=3D=3D) Matched scfb as autoconfigured driver 2 [ 9.725] (=3D=3D) Matched vesa as autoconfigured driver 3 [ 9.725] (=3D=3D) Assigned the driver to the xf86ConfigLayout [ 9.725] (II) LoadModule: "ati" [ 9.726] (WW) Warning, couldn't open module ati [ 9.726] (EE) Failed to load module "ati" (module does not exist, 0) [ 9.726] (II) LoadModule: "modesetting" [ 9.726] (II) Loading /usr/local/lib/xorg/modules/drivers/modesetting_d= rv.so [ 9.727] (II) Module modesetting: vendor=3D"X.Org Foundation" [ 9.727] compiled for 1.20.8, module version =3D 1.20.8 [ 9.727] Module class: X.Org Video Driver [ 9.727] ABI class: X.Org Video Driver, version 24.1 [ 9.727] (II) LoadModule: "scfb" [ 9.727] (II) Loading /usr/local/lib/xorg/modules/drivers/scfb_drv.so [ 9.727] (II) Module scfb: vendor=3D"X.Org Foundation" [ 9.727] compiled for 1.20.8, module version =3D 0.0.5 [ 9.727] ABI class: X.Org Video Driver, version 24.1 [ 9.727] (II) LoadModule: "vesa" [ 9.727] (II) Loading /usr/local/lib/xorg/modules/drivers/vesa_drv.so [ 9.728] (II) Module vesa: vendor=3D"X.Org Foundation" [ 9.728] compiled for 1.20.8, module version =3D 2.4.0 [ 9.728] Module class: X.Org Video Driver [ 9.728] ABI class: X.Org Video Driver, version 24.1 [ 9.728] (II) modesetting: Driver for Modesetting Kernel Drivers: kms [ 9.728] (II) scfb: driver for wsdisplay framebuffer: scfb [ 9.728] (II) VESA: driver for VESA chipsets: vesa [ 9.728] (--) Using syscons driver with X support (version 2.0) [ 9.728] (--) using VT number 9 [ 9.738] (EE) open /dev/dri/card0: No such file or directory [ 9.738] (WW) Falling back to old probe method for modesetting [ 9.738] (EE) open /dev/dri/card0: No such file or directory [ 9.738] (WW) Falling back to old probe method for scfb [ 9.738] scfb trace: probe start [ 9.738] scfb trace: probe done [ 9.738] (WW) VGA arbiter: cannot open kernel arbiter, no multi-card su= pport [ 9.738] (EE) Screen 0 deleted because of no matching config section. [ 9.738] (II) UnloadModule: "modesetting" [ 9.738] (II) Loading sub module "vbe" [ 9.738] (II) LoadModule: "vbe" [ 9.738] (II) Loading /usr/local/lib/xorg/modules/libvbe.so [ 9.739] (II) Module vbe: vendor=3D"X.Org Foundation" [ 9.739] compiled for 1.20.8, module version =3D 1.1.0 [ 9.739] ABI class: X.Org Video Driver, version 24.1 [ 9.739] (II) Loading sub module "int10" [ 9.739] (II) LoadModule: "int10" [ 9.739] (II) Loading /usr/local/lib/xorg/modules/libint10.so [ 9.740] (II) Module int10: vendor=3D"X.Org Foundation" [ 9.740] compiled for 1.20.8, module version =3D 1.0.0 [ 9.740] ABI class: X.Org Video Driver, version 24.1 [ 9.740] (II) VESA(0): initializing int10 [ 9.741] (II) VESA(0): Primary V_BIOS segment is: 0xc000 [ 9.741] (II) VESA(0): VESA BIOS detected [ 9.741] (II) VESA(0): VESA VBE Version 3.0 [ 9.741] (II) VESA(0): VESA VBE Total Mem: 49152 kB [ 9.741] (II) VESA(0): VESA VBE OEM: AMD ATOMBIOS [ 9.741] (II) VESA(0): VESA VBE OEM Software Rev: 16.2 [ 9.741] (II) VESA(0): VESA VBE OEM Vendor: (C) 1988-2010, Advanced Mic= ro Devices, Inc. [ 9.741] (II) VESA(0): VESA VBE OEM Product: RAVEN2 [ 9.741] (II) VESA(0): VESA VBE OEM Product Rev: 01.00 [ 9.806] (II) VESA(0): Creating default Display subsection in Screen se= ction "Default Screen Section" for depth/fbbpp 24/32 [ 9.807] (=3D=3D) VESA(0): Depth 24, (--) framebuffer bpp 32 [ 9.807] (=3D=3D) VESA(0): RGB weight 888 [ 9.807] (=3D=3D) VESA(0): Default visual is TrueColor [ 9.807] (=3D=3D) VESA(0): Using gamma correction (1.0, 1.0, 1.0) [ 9.807] (II) Loading sub module "ddc" [ 9.807] (II) LoadModule: "ddc" [ 9.807] (II) Module "ddc" already built-in [ 9.807] (II) VESA(0): VESA VBE DDC supported [ 9.807] (II) VESA(0): VESA VBE DDC Level 2 [ 9.807] (II) VESA(0): VESA VBE DDC transfer in appr. 1 sec. [ 9.810] (II) VESA(0): VESA VBE DDC read successfully [ 9.812] (II) VESA(0): Manufacturer: CMN Model: 14d4 Serial#: 0 [ 9.812] (II) VESA(0): Year: 2016 Week: 36 [ 9.812] (II) VESA(0): EDID Version: 1.4 [ 9.812] (II) VESA(0): Digital Display Input [ 9.812] (II) VESA(0): 8 bits per channel [ 9.812] (II) VESA(0): Digital interface is DisplayPort [ 9.812] (II) VESA(0): Max Image Size [cm]: horiz.: 31 vert.: 17 [ 9.812] (II) VESA(0): Gamma: 2.20 [ 9.812] (II) VESA(0): No DPMS capabilities specified [ 9.812] (II) VESA(0): Supported color encodings: RGB 4:4:4=20 [ 9.812] (II) VESA(0): First detailed timing is preferred mode [ 9.812] (II) VESA(0): Preferred mode is native pixel format and refres= h rate [ 9.812] (II) VESA(0): redX: 0.590 redY: 0.350 greenX: 0.330 greenY: = 0.555 [ 9.812] (II) VESA(0): blueX: 0.153 blueY: 0.119 whiteX: 0.313 whiteY= : 0.329 [ 9.812] (II) VESA(0): Manufacturer's mask: 0 [ 9.812] (II) VESA(0): Supported detailed timing: [ 9.812] (II) VESA(0): clock: 152.8 MHz Image Size: 309 x 173 mm [ 9.812] (II) VESA(0): h_active: 1920 h_sync: 2000 h_sync_end 2060 h_= blank_end 2250 h_border: 0 [ 9.812] (II) VESA(0): v_active: 1080 v_sync: 1086 v_sync_end 1094 v_= blanking: 1132 v_border: 0 [ 9.812] (II) VESA(0): N140HCA-EAC [ 9.812] (II) VESA(0): CMN [ 9.812] (II) VESA(0): N140HCA-EAC [ 9.812] (II) VESA(0): EDID (in hex): [ 9.812] (II) VESA(0): 00ffffffffffff000daed41400000000 [ 9.812] (II) VESA(0): 241a0104a51f11780228659759548e27 [ 9.812] (II) VESA(0): 1e505400000001010101010101010101 [ 9.812] (II) VESA(0): 010101010101b43b804a71383440503c [ 9.812] (II) VESA(0): 680035ad10000018000000fe004e3134 [ 9.812] (II) VESA(0): 304843412d4541430a20000000fe0043 [ 9.812] (II) VESA(0): 4d4e0a202020202020202020000000fe [ 9.812] (II) VESA(0): 004e3134304843412d4541430a200005 [ 9.812] (II) VESA(0): EDID vendor "CMN", prod id 5332 [ 9.812] (II) VESA(0): Printing DDC gathered Modelines: [ 9.812] (II) VESA(0): Modeline "1920x1080"x0.0 152.84 1920 2000 2060= 2250 1080 1086 1094 1132 -hsync -vsync (67.9 kHz eP) [ 9.812] (II) VESA(0): Searching for matching VESA mode(s): [ 9.815] Mode: 110 (640x480) [ 9.815] ModeAttributes: 0xbb [ 9.815] WinAAttributes: 0x7 [ 9.815] WinBAttributes: 0x0 [ 9.815] WinGranularity: 64 [ 9.815] WinSize: 64 [ 9.815] WinASegment: 0xa000 [ 9.815] WinBSegment: 0x0 [ 9.815] WinFuncPtr: 0xc0004c39 [ 9.815] BytesPerScanline: 1280 [ 9.815] XResolution: 640 [ 9.815] YResolution: 480 [ 9.815] XCharSize: 8 [ 9.815] YCharSize: 16 [ 9.815] NumberOfPlanes: 1 [ 9.815] BitsPerPixel: 16 [ 9.815] NumberOfBanks: 1 [ 9.815] MemoryModel: 6 [ 9.815] BankSize: 0 [ 9.815] NumberOfImages: 75 [ 9.815] RedMaskSize: 5 [ 9.815] RedFieldPosition: 10 [ 9.815] GreenMaskSize: 5 [ 9.815] GreenFieldPosition: 5 [ 9.815] BlueMaskSize: 5 [ 9.815] BlueFieldPosition: 0 [ 9.816] RsvdMaskSize: 0 [ 9.816] RsvdFieldPosition: 0 [ 9.816] DirectColorModeInfo: 0 [ 9.816] PhysBasePtr: 0xb0000000 [ 9.816] LinBytesPerScanLine: 1280 [ 9.816] BnkNumberOfImagePages: 75 [ 9.816] LinNumberOfImagePages: 75 [ 9.816] LinRedMaskSize: 5 [ 9.816] LinRedFieldPosition: 10 [ 9.816] LinGreenMaskSize: 5 [ 9.816] LinGreenFieldPosition: 5 [ 9.816] LinBlueMaskSize: 5 [ 9.816] LinBlueFieldPosition: 0 [ 9.816] LinRsvdMaskSize: 0 [ 9.816] LinRsvdFieldPosition: 0 [ 9.816] MaxPixelClock: 400000000 [ 9.819] Mode: 111 (640x480) [ 9.819] ModeAttributes: 0xbb [ 9.819] WinAAttributes: 0x7 [ 9.819] WinBAttributes: 0x0 [ 9.819] WinGranularity: 64 [ 9.819] WinSize: 64 [ 9.819] WinASegment: 0xa000 [ 9.819] WinBSegment: 0x0 [ 9.819] WinFuncPtr: 0xc0004c39 [ 9.819] BytesPerScanline: 1280 [ 9.819] XResolution: 640 [ 9.819] YResolution: 480 [ 9.819] XCharSize: 8 [ 9.819] YCharSize: 16 [ 9.819] NumberOfPlanes: 1 [ 9.819] BitsPerPixel: 16 [ 9.819] NumberOfBanks: 1 [ 9.819] MemoryModel: 6 [ 9.819] BankSize: 0 [ 9.819] NumberOfImages: 75 [ 9.819] RedMaskSize: 5 [ 9.819] RedFieldPosition: 11 [ 9.819] GreenMaskSize: 6 [ 9.819] GreenFieldPosition: 5 [ 9.819] BlueMaskSize: 5 [ 9.819] BlueFieldPosition: 0 [ 9.819] RsvdMaskSize: 0 [ 9.819] RsvdFieldPosition: 0 [ 9.819] DirectColorModeInfo: 0 [ 9.819] PhysBasePtr: 0xb0000000 [ 9.819] LinBytesPerScanLine: 1280 [ 9.819] BnkNumberOfImagePages: 75 [ 9.819] LinNumberOfImagePages: 75 [ 9.819] LinRedMaskSize: 5 [ 9.819] LinRedFieldPosition: 11 [ 9.819] LinGreenMaskSize: 6 [ 9.819] LinGreenFieldPosition: 5 [ 9.819] LinBlueMaskSize: 5 [ 9.819] LinBlueFieldPosition: 0 [ 9.819] LinRsvdMaskSize: 0 [ 9.819] LinRsvdFieldPosition: 0 [ 9.819] MaxPixelClock: 400000000 [ 9.822] Mode: 113 (800x600) [ 9.822] ModeAttributes: 0xbb [ 9.822] WinAAttributes: 0x7 [ 9.822] WinBAttributes: 0x0 [ 9.822] WinGranularity: 64 [ 9.822] WinSize: 64 [ 9.822] WinASegment: 0xa000 [ 9.822] WinBSegment: 0x0 [ 9.822] WinFuncPtr: 0xc0004c39 [ 9.822] BytesPerScanline: 1664 [ 9.822] XResolution: 800 [ 9.822] YResolution: 600 [ 9.822] XCharSize: 8 [ 9.822] YCharSize: 14 [ 9.822] NumberOfPlanes: 1 [ 9.822] BitsPerPixel: 16 [ 9.822] NumberOfBanks: 1 [ 9.822] MemoryModel: 6 [ 9.822] BankSize: 0 [ 9.822] NumberOfImages: 47 [ 9.822] RedMaskSize: 5 [ 9.822] RedFieldPosition: 10 [ 9.822] GreenMaskSize: 5 [ 9.822] GreenFieldPosition: 5 [ 9.822] BlueMaskSize: 5 [ 9.822] BlueFieldPosition: 0 [ 9.822] RsvdMaskSize: 0 [ 9.822] RsvdFieldPosition: 0 [ 9.822] DirectColorModeInfo: 0 [ 9.823] PhysBasePtr: 0xb0000000 [ 9.823] LinBytesPerScanLine: 1664 [ 9.823] BnkNumberOfImagePages: 47 [ 9.823] LinNumberOfImagePages: 47 [ 9.823] LinRedMaskSize: 5 [ 9.823] LinRedFieldPosition: 10 [ 9.823] LinGreenMaskSize: 5 [ 9.823] LinGreenFieldPosition: 5 [ 9.823] LinBlueMaskSize: 5 [ 9.823] LinBlueFieldPosition: 0 [ 9.823] LinRsvdMaskSize: 0 [ 9.823] LinRsvdFieldPosition: 0 [ 9.823] MaxPixelClock: 400000000 [ 9.826] Mode: 114 (800x600) [ 9.826] ModeAttributes: 0xbb [ 9.826] WinAAttributes: 0x7 [ 9.826] WinBAttributes: 0x0 [ 9.826] WinGranularity: 64 [ 9.826] WinSize: 64 [ 9.826] WinASegment: 0xa000 [ 9.826] WinBSegment: 0x0 [ 9.826] WinFuncPtr: 0xc0004c39 [ 9.826] BytesPerScanline: 1664 [ 9.826] XResolution: 800 [ 9.826] YResolution: 600 [ 9.826] XCharSize: 8 [ 9.826] YCharSize: 14 [ 9.826] NumberOfPlanes: 1 [ 9.826] BitsPerPixel: 16 [ 9.826] NumberOfBanks: 1 [ 9.826] MemoryModel: 6 [ 9.826] BankSize: 0 [ 9.826] NumberOfImages: 47 [ 9.826] RedMaskSize: 5 [ 9.826] RedFieldPosition: 11 [ 9.826] GreenMaskSize: 6 [ 9.826] GreenFieldPosition: 5 [ 9.826] BlueMaskSize: 5 [ 9.826] BlueFieldPosition: 0 [ 9.826] RsvdMaskSize: 0 [ 9.826] RsvdFieldPosition: 0 [ 9.826] DirectColorModeInfo: 0 [ 9.826] PhysBasePtr: 0xb0000000 [ 9.826] LinBytesPerScanLine: 1664 [ 9.826] BnkNumberOfImagePages: 47 [ 9.826] LinNumberOfImagePages: 47 [ 9.826] LinRedMaskSize: 5 [ 9.826] LinRedFieldPosition: 11 [ 9.826] LinGreenMaskSize: 6 [ 9.826] LinGreenFieldPosition: 5 [ 9.826] LinBlueMaskSize: 5 [ 9.826] LinBlueFieldPosition: 0 [ 9.826] LinRsvdMaskSize: 0 [ 9.826] LinRsvdFieldPosition: 0 [ 9.826] MaxPixelClock: 400000000 [ 9.829] Mode: 116 (1024x768) [ 9.829] ModeAttributes: 0xbb [ 9.829] WinAAttributes: 0x7 [ 9.829] WinBAttributes: 0x0 [ 9.829] WinGranularity: 64 [ 9.829] WinSize: 64 [ 9.829] WinASegment: 0xa000 [ 9.829] WinBSegment: 0x0 [ 9.829] WinFuncPtr: 0xc0004c39 [ 9.829] BytesPerScanline: 2048 [ 9.829] XResolution: 1024 [ 9.829] YResolution: 768 [ 9.829] XCharSize: 8 [ 9.829] YCharSize: 16 [ 9.829] NumberOfPlanes: 1 [ 9.829] BitsPerPixel: 16 [ 9.829] NumberOfBanks: 1 [ 9.829] MemoryModel: 6 [ 9.829] BankSize: 0 [ 9.829] NumberOfImages: 29 [ 9.829] RedMaskSize: 5 [ 9.829] RedFieldPosition: 10 [ 9.829] GreenMaskSize: 5 [ 9.829] GreenFieldPosition: 5 [ 9.829] BlueMaskSize: 5 [ 9.829] BlueFieldPosition: 0 [ 9.829] RsvdMaskSize: 0 [ 9.830] RsvdFieldPosition: 0 [ 9.830] DirectColorModeInfo: 0 [ 9.830] PhysBasePtr: 0xb0000000 [ 9.830] LinBytesPerScanLine: 2048 [ 9.830] BnkNumberOfImagePages: 29 [ 9.830] LinNumberOfImagePages: 29 [ 9.830] LinRedMaskSize: 5 [ 9.830] LinRedFieldPosition: 10 [ 9.830] LinGreenMaskSize: 5 [ 9.830] LinGreenFieldPosition: 5 [ 9.830] LinBlueMaskSize: 5 [ 9.830] LinBlueFieldPosition: 0 [ 9.830] LinRsvdMaskSize: 0 [ 9.830] LinRsvdFieldPosition: 0 [ 9.830] MaxPixelClock: 400000000 [ 9.833] Mode: 117 (1024x768) [ 9.833] ModeAttributes: 0xbb [ 9.833] WinAAttributes: 0x7 [ 9.833] WinBAttributes: 0x0 [ 9.833] WinGranularity: 64 [ 9.833] WinSize: 64 [ 9.833] WinASegment: 0xa000 [ 9.833] WinBSegment: 0x0 [ 9.833] WinFuncPtr: 0xc0004c39 [ 9.833] BytesPerScanline: 2048 [ 9.833] XResolution: 1024 [ 9.833] YResolution: 768 [ 9.833] XCharSize: 8 [ 9.833] YCharSize: 16 [ 9.833] NumberOfPlanes: 1 [ 9.833] BitsPerPixel: 16 [ 9.833] NumberOfBanks: 1 [ 9.833] MemoryModel: 6 [ 9.833] BankSize: 0 [ 9.833] NumberOfImages: 29 [ 9.833] RedMaskSize: 5 [ 9.833] RedFieldPosition: 11 [ 9.833] GreenMaskSize: 6 [ 9.833] GreenFieldPosition: 5 [ 9.833] BlueMaskSize: 5 [ 9.833] BlueFieldPosition: 0 [ 9.833] RsvdMaskSize: 0 [ 9.833] RsvdFieldPosition: 0 [ 9.833] DirectColorModeInfo: 0 [ 9.833] PhysBasePtr: 0xb0000000 [ 9.833] LinBytesPerScanLine: 2048 [ 9.833] BnkNumberOfImagePages: 29 [ 9.833] LinNumberOfImagePages: 29 [ 9.833] LinRedMaskSize: 5 [ 9.833] LinRedFieldPosition: 11 [ 9.833] LinGreenMaskSize: 6 [ 9.833] LinGreenFieldPosition: 5 [ 9.833] LinBlueMaskSize: 5 [ 9.833] LinBlueFieldPosition: 0 [ 9.833] LinRsvdMaskSize: 0 [ 9.833] LinRsvdFieldPosition: 0 [ 9.833] MaxPixelClock: 400000000 [ 9.836] Mode: 119 (1280x1024) [ 9.836] ModeAttributes: 0xbb [ 9.836] WinAAttributes: 0x7 [ 9.836] WinBAttributes: 0x0 [ 9.836] WinGranularity: 64 [ 9.836] WinSize: 64 [ 9.836] WinASegment: 0xa000 [ 9.836] WinBSegment: 0x0 [ 9.836] WinFuncPtr: 0xc0004c39 [ 9.836] BytesPerScanline: 2560 [ 9.836] XResolution: 1280 [ 9.836] YResolution: 1024 [ 9.836] XCharSize: 8 [ 9.836] YCharSize: 16 [ 9.836] NumberOfPlanes: 1 [ 9.836] BitsPerPixel: 16 [ 9.836] NumberOfBanks: 1 [ 9.836] MemoryModel: 6 [ 9.836] BankSize: 0 [ 9.836] NumberOfImages: 17 [ 9.836] RedMaskSize: 5 [ 9.836] RedFieldPosition: 10 [ 9.836] GreenMaskSize: 5 [ 9.836] GreenFieldPosition: 5 [ 9.837] BlueMaskSize: 5 [ 9.837] BlueFieldPosition: 0 [ 9.837] RsvdMaskSize: 0 [ 9.837] RsvdFieldPosition: 0 [ 9.837] DirectColorModeInfo: 0 [ 9.837] PhysBasePtr: 0xb0000000 [ 9.837] LinBytesPerScanLine: 2560 [ 9.837] BnkNumberOfImagePages: 17 [ 9.837] LinNumberOfImagePages: 17 [ 9.837] LinRedMaskSize: 5 [ 9.837] LinRedFieldPosition: 10 [ 9.837] LinGreenMaskSize: 5 [ 9.837] LinGreenFieldPosition: 5 [ 9.837] LinBlueMaskSize: 5 [ 9.837] LinBlueFieldPosition: 0 [ 9.837] LinRsvdMaskSize: 0 [ 9.837] LinRsvdFieldPosition: 0 [ 9.837] MaxPixelClock: 400000000 [ 9.840] Mode: 11a (1280x1024) [ 9.840] ModeAttributes: 0xbb [ 9.840] WinAAttributes: 0x7 [ 9.840] WinBAttributes: 0x0 [ 9.840] WinGranularity: 64 [ 9.840] WinSize: 64 [ 9.840] WinASegment: 0xa000 [ 9.840] WinBSegment: 0x0 [ 9.840] WinFuncPtr: 0xc0004c39 [ 9.840] BytesPerScanline: 2560 [ 9.840] XResolution: 1280 [ 9.840] YResolution: 1024 [ 9.840] XCharSize: 8 [ 9.840] YCharSize: 16 [ 9.840] NumberOfPlanes: 1 [ 9.840] BitsPerPixel: 16 [ 9.840] NumberOfBanks: 1 [ 9.840] MemoryModel: 6 [ 9.840] BankSize: 0 [ 9.840] NumberOfImages: 17 [ 9.840] RedMaskSize: 5 [ 9.840] RedFieldPosition: 11 [ 9.840] GreenMaskSize: 6 [ 9.840] GreenFieldPosition: 5 [ 9.840] BlueMaskSize: 5 [ 9.840] BlueFieldPosition: 0 [ 9.840] RsvdMaskSize: 0 [ 9.840] RsvdFieldPosition: 0 [ 9.840] DirectColorModeInfo: 0 [ 9.840] PhysBasePtr: 0xb0000000 [ 9.840] LinBytesPerScanLine: 2560 [ 9.840] BnkNumberOfImagePages: 17 [ 9.840] LinNumberOfImagePages: 17 [ 9.840] LinRedMaskSize: 5 [ 9.840] LinRedFieldPosition: 11 [ 9.840] LinGreenMaskSize: 6 [ 9.840] LinGreenFieldPosition: 5 [ 9.840] LinBlueMaskSize: 5 [ 9.840] LinBlueFieldPosition: 0 [ 9.840] LinRsvdMaskSize: 0 [ 9.840] LinRsvdFieldPosition: 0 [ 9.840] MaxPixelClock: 400000000 [ 9.843] Mode: 165 (1280x960) [ 9.843] ModeAttributes: 0xbb [ 9.843] WinAAttributes: 0x7 [ 9.843] WinBAttributes: 0x0 [ 9.843] WinGranularity: 64 [ 9.843] WinSize: 64 [ 9.843] WinASegment: 0xa000 [ 9.843] WinBSegment: 0x0 [ 9.843] WinFuncPtr: 0xc0004c39 [ 9.843] BytesPerScanline: 2560 [ 9.843] XResolution: 1280 [ 9.844] YResolution: 960 [ 9.844] XCharSize: 8 [ 9.844] YCharSize: 16 [ 9.844] NumberOfPlanes: 1 [ 9.844] BitsPerPixel: 16 [ 9.844] NumberOfBanks: 1 [ 9.844] MemoryModel: 6 [ 9.844] BankSize: 0 [ 9.844] NumberOfImages: 19 [ 9.844] RedMaskSize: 5 [ 9.844] RedFieldPosition: 11 [ 9.844] GreenMaskSize: 6 [ 9.844] GreenFieldPosition: 5 [ 9.844] BlueMaskSize: 5 [ 9.844] BlueFieldPosition: 0 [ 9.844] RsvdMaskSize: 0 [ 9.844] RsvdFieldPosition: 0 [ 9.844] DirectColorModeInfo: 0 [ 9.844] PhysBasePtr: 0xb0000000 [ 9.844] LinBytesPerScanLine: 2560 [ 9.844] BnkNumberOfImagePages: 19 [ 9.844] LinNumberOfImagePages: 19 [ 9.844] LinRedMaskSize: 5 [ 9.844] LinRedFieldPosition: 11 [ 9.844] LinGreenMaskSize: 6 [ 9.844] LinGreenFieldPosition: 5 [ 9.844] LinBlueMaskSize: 5 [ 9.844] LinBlueFieldPosition: 0 [ 9.844] LinRsvdMaskSize: 0 [ 9.844] LinRsvdFieldPosition: 0 [ 9.844] MaxPixelClock: 400000000 [ 9.847] *Mode: 166 (1280x960) [ 9.847] ModeAttributes: 0xbb [ 9.847] WinAAttributes: 0x7 [ 9.847] WinBAttributes: 0x0 [ 9.847] WinGranularity: 64 [ 9.847] WinSize: 64 [ 9.847] WinASegment: 0xa000 [ 9.847] WinBSegment: 0x0 [ 9.847] WinFuncPtr: 0xc0004c39 [ 9.847] BytesPerScanline: 5120 [ 9.847] XResolution: 1280 [ 9.847] YResolution: 960 [ 9.847] XCharSize: 8 [ 9.847] YCharSize: 16 [ 9.847] NumberOfPlanes: 1 [ 9.847] BitsPerPixel: 32 [ 9.847] NumberOfBanks: 1 [ 9.847] MemoryModel: 6 [ 9.847] BankSize: 0 [ 9.847] NumberOfImages: 9 [ 9.847] RedMaskSize: 8 [ 9.847] RedFieldPosition: 16 [ 9.847] GreenMaskSize: 8 [ 9.847] GreenFieldPosition: 8 [ 9.847] BlueMaskSize: 8 [ 9.847] BlueFieldPosition: 0 [ 9.847] RsvdMaskSize: 0 [ 9.847] RsvdFieldPosition: 0 [ 9.847] DirectColorModeInfo: 0 [ 9.847] PhysBasePtr: 0xb0000000 [ 9.847] LinBytesPerScanLine: 5120 [ 9.847] BnkNumberOfImagePages: 9 [ 9.847] LinNumberOfImagePages: 9 [ 9.847] LinRedMaskSize: 8 [ 9.847] LinRedFieldPosition: 16 [ 9.847] LinGreenMaskSize: 8 [ 9.847] LinGreenFieldPosition: 8 [ 9.847] LinBlueMaskSize: 8 [ 9.847] LinBlueFieldPosition: 0 [ 9.847] LinRsvdMaskSize: 0 [ 9.847] LinRsvdFieldPosition: 0 [ 9.847] MaxPixelClock: 400000000 [ 9.850] *Mode: 121 (640x480) [ 9.850] ModeAttributes: 0xbb [ 9.850] WinAAttributes: 0x7 [ 9.850] WinBAttributes: 0x0 [ 9.850] WinGranularity: 64 [ 9.850] WinSize: 64 [ 9.850] WinASegment: 0xa000 [ 9.850] WinBSegment: 0x0 [ 9.850] WinFuncPtr: 0xc0004c39 [ 9.850] BytesPerScanline: 2560 [ 9.851] XResolution: 640 [ 9.851] YResolution: 480 [ 9.851] XCharSize: 8 [ 9.851] YCharSize: 16 [ 9.851] NumberOfPlanes: 1 [ 9.851] BitsPerPixel: 32 [ 9.851] NumberOfBanks: 1 [ 9.851] MemoryModel: 6 [ 9.851] BankSize: 0 [ 9.851] NumberOfImages: 39 [ 9.851] RedMaskSize: 8 [ 9.851] RedFieldPosition: 16 [ 9.851] GreenMaskSize: 8 [ 9.851] GreenFieldPosition: 8 [ 9.851] BlueMaskSize: 8 [ 9.851] BlueFieldPosition: 0 [ 9.851] RsvdMaskSize: 0 [ 9.851] RsvdFieldPosition: 0 [ 9.851] DirectColorModeInfo: 0 [ 9.851] PhysBasePtr: 0xb0000000 [ 9.851] LinBytesPerScanLine: 2560 [ 9.851] BnkNumberOfImagePages: 39 [ 9.851] LinNumberOfImagePages: 39 [ 9.851] LinRedMaskSize: 8 [ 9.851] LinRedFieldPosition: 16 [ 9.851] LinGreenMaskSize: 8 [ 9.851] LinGreenFieldPosition: 8 [ 9.851] LinBlueMaskSize: 8 [ 9.851] LinBlueFieldPosition: 0 [ 9.851] LinRsvdMaskSize: 0 [ 9.851] LinRsvdFieldPosition: 0 [ 9.851] MaxPixelClock: 400000000 [ 9.854] *Mode: 122 (800x600) [ 9.854] ModeAttributes: 0xbb [ 9.854] WinAAttributes: 0x7 [ 9.854] WinBAttributes: 0x0 [ 9.854] WinGranularity: 64 [ 9.854] WinSize: 64 [ 9.854] WinASegment: 0xa000 [ 9.854] WinBSegment: 0x0 [ 9.854] WinFuncPtr: 0xc0004c39 [ 9.854] BytesPerScanline: 3328 [ 9.854] XResolution: 800 [ 9.854] YResolution: 600 [ 9.854] XCharSize: 8 [ 9.854] YCharSize: 14 [ 9.854] NumberOfPlanes: 1 [ 9.854] BitsPerPixel: 32 [ 9.854] NumberOfBanks: 1 [ 9.854] MemoryModel: 6 [ 9.854] BankSize: 0 [ 9.854] NumberOfImages: 23 [ 9.854] RedMaskSize: 8 [ 9.854] RedFieldPosition: 16 [ 9.854] GreenMaskSize: 8 [ 9.854] GreenFieldPosition: 8 [ 9.854] BlueMaskSize: 8 [ 9.854] BlueFieldPosition: 0 [ 9.854] RsvdMaskSize: 0 [ 9.854] RsvdFieldPosition: 0 [ 9.854] DirectColorModeInfo: 0 [ 9.854] PhysBasePtr: 0xb0000000 [ 9.854] LinBytesPerScanLine: 3328 [ 9.854] BnkNumberOfImagePages: 23 [ 9.854] LinNumberOfImagePages: 23 [ 9.854] LinRedMaskSize: 8 [ 9.854] LinRedFieldPosition: 16 [ 9.854] LinGreenMaskSize: 8 [ 9.854] LinGreenFieldPosition: 8 [ 9.854] LinBlueMaskSize: 8 [ 9.854] LinBlueFieldPosition: 0 [ 9.854] LinRsvdMaskSize: 0 [ 9.854] LinRsvdFieldPosition: 0 [ 9.854] MaxPixelClock: 400000000 [ 9.857] *Mode: 123 (1024x768) [ 9.857] ModeAttributes: 0xbb [ 9.857] WinAAttributes: 0x7 [ 9.858] WinBAttributes: 0x0 [ 9.858] WinGranularity: 64 [ 9.858] WinSize: 64 [ 9.858] WinASegment: 0xa000 [ 9.858] WinBSegment: 0x0 [ 9.858] WinFuncPtr: 0xc0004c39 [ 9.858] BytesPerScanline: 4096 [ 9.858] XResolution: 1024 [ 9.858] YResolution: 768 [ 9.858] XCharSize: 8 [ 9.858] YCharSize: 16 [ 9.858] NumberOfPlanes: 1 [ 9.858] BitsPerPixel: 32 [ 9.858] NumberOfBanks: 1 [ 9.858] MemoryModel: 6 [ 9.858] BankSize: 0 [ 9.858] NumberOfImages: 14 [ 9.858] RedMaskSize: 8 [ 9.858] RedFieldPosition: 16 [ 9.858] GreenMaskSize: 8 [ 9.858] GreenFieldPosition: 8 [ 9.858] BlueMaskSize: 8 [ 9.858] BlueFieldPosition: 0 [ 9.858] RsvdMaskSize: 0 [ 9.858] RsvdFieldPosition: 0 [ 9.858] DirectColorModeInfo: 0 [ 9.858] PhysBasePtr: 0xb0000000 [ 9.858] LinBytesPerScanLine: 4096 [ 9.858] BnkNumberOfImagePages: 14 [ 9.858] LinNumberOfImagePages: 14 [ 9.858] LinRedMaskSize: 8 [ 9.858] LinRedFieldPosition: 16 [ 9.858] LinGreenMaskSize: 8 [ 9.858] LinGreenFieldPosition: 8 [ 9.858] LinBlueMaskSize: 8 [ 9.858] LinBlueFieldPosition: 0 [ 9.858] LinRsvdMaskSize: 0 [ 9.858] LinRsvdFieldPosition: 0 [ 9.858] MaxPixelClock: 400000000 [ 9.861] *Mode: 124 (1280x1024) [ 9.861] ModeAttributes: 0xbb [ 9.861] WinAAttributes: 0x7 [ 9.861] WinBAttributes: 0x0 [ 9.861] WinGranularity: 64 [ 9.861] WinSize: 64 [ 9.861] WinASegment: 0xa000 [ 9.861] WinBSegment: 0x0 [ 9.861] WinFuncPtr: 0xc0004c39 [ 9.861] BytesPerScanline: 5120 [ 9.861] XResolution: 1280 [ 9.861] YResolution: 1024 [ 9.861] XCharSize: 8 [ 9.861] YCharSize: 16 [ 9.861] NumberOfPlanes: 1 [ 9.861] BitsPerPixel: 32 [ 9.861] NumberOfBanks: 1 [ 9.861] MemoryModel: 6 [ 9.861] BankSize: 0 [ 9.861] NumberOfImages: 8 [ 9.861] RedMaskSize: 8 [ 9.861] RedFieldPosition: 16 [ 9.861] GreenMaskSize: 8 [ 9.861] GreenFieldPosition: 8 [ 9.861] BlueMaskSize: 8 [ 9.861] BlueFieldPosition: 0 [ 9.861] RsvdMaskSize: 0 [ 9.861] RsvdFieldPosition: 0 [ 9.861] DirectColorModeInfo: 0 [ 9.861] PhysBasePtr: 0xb0000000 [ 9.861] LinBytesPerScanLine: 5120 [ 9.861] BnkNumberOfImagePages: 8 [ 9.861] LinNumberOfImagePages: 8 [ 9.861] LinRedMaskSize: 8 [ 9.861] LinRedFieldPosition: 16 [ 9.861] LinGreenMaskSize: 8 [ 9.861] LinGreenFieldPosition: 8 [ 9.861] LinBlueMaskSize: 8 [ 9.861] LinBlueFieldPosition: 0 [ 9.861] LinRsvdMaskSize: 0 [ 9.861] LinRsvdFieldPosition: 0 [ 9.861] MaxPixelClock: 400000000 [ 9.865] Mode: 145 (1400x1050) [ 9.865] ModeAttributes: 0xbb [ 9.865] WinAAttributes: 0x7 [ 9.865] WinBAttributes: 0x0 [ 9.865] WinGranularity: 64 [ 9.865] WinSize: 64 [ 9.865] WinASegment: 0xa000 [ 9.865] WinBSegment: 0x0 [ 9.865] WinFuncPtr: 0xc0004c39 [ 9.865] BytesPerScanline: 2816 [ 9.865] XResolution: 1400 [ 9.865] YResolution: 1050 [ 9.865] XCharSize: 8 [ 9.865] YCharSize: 16 [ 9.865] NumberOfPlanes: 1 [ 9.865] BitsPerPixel: 16 [ 9.865] NumberOfBanks: 1 [ 9.865] MemoryModel: 6 [ 9.865] BankSize: 0 [ 9.865] NumberOfImages: 15 [ 9.865] RedMaskSize: 5 [ 9.865] RedFieldPosition: 11 [ 9.865] GreenMaskSize: 6 [ 9.865] GreenFieldPosition: 5 [ 9.865] BlueMaskSize: 5 [ 9.865] BlueFieldPosition: 0 [ 9.865] RsvdMaskSize: 0 [ 9.865] RsvdFieldPosition: 0 [ 9.865] DirectColorModeInfo: 0 [ 9.865] PhysBasePtr: 0xb0000000 [ 9.865] LinBytesPerScanLine: 2816 [ 9.865] BnkNumberOfImagePages: 15 [ 9.865] LinNumberOfImagePages: 15 [ 9.865] LinRedMaskSize: 5 [ 9.865] LinRedFieldPosition: 11 [ 9.865] LinGreenMaskSize: 6 [ 9.865] LinGreenFieldPosition: 5 [ 9.865] LinBlueMaskSize: 5 [ 9.865] LinBlueFieldPosition: 0 [ 9.865] LinRsvdMaskSize: 0 [ 9.865] LinRsvdFieldPosition: 0 [ 9.865] MaxPixelClock: 400000000 [ 9.868] *Mode: 146 (1400x1050) [ 9.868] ModeAttributes: 0xbb [ 9.868] WinAAttributes: 0x7 [ 9.868] WinBAttributes: 0x0 [ 9.868] WinGranularity: 64 [ 9.868] WinSize: 64 [ 9.868] WinASegment: 0xa000 [ 9.868] WinBSegment: 0x0 [ 9.868] WinFuncPtr: 0xc0004c39 [ 9.868] BytesPerScanline: 5632 [ 9.868] XResolution: 1400 [ 9.868] YResolution: 1050 [ 9.868] XCharSize: 8 [ 9.868] YCharSize: 16 [ 9.868] NumberOfPlanes: 1 [ 9.868] BitsPerPixel: 32 [ 9.868] NumberOfBanks: 1 [ 9.868] MemoryModel: 6 [ 9.868] BankSize: 0 [ 9.868] NumberOfImages: 7 [ 9.868] RedMaskSize: 8 [ 9.868] RedFieldPosition: 16 [ 9.868] GreenMaskSize: 8 [ 9.868] GreenFieldPosition: 8 [ 9.868] BlueMaskSize: 8 [ 9.868] BlueFieldPosition: 0 [ 9.868] RsvdMaskSize: 0 [ 9.868] RsvdFieldPosition: 0 [ 9.868] DirectColorModeInfo: 0 [ 9.868] PhysBasePtr: 0xb0000000 [ 9.868] LinBytesPerScanLine: 5632 [ 9.868] BnkNumberOfImagePages: 7 [ 9.868] LinNumberOfImagePages: 7 [ 9.868] LinRedMaskSize: 8 [ 9.868] LinRedFieldPosition: 16 [ 9.868] LinGreenMaskSize: 8 [ 9.868] LinGreenFieldPosition: 8 [ 9.868] LinBlueMaskSize: 8 [ 9.868] LinBlueFieldPosition: 0 [ 9.868] LinRsvdMaskSize: 0 [ 9.868] LinRsvdFieldPosition: 0 [ 9.868] MaxPixelClock: 400000000 [ 9.871] Mode: 175 (1600x1200) [ 9.871] ModeAttributes: 0xba [ 9.871] WinAAttributes: 0x7 [ 9.871] WinBAttributes: 0x0 [ 9.871] WinGranularity: 64 [ 9.871] WinSize: 64 [ 9.871] WinASegment: 0xa000 [ 9.871] WinBSegment: 0x0 [ 9.871] WinFuncPtr: 0xc0004c39 [ 9.871] BytesPerScanline: 3200 [ 9.871] XResolution: 1600 [ 9.871] YResolution: 1200 [ 9.871] XCharSize: 8 [ 9.871] YCharSize: 16 [ 9.871] NumberOfPlanes: 1 [ 9.871] BitsPerPixel: 16 [ 9.871] NumberOfBanks: 1 [ 9.871] MemoryModel: 6 [ 9.871] BankSize: 0 [ 9.871] NumberOfImages: 12 [ 9.871] RedMaskSize: 5 [ 9.871] RedFieldPosition: 11 [ 9.871] GreenMaskSize: 6 [ 9.871] GreenFieldPosition: 5 [ 9.871] BlueMaskSize: 5 [ 9.871] BlueFieldPosition: 0 [ 9.871] RsvdMaskSize: 0 [ 9.871] RsvdFieldPosition: 0 [ 9.871] DirectColorModeInfo: 0 [ 9.871] PhysBasePtr: 0xb0000000 [ 9.871] LinBytesPerScanLine: 3200 [ 9.871] BnkNumberOfImagePages: 12 [ 9.871] LinNumberOfImagePages: 12 [ 9.871] LinRedMaskSize: 5 [ 9.871] LinRedFieldPosition: 11 [ 9.871] LinGreenMaskSize: 6 [ 9.871] LinGreenFieldPosition: 5 [ 9.871] LinBlueMaskSize: 5 [ 9.871] LinBlueFieldPosition: 0 [ 9.871] LinRsvdMaskSize: 0 [ 9.871] LinRsvdFieldPosition: 0 [ 9.871] MaxPixelClock: 400000000 [ 9.873] Mode: 176 (1600x1200) [ 9.873] ModeAttributes: 0xba [ 9.873] WinAAttributes: 0x7 [ 9.873] WinBAttributes: 0x0 [ 9.873] WinGranularity: 64 [ 9.873] WinSize: 64 [ 9.873] WinASegment: 0xa000 [ 9.873] WinBSegment: 0x0 [ 9.873] WinFuncPtr: 0xc0004c39 [ 9.873] BytesPerScanline: 6400 [ 9.873] XResolution: 1600 [ 9.873] YResolution: 1200 [ 9.873] XCharSize: 8 [ 9.873] YCharSize: 16 [ 9.873] NumberOfPlanes: 1 [ 9.873] BitsPerPixel: 32 [ 9.873] NumberOfBanks: 1 [ 9.873] MemoryModel: 6 [ 9.873] BankSize: 0 [ 9.873] NumberOfImages: 5 [ 9.873] RedMaskSize: 8 [ 9.873] RedFieldPosition: 16 [ 9.873] GreenMaskSize: 8 [ 9.873] GreenFieldPosition: 8 [ 9.873] BlueMaskSize: 8 [ 9.873] BlueFieldPosition: 0 [ 9.873] RsvdMaskSize: 0 [ 9.873] RsvdFieldPosition: 0 [ 9.873] DirectColorModeInfo: 0 [ 9.873] PhysBasePtr: 0xb0000000 [ 9.873] LinBytesPerScanLine: 6400 [ 9.873] BnkNumberOfImagePages: 5 [ 9.874] LinNumberOfImagePages: 5 [ 9.874] LinRedMaskSize: 8 [ 9.874] LinRedFieldPosition: 16 [ 9.874] LinGreenMaskSize: 8 [ 9.874] LinGreenFieldPosition: 8 [ 9.874] LinBlueMaskSize: 8 [ 9.874] LinBlueFieldPosition: 0 [ 9.874] LinRsvdMaskSize: 0 [ 9.874] LinRsvdFieldPosition: 0 [ 9.874] MaxPixelClock: 400000000 [ 9.877] Mode: 1d2 (1920x1080) [ 9.877] ModeAttributes: 0xbb [ 9.877] WinAAttributes: 0x7 [ 9.877] WinBAttributes: 0x0 [ 9.877] WinGranularity: 64 [ 9.877] WinSize: 64 [ 9.877] WinASegment: 0xa000 [ 9.877] WinBSegment: 0x0 [ 9.877] WinFuncPtr: 0xc0004c39 [ 9.877] BytesPerScanline: 3840 [ 9.877] XResolution: 1920 [ 9.877] YResolution: 1080 [ 9.877] XCharSize: 8 [ 9.877] YCharSize: 16 [ 9.877] NumberOfPlanes: 1 [ 9.877] BitsPerPixel: 16 [ 9.877] NumberOfBanks: 1 [ 9.877] MemoryModel: 6 [ 9.877] BankSize: 0 [ 9.877] NumberOfImages: 11 [ 9.877] RedMaskSize: 5 [ 9.877] RedFieldPosition: 11 [ 9.877] GreenMaskSize: 6 [ 9.877] GreenFieldPosition: 5 [ 9.877] BlueMaskSize: 5 [ 9.877] BlueFieldPosition: 0 [ 9.877] RsvdMaskSize: 0 [ 9.877] RsvdFieldPosition: 0 [ 9.877] DirectColorModeInfo: 0 [ 9.877] PhysBasePtr: 0xb0000000 [ 9.877] LinBytesPerScanLine: 3840 [ 9.877] BnkNumberOfImagePages: 11 [ 9.877] LinNumberOfImagePages: 11 [ 9.877] LinRedMaskSize: 5 [ 9.877] LinRedFieldPosition: 11 [ 9.877] LinGreenMaskSize: 6 [ 9.877] LinGreenFieldPosition: 5 [ 9.877] LinBlueMaskSize: 5 [ 9.877] LinBlueFieldPosition: 0 [ 9.877] LinRsvdMaskSize: 0 [ 9.877] LinRsvdFieldPosition: 0 [ 9.877] MaxPixelClock: 400000000 [ 9.880] *Mode: 1d4 (1920x1080) [ 9.880] ModeAttributes: 0xbb [ 9.880] WinAAttributes: 0x7 [ 9.880] WinBAttributes: 0x0 [ 9.880] WinGranularity: 64 [ 9.880] WinSize: 64 [ 9.880] WinASegment: 0xa000 [ 9.880] WinBSegment: 0x0 [ 9.880] WinFuncPtr: 0xc0004c39 [ 9.880] BytesPerScanline: 7680 [ 9.880] XResolution: 1920 [ 9.880] YResolution: 1080 [ 9.880] XCharSize: 8 [ 9.880] YCharSize: 16 [ 9.880] NumberOfPlanes: 1 [ 9.880] BitsPerPixel: 32 [ 9.880] NumberOfBanks: 1 [ 9.880] MemoryModel: 6 [ 9.880] BankSize: 0 [ 9.880] NumberOfImages: 5 [ 9.880] RedMaskSize: 8 [ 9.880] RedFieldPosition: 16 [ 9.881] GreenMaskSize: 8 [ 9.881] GreenFieldPosition: 8 [ 9.881] BlueMaskSize: 8 [ 9.881] BlueFieldPosition: 0 [ 9.881] RsvdMaskSize: 0 [ 9.881] RsvdFieldPosition: 0 [ 9.881] DirectColorModeInfo: 0 [ 9.881] PhysBasePtr: 0xb0000000 [ 9.881] LinBytesPerScanLine: 7680 [ 9.881] BnkNumberOfImagePages: 5 [ 9.881] LinNumberOfImagePages: 5 [ 9.881] LinRedMaskSize: 8 [ 9.881] LinRedFieldPosition: 16 [ 9.881] LinGreenMaskSize: 8 [ 9.881] LinGreenFieldPosition: 8 [ 9.881] LinBlueMaskSize: 8 [ 9.881] LinBlueFieldPosition: 0 [ 9.881] LinRsvdMaskSize: 0 [ 9.881] LinRsvdFieldPosition: 0 [ 9.881] MaxPixelClock: 400000000 [ 9.881]=20 [ 9.881] (II) VESA(0): Total Memory: 768 64KB banks (49152kB) [ 9.881] (II) VESA(0): : Using hsync value of 67.93 kHz [ 9.881] (II) VESA(0): : Using vrefresh value of 60.01= Hz [ 9.881] (WW) VESA(0): Unable to estimate virtual size [ 9.881] (II) VESA(0): Not using built-in mode "1400x1050" (no mode of = this name) [ 9.881] (II) VESA(0): Not using built-in mode "1280x1024" (no mode of = this name) [ 9.881] (II) VESA(0): Not using built-in mode "1280x960" (no mode of t= his name) [ 9.881] (II) VESA(0): Not using built-in mode "1024x768" (no mode of t= his name) [ 9.881] (II) VESA(0): Not using built-in mode "800x600" (no mode of th= is name) [ 9.881] (II) VESA(0): Not using built-in mode "640x480" (no mode of th= is name) [ 9.881] (II) VESA(0): Virtual size is 1920x1080 (pitch 1920) [ 9.881] (**) VESA(0): *Built-in mode "1920x1080" [ 9.881] (**) VESA(0): Display dimensions: (310, 170) mm [ 9.881] (**) VESA(0): DPI set to (157, 161) [ 9.881] (**) VESA(0): Using "Shadow Framebuffer" [ 9.881] (II) Loading sub module "shadow" [ 9.881] (II) LoadModule: "shadow" [ 9.881] (II) Loading /usr/local/lib/xorg/modules/libshadow.so [ 9.881] (II) Module shadow: vendor=3D"X.Org Foundation" [ 9.881] compiled for 1.20.8, module version =3D 1.1.0 [ 9.881] ABI class: X.Org ANSI C Emulation, version 0.4 [ 9.881] (II) Loading sub module "fb" [ 9.881] (II) LoadModule: "fb" [ 9.882] (II) Loading /usr/local/lib/xorg/modules/libfb.so [ 9.882] (II) Module fb: vendor=3D"X.Org Foundation" [ 9.882] compiled for 1.20.8, module version =3D 1.0.0 [ 9.882] ABI class: X.Org ANSI C Emulation, version 0.4 [ 9.883] (II) UnloadModule: "scfb" [ 9.883] (II) Unloading scfb [ 9.883] (II) Loading sub module "int10" [ 9.883] (II) LoadModule: "int10" [ 9.883] (II) Loading /usr/local/lib/xorg/modules/libint10.so [ 9.883] (II) Module int10: vendor=3D"X.Org Foundation" [ 9.883] compiled for 1.20.8, module version =3D 1.0.0 [ 9.883] ABI class: X.Org Video Driver, version 24.1 [ 9.883] (II) VESA(0): initializing int10 [ 9.883] (II) VESA(0): Primary V_BIOS segment is: 0xc000 [ 9.883] (II) VESA(0): VESA BIOS detected [ 9.883] (II) VESA(0): VESA VBE Version 3.0 [ 9.883] (II) VESA(0): VESA VBE Total Mem: 49152 kB [ 9.883] (II) VESA(0): VESA VBE OEM: AMD ATOMBIOS [ 9.883] (II) VESA(0): VESA VBE OEM Software Rev: 16.2 [ 9.883] (II) VESA(0): VESA VBE OEM Vendor: (C) 1988-2010, Advanced Mic= ro Devices, Inc. [ 9.883] (II) VESA(0): VESA VBE OEM Product: RAVEN2 [ 9.883] (II) VESA(0): VESA VBE OEM Product Rev: 01.00 [ 9.886] (II) VESA(0): virtual address =3D 0x801c00000, VGAbase =3D 0x8= 01bdb000 physical address =3D 0xb0000000, size =3D 50331648 [ 9.887] (II) VESA(0): Setting up VESA Mode 0x1D4 (1920x1080) [ 9.887] (II) VESA(0): VBESetVBEMode failed, mode set without customize= d refresh. [ 10.071] (=3D=3D) VESA(0): Default visual is TrueColor [ 10.073] (=3D=3D) VESA(0): Backing store enabled [ 10.073] (=3D=3D) VESA(0): DPMS enabled [ 10.073] (II) Initializing extension Generic Event Extension [ 10.073] (II) Initializing extension SHAPE [ 10.073] (II) Initializing extension MIT-SHM [ 10.074] (II) Initializing extension XInputExtension [ 10.074] (II) Initializing extension XTEST [ 10.075] (II) Initializing extension BIG-REQUESTS [ 10.075] (II) Initializing extension SYNC [ 10.075] (II) Initializing extension XKEYBOARD [ 10.075] (II) Initializing extension XC-MISC [ 10.075] (II) Initializing extension SECURITY [ 10.076] (II) Initializing extension XFIXES [ 10.076] (II) Initializing extension RENDER [ 10.076] (II) Initializing extension RANDR [ 10.076] (II) Initializing extension COMPOSITE [ 10.077] (II) Initializing extension DAMAGE [ 10.077] (II) Initializing extension MIT-SCREEN-SAVER [ 10.077] (II) Initializing extension DOUBLE-BUFFER [ 10.077] (II) Initializing extension RECORD [ 10.077] (II) Initializing extension DPMS [ 10.077] (II) Initializing extension Present [ 10.078] (II) Initializing extension DRI3 [ 10.078] (II) Initializing extension X-Resource [ 10.078] (II) Initializing extension XVideo [ 10.078] (II) Initializing extension XVideo-MotionCompensation [ 10.078] (II) Initializing extension GLX [ 10.078] (II) AIGLX: Screen 0 is not DRI2 capable [ 10.299] (II) IGLX: Loaded and initialized swrast [ 10.299] (II) GLX: Initialized DRISWRAST GL provider for screen 0 [ 10.299] (II) Initializing extension XFree86-VidModeExtension [ 10.299] (II) Initializing extension XFree86-DGA [ 10.299] (II) Initializing extension XFree86-DRI [ 10.299] (II) Initializing extension DRI2 [ 10.379] (II) config/udev: Adding input device System keyboard multiple= xer (/dev/input/event0) [ 10.379] (**) System keyboard multiplexer: Applying InputClass "Evdev k= eyboard" [ 10.379] (**) System keyboard multiplexer: Applying InputClass "libinpu= t keyboard catchall" [ 10.379] (II) LoadModule: "libinput" [ 10.379] (II) Loading /usr/local/lib/xorg/modules/input/libinput_drv.so [ 10.386] (II) Module libinput: vendor=3D"X.Org Foundation" [ 10.386] compiled for 1.20.8, module version =3D 0.30.0 [ 10.386] Module class: X.Org XInput Driver [ 10.386] ABI class: X.Org XInput driver, version 24.1 [ 10.386] (II) Using input driver 'libinput' for 'System keyboard multip= lexer' [ 10.386] (**) System keyboard multiplexer: always reports core events [ 10.386] (**) Option "Device" "/dev/input/event0" [ 10.387] (**) Option "_source" "server/udev" [ 10.396] (II) event0 - System keyboard multiplexer: is tagged by udev = as: Keyboard [ 10.396] (II) event0 - System keyboard multiplexer: device is a keyboa= rd [ 10.396] (II) event0 - System keyboard multiplexer: device removed [ 10.396] (**) Option "config_info" "udev:/dev/input/event0" [ 10.396] (II) XINPUT: Adding extended input device "System keyboard mul= tiplexer" (type: KEYBOARD, id 6) [ 10.396] (**) Option "xkb_rules" "evdev" [ 10.421] (II) event0 - System keyboard multiplexer: is tagged by udev = as: Keyboard [ 10.422] (II) event0 - System keyboard multiplexer: device is a keyboa= rd [ 10.422] (II) config/udev: Adding input device System mouse (/dev/input= /event1) [ 10.422] (**) System mouse: Applying InputClass "libinput pointer catch= all" [ 10.422] (II) Using input driver 'libinput' for 'System mouse' [ 10.422] (**) System mouse: always reports core events [ 10.422] (**) Option "Device" "/dev/input/event1" [ 10.422] (**) Option "_source" "server/udev" [ 10.423] (II) event1 - System mouse: is tagged by udev as: Mouse [ 10.423] (II) event1 - System mouse: device is a pointer [ 10.423] (II) event1 - System mouse: device removed [ 10.423] (**) Option "config_info" "udev:/dev/input/event1" [ 10.423] (II) XINPUT: Adding extended input device "System mouse" (type= : MOUSE, id 7) [ 10.423] (**) Option "AccelerationScheme" "none" [ 10.423] (**) System mouse: (accel) selected scheme none/0 [ 10.423] (**) System mouse: (accel) acceleration factor: 2.000 [ 10.423] (**) System mouse: (accel) acceleration threshold: 4 [ 10.424] (II) event1 - System mouse: is tagged by udev as: Mouse [ 10.424] (II) event1 - System mouse: device is a pointer [ 10.424] (II) config/udev: Adding input device AT keyboard (/dev/input/= event2) [ 10.424] (**) AT keyboard: Applying InputClass "Evdev keyboard" [ 10.424] (**) AT keyboard: Applying InputClass "libinput keyboard catch= all" [ 10.424] (II) Using input driver 'libinput' for 'AT keyboard' [ 10.425] (**) AT keyboard: always reports core events [ 10.425] (**) Option "Device" "/dev/input/event2" [ 10.425] (**) Option "_source" "server/udev" [ 10.425] (II) event2 - AT keyboard: is tagged by udev as: Keyboard [ 10.425] (II) event2 - AT keyboard: device is a keyboard [ 10.425] (II) event2 - AT keyboard: device removed [ 10.425] (**) Option "config_info" "udev:/dev/input/event2" [ 10.425] (II) XINPUT: Adding extended input device "AT keyboard" (type:= KEYBOARD, id 8) [ 10.425] (**) Option "xkb_rules" "evdev" [ 10.426] (II) event2 - AT keyboard: is tagged by udev as: Keyboard [ 10.426] (II) event2 - AT keyboard: device is a keyboard [ 10.427] (II) config/udev: Adding input device ELAN469D:08 04F3:304B Mo= use (/dev/input/event3) [ 10.427] (**) ELAN469D:08 04F3:304B Mouse: Applying InputClass "libinpu= t pointer catchall" [ 10.427] (II) Using input driver 'libinput' for 'ELAN469D:08 04F3:304B = Mouse' [ 10.427] (**) ELAN469D:08 04F3:304B Mouse: always reports core events [ 10.427] (**) Option "Device" "/dev/input/event3" [ 10.427] (**) Option "_source" "server/udev" [ 10.427] (II) event3 - ELAN469D:08 04F3:304B Mouse: is tagged by udev = as: Mouse [ 10.428] (II) event3 - ELAN469D:08 04F3:304B Mouse: device is a pointer [ 10.428] (II) event3 - ELAN469D:08 04F3:304B Mouse: device removed [ 10.428] (**) Option "config_info" "udev:/dev/input/event3" [ 10.428] (II) XINPUT: Adding extended input device "ELAN469D:08 04F3:30= 4B Mouse" (type: MOUSE, id 9) [ 10.428] (**) Option "AccelerationScheme" "none" [ 10.428] (**) ELAN469D:08 04F3:304B Mouse: (accel) selected scheme none= /0 [ 10.428] (**) ELAN469D:08 04F3:304B Mouse: (accel) acceleration factor:= 2.000 [ 10.428] (**) ELAN469D:08 04F3:304B Mouse: (accel) acceleration thresho= ld: 4 [ 10.429] (II) event3 - ELAN469D:08 04F3:304B Mouse: is tagged by udev = as: Mouse [ 10.429] (II) event3 - ELAN469D:08 04F3:304B Mouse: device is a pointer [ 10.429] (II) config/udev: Adding input device ELAN469D:08 04F3:304B To= uchPad (/dev/input/event4) [ 10.429] (**) ELAN469D:08 04F3:304B TouchPad: Applying InputClass "libi= nput pointer catchall" [ 10.429] (**) ELAN469D:08 04F3:304B TouchPad: Applying InputClass "libi= nput touchpad catchall" [ 10.429] (**) ELAN469D:08 04F3:304B TouchPad: Applying InputClass "touc= hpad catchall" [ 10.430] (**) ELAN469D:08 04F3:304B TouchPad: Applying InputClass "Defa= ult clickpad buttons" [ 10.430] (II) LoadModule: "synaptics" [ 10.430] (II) Loading /usr/local/lib/xorg/modules/input/synaptics_drv.so [ 10.431] (II) Module synaptics: vendor=3D"X.Org Foundation" [ 10.431] compiled for 1.20.8, module version =3D 1.9.1 [ 10.431] Module class: X.Org XInput Driver [ 10.431] ABI class: X.Org XInput driver, version 24.1 [ 10.431] (II) Using input driver 'synaptics' for 'ELAN469D:08 04F3:304B= TouchPad' [ 10.431] (**) ELAN469D:08 04F3:304B TouchPad: always reports core events [ 10.431] (**) Option "Device" "/dev/input/event4" [ 10.431] (II) synaptics: ELAN469D:08 04F3:304B TouchPad: found clickpad= property [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: x-axis range 0= - 3209 (res 31) [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: y-axis range 0= - 2097 (res 31) [ 10.431] (II) synaptics: ELAN469D:08 04F3:304B TouchPad: device does no= t report pressure, will use touch data. [ 10.431] (II) synaptics: ELAN469D:08 04F3:304B TouchPad: device does no= t report finger width. [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: buttons: left = double triple [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: Vendor 0x4f3 P= roduct 0x304b [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: invalid pressu= re range. defaulting to 0 - 255 [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: invalid finger= width range. defaulting to 0 - 15 [ 10.431] (**) Option "SoftButtonAreas" "50% 0 82% 0 0 0 0 0" [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: touchpad found [ 10.431] (**) ELAN469D:08 04F3:304B TouchPad: always reports core events [ 10.431] (**) Option "config_info" "udev:/dev/input/event4" [ 10.431] (II) XINPUT: Adding extended input device "ELAN469D:08 04F3:30= 4B TouchPad" (type: TOUCHPAD, id 10) [ 10.431] (**) synaptics: ELAN469D:08 04F3:304B TouchPad: (accel) MinSpe= ed is now constant deceleration 2.5 [ 10.431] (**) synaptics: ELAN469D:08 04F3:304B TouchPad: (accel) MaxSpe= ed is now 1.75 [ 10.431] (**) synaptics: ELAN469D:08 04F3:304B TouchPad: (accel) AccelF= actor is now 0.052 [ 10.431] (**) ELAN469D:08 04F3:304B TouchPad: (accel) keeping accelerat= ion scheme 1 [ 10.431] (**) ELAN469D:08 04F3:304B TouchPad: (accel) acceleration prof= ile 1 [ 10.431] (**) ELAN469D:08 04F3:304B TouchPad: (accel) acceleration fact= or: 2.000 [ 10.431] (**) ELAN469D:08 04F3:304B TouchPad: (accel) acceleration thre= shold: 4 [ 10.431] (--) synaptics: ELAN469D:08 04F3:304B TouchPad: touchpad found [ 10.431] (II) config/udev: Adding input device Logitech USB Optical Mou= se (/dev/input/event5) [ 10.431] (**) Logitech USB Optical Mouse: Applying InputClass "libinput= pointer catchall" [ 10.431] (II) Using input driver 'libinput' for 'Logitech USB Optical M= ouse' [ 10.431] (**) Logitech USB Optical Mouse: always reports core events [ 10.431] (**) Option "Device" "/dev/input/event5" [ 10.431] (**) Option "_source" "server/udev" [ 10.432] (II) event5 - Logitech USB Optical Mouse, class 0/0, rev 2.00= /54.00, addr 1: is tagged by udev as: Mouse [ 10.432] (II) event5 - Logitech USB Optical Mouse, class 0/0, rev 2.00= /54.00, addr 1: device is a pointer [ 10.432] (II) event5 - Logitech USB Optical Mouse, class 0/0, rev 2.00= /54.00, addr 1: device removed [ 10.432] (**) Option "config_info" "udev:/dev/input/event5" [ 10.432] (II) XINPUT: Adding extended input device "Logitech USB Optica= l Mouse" (type: MOUSE, id 11) [ 10.433] (**) Option "AccelerationScheme" "none" [ 10.433] (**) Logitech USB Optical Mouse: (accel) selected scheme none/0 [ 10.433] (**) Logitech USB Optical Mouse: (accel) acceleration factor: = 2.000 [ 10.433] (**) Logitech USB Optical Mouse: (accel) acceleration threshol= d: 4 [ 10.433] (II) event5 - Logitech USB Optical Mouse, class 0/0, rev 2.00= /54.00, addr 1: is tagged by udev as: Mouse [ 10.433] (II) event5 - Logitech USB Optical Mouse, class 0/0, rev 2.00= /54.00, addr 1: device is a pointer --yvKPtJ8e/9/fHVzf-- --7eONtfCMZgtK0KXg Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iHUEARYKAB0WIQRJJMXN6/nibGTfWk0+WR6AK2efSAUCX+spBwAKCRA+WR6AK2ef SP5lAP4oHLNq1JHszMH7lBqUSpgUv3uv8s8XcuftNTJyGn6/NAEAz+X5YQg0xyH5 m4MBnM+Ca/kNyFRYcEyF2bLDUmTaxA8= =u5oL -----END PGP SIGNATURE----- --7eONtfCMZgtK0KXg-- From owner-freebsd-questions@freebsd.org Tue Dec 29 13:14:20 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 65C7E4BE3B4 for ; Tue, 29 Dec 2020 13:14:20 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: from mail-ot1-x331.google.com (mail-ot1-x331.google.com [IPv6:2607:f8b0:4864:20::331]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4vyM4mvpz4XpG for ; Tue, 29 Dec 2020 13:14:19 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: by mail-ot1-x331.google.com with SMTP id j12so11762068ota.7 for ; Tue, 29 Dec 2020 05:14:19 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=h0JrSgOrqFIimO4N680xfeEWf1IZsRvghX/zRRAbC60=; b=uzvOvqcHwBZvZPrihQQ1PQpEDirZpzu30bOU5rTsFNfb/Pyin3sdhZKV7SxFUl+Gtw O0Zs8HTcDOPk60lYgSiq1MN/Om5atp5u5xQ3segDwZk79hK+IQjGV/9TtwlZWw8hGgpq 1hhNYdBi14YqCL70RPtLPJONYpNNfCAd3XkbXanhb8NEcmMNFfWiSH3Lm6ctoHAMpBzl rXtj9YsLuoYQFwe47ZxU/leS9ABewPnq88z1OvtLyTFtv4nHydLz4spLs4CMwO5X2ocl WXOFtMLy00M1SJI9r/rSVqNtl5SIelkJm5gT/whvlvMD8YfZ/ufUfojSCtK832j+gjoD ED6A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=h0JrSgOrqFIimO4N680xfeEWf1IZsRvghX/zRRAbC60=; b=R9Di52xfKypLi4ncjeyXPViVkoe9XYWTFFGv6utpAvPupZY0hp21v/HdUrBnwAEEP6 lenLglh9fh4Ni+MKC8orXyeHijfNSFiDOzfj+g8gCtD+l2fWqMtXknvgTqmqzLvQwCso xVrfGf8YScW5LC48FkacfAkTbAQqQh55F/d//UoZnWX8CVg7yQ7zPdZyQByXOSyFO/Uq tCMN7Dat3uI2vXrRKgsIZlt4xF0Q2zHryfrVspwiUZ5upEOVSk4c6Eh9EmLIK7H/+/Id 5CyIASUoLsXoML3U18SHi0gCOvnQyuc37LWIG5QqhZrvH4LFdsH2Zbxttnb7ADgF8qSX Li9A== X-Gm-Message-State: AOAM532LE9B+8Aat2xajyc2DIDchBbWZB5SgreZJEN4zQJDzZ69uKq1j daGkVeDk5woqbE6KgE1CFur3N7X2qFOydLahPu4= X-Google-Smtp-Source: ABdhPJyVljYXIclk9In6U8kAFuo/UI8J2bVcNRV5BSZKuXLyX9V3AuI869vBEOAWk1rjSnLMs85vc6osBZY0jmOkMps= X-Received: by 2002:a05:6830:1e0c:: with SMTP id s12mr35120519otr.152.1609247658556; Tue, 29 Dec 2020 05:14:18 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Vasily Postnicov Date: Tue, 29 Dec 2020 16:14:07 +0300 Message-ID: Subject: Re: graphics on amd radeon vega To: Oskar Sharipov Cc: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4D4vyM4mvpz4XpG X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=uzvOvqcH; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of shamazmazum@gmail.com designates 2607:f8b0:4864:20::331 as permitted sender) smtp.mailfrom=shamazmazum@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::331:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::331:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::331:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 13:14:20 -0000 The interesting part of dmesg seems to be truncated: > [drm] radeon kernel modesetting enabled. > acpi_video0: on vgapci0 > > ... General hint: do not forget to add your user to the group called "video" (this is not relevant to driver loading, but you will not be able to use /dev/dri/* devices without this step). Also, for FreeBSD 12 with EFI bootloader add the following line to /boot/loader.conf: hw.syscons.disable=3D"1" and this line in /etc/rc.conf: kld_list=3D"amdgpu" Warning! That line in /boot/loader.conf will disable your console driver (vt(4) that is), so you will see garbage on your display until AMD driver is loaded. So check if amdgpu driver detects your card first (with kldload amdgpu). =D0=B2=D1=82, 29 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3. =D0=B2 15:56, Oskar Shari= pov : > Hello! > > I'm using FreeBSD 12.1-RELEASE-p10 (amd64) on Lenovo S340. There is an > AMD Ryzen CPU with Radeon Vega Mobile Gfx as it's printed in dmesg. > > The problem is I cannot use amdgpu drivers. I built them from ports, I > wrote kld_list=3D"/boot/modules/amdgpu.ko" in /etc/rc.conf, I added mysel= f > in "video" group. When I boot the laptop I can notice interface is > laggy. Video in mpv is lagging, switching windows in wm is lagging and > so on. > > I checked glxheads information, it prints GL_RENDERER is "llvmpipe". As > I understand it means X11 uses default llvm drivers. > > I checked Xorg.0.logs, there are these lines: > > ... > [ 9.738] (EE) open /dev/dri/card0: No such file or directory > [ 9.738] (WW) Falling back to old probe method for modesettin= g > [ 9.738] (EE) open /dev/dri/card0: No such file or directory > [ 9.738] (WW) Falling back to old probe method for scfb > ... > > which also shows something is wrong with loading drivers, as I > understand. > > Experimenting I ended up with radeonkms module in rc.conf but I see > no difference, everything is the same with radeon and amdgpu drivers. > > I attached graphics_on_vega.tar.gz archive which contains: > > graphics_on_vega/devinfo that's `devinfo -vr` output > graphics_on_vega/dmesg that's `dmesg` output > graphics_on_vega/hw.model that's `sysctl hw.model` output > graphics_on_vega/pciconf that's `pciconf -lvbce` output > graphics_on_vega/pkg_info that's `pkg info` output > graphics_on_vega/Xorg.0.log that's `cat /var/log/Xorg.0.log` > output > > Is it a problem with my understandings how to set up drivers, with Radeon > Vega GPUs or with drivers themselves? Should I file a bug report to > freebsd-x11@freebsd.org? > > -- > Oskar Sharipov > site (might be unpaid and cancelled): oskarsh.ru > e-mail (replace asterisk with dot): oskarsh at riseup * net > secondary e-mail (same): oskar * sharipov at tutanota * org > gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 > From owner-freebsd-questions@freebsd.org Tue Dec 29 13:28:37 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 35CF74BE976 for ; Tue, 29 Dec 2020 13:28:37 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4wGr4GVZz4YtF for ; Tue, 29 Dec 2020 13:28:36 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from bell.riseup.net (bell-pn.riseup.net [10.0.1.178]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4D4wGl59wYzFcJj for ; Tue, 29 Dec 2020 05:28:31 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1609248511; bh=uRWjYPbHyWyDVfBGqWrqYBGC9x4P+T4AJFpMHEjbITU=; h=Date:From:To:Subject:References:In-Reply-To:From; b=PT/EKxTvf+zOJf9zSDr2nUC0+XsfJxg7+15DIJd/Gxjqu+45Lgiy/mVYULglsfgpp ONWyIwnHxyjT9/2LV/LEY0en6Xdia8Rr6Y39LI1whpKqXsBvmA7wCkoWemU8NYU0yS nKIedNCkmY2loyUYmcn31YukKkNITirUiti9WI6Y= X-Riseup-User-ID: 6EA379A6C0D7323AE99B7B6E171AEF76A9177EE8CAEAC5CC80BA2D9A670BEB1A Received: from [127.0.0.1] (localhost [127.0.0.1]) by bell.riseup.net (Postfix) with ESMTPSA id 4D4wGk3xstzJmnS for ; Tue, 29 Dec 2020 05:28:30 -0800 (PST) Date: Tue, 29 Dec 2020 16:28:20 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: Re: graphics on amd radeon vega Message-ID: References: MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="PfMNkUu6w7uqAwHs" Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4D4wGr4GVZz4YtF X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=PT/EKxTv; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of oskarsh@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=oskarsh@riseup.net X-Spamd-Result: default: False [-6.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; HAS_ATTACHMENT(0.00)[]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:+,4:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,multipart/mixed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 13:28:37 -0000 --PfMNkUu6w7uqAwHs Content-Type: multipart/mixed; protected-headers=v1; boundary="i4+hXSD0MH+kUt2u" Content-Disposition: inline Date: Tue, 29 Dec 2020 16:28:20 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: Re: graphics on amd radeon vega --i4+hXSD0MH+kUt2u Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Tue, Dec 29, 2020 at 04:14:07PM +0300, Vasily Postnicov wrote: > The interesting part of dmesg seems to be truncated: >=20 > > [drm] radeon kernel modesetting enabled. > > acpi_video0: on vgapci0 > > > > ... Yep, my fault. Wanted to not show everything that dmesg prints. > General hint: do not forget to add your user to the group called "video" > (this is not relevant to driver loading, but you will not be able to use > /dev/dri/* devices without this step). Also, for FreeBSD 12 with EFI > bootloader add the following line to /boot/loader.conf: > hw.syscons.disable=3D"1" The user is in "video" group, it's shown by `groups username`. hw.syscons.disable=3D"1" is in /boot/loader.conf as well. > and this line in /etc/rc.conf: > kld_list=3D"amdgpu" Set it right now and rebooted. Nothing changed. I'm attaching dmesg again. Note: I rebooted PC a minute ago. --=20 Oskar Sharipov site (might be unpaid and cancelled): oskarsh.ru e-mail (replace asterisk with dot): oskarsh at riseup * net secondary e-mail (same): oskar * sharipov at tutanota * org gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 --i4+hXSD0MH+kUt2u Content-Type: text/plain; charset=us-ascii Content-Disposition: attachment; filename=dmesg Content-Transfer-Encoding: quoted-printable ---<>--- Copyright (c) 1992-2019 The FreeBSD Project. Copyright (c) 1979, 1980, 1983, 1986, 1988, 1989, 1991, 1992, 1993, 1994 The Regents of the University of California. All rights reserved. FreeBSD is a registered trademark of The FreeBSD Foundation. FreeBSD 12.1-RELEASE-p10 GENERIC amd64 FreeBSD clang version 8.0.1 (tags/RELEASE_801/final 366581) (based on LLVM = 8.0.1) VT(vga): resolution 640x480 CPU: AMD Ryzen 3 3200U with Radeon Vega Mobile Gfx (2595.18-MHz K8-class = CPU) Origin=3D"AuthenticAMD" Id=3D0x810f81 Family=3D0x17 Model=3D0x18 Step= ping=3D1 Features=3D0x178bfbff Features2=3D0x7ed8320b AMD Features=3D0x2e500800 AMD Features2=3D0x35c233ff Structured Extended Features=3D0x209c01a9 XSAVE Features=3D0xf AMD Extended Feature Extensions ID EBX=3D0x1007 SVM: NP,NRIP,VClean,AFlush,DAssist,NAsids=3D32768 TSC: P-state invariant, performance statistics real memory =3D 8589934592 (8192 MB) avail memory =3D 6114369536 (5831 MB) Event timer "LAPIC" quality 600 ACPI APIC Table: FreeBSD/SMP: Multiprocessor System Detected: 4 CPUs FreeBSD/SMP: 1 package(s) x 2 core(s) x 2 hardware threads random: unblocking device. ioapic0: Changing APIC ID to 33 ioapic1: Changing APIC ID to 34 ioapic0 irqs 0-23 on motherboard ioapic1 irqs 24-55 on motherboard Launching APs: 1 3 2 Timecounter "TSC-low" frequency 1297591399 Hz quality 1000 Cuse v0.1.36 @ /dev/cuse random: entropy device external interface kbd1 at kbdmux0 000.000024 [4335] netmap_init netmap: loaded module [ath_hal] loaded module_register_init: MOD_LOAD (vesa, 0xffffffff8112f0f0, 0) error 19 random: registering fast source Intel Secure Key RNG random: fast provider: "Intel Secure Key RNG" [ath_dfs] loaded [ath_rate] loaded [ar9300] loaded [ar5212] loaded [ar5416] loaded [ar5211] loaded [ar5210] loaded [ath] loaded nexus0 vtvga0: on motherboard cryptosoft0: on motherboard acpi0: on motherboard Firmware Error (ACPI): Could not resolve [\134_SB.PCI0.GPP2.BCM5], AE_NOT_F= OUND (20181213/dswload2-312) ACPI Error: AE_NOT_FOUND, During name lookup/catalog (20181213/psobject-372) acpi0: Power Button (fixed) cpu0: on acpi0 hpet0: iomem 0xfed00000-0xfed003ff irq 0,8 on = acpi0 Timecounter "HPET" frequency 14318180 Hz quality 950 Event timer "HPET" frequency 14318180 Hz quality 450 Event timer "HPET1" frequency 14318180 Hz quality 450 Event timer "HPET2" frequency 14318180 Hz quality 450 atrtc0: port 0x70-0x71 on acpi0 atrtc0: registered as a time-of-day clock, resolution 1.000000s Event timer "RTC" frequency 32768 Hz quality 0 attimer0: port 0x40-0x43 on acpi0 Timecounter "i8254" frequency 1193182 Hz quality 0 Event timer "i8254" frequency 1193182 Hz quality 100 Timecounter "ACPI-fast" frequency 3579545 Hz quality 900 acpi_timer0: <32-bit timer at 3.579545MHz> port 0x408-0x40b on acpi0 acpi_ec0: port 0x62,0x66 on acpi0 pcib0: port 0xcf8-0xcff on acpi0 pci0: on pcib0 pci0: at device 0.2 (no driver attached) pcib1: at device 1.2 on pci0 pci1: on pcib1 sdhci_pci0: mem 0xc0801000-0xc0801fff,0xc0800000-0xc08007f= f irq 28 at device 0.0 on pci1 sdhci_pci0: 1 slot(s) allocated pcib2: at device 1.3 on pci0 pci2: on pcib2 pci2: at device 0.0 (no driver attached) pcib3: at device 1.7 on pci0 pci3: on pcib3 nvme0: mem 0xc0700000-0xc0703fff irq 48 at device 0.0= on pci3 pcib4: irq 43 at device 8.1 on pci0 pci4: on pcib4 vgapci0: port 0x1000-0x10ff mem 0xb0000000-0xbffff= fff,0xc0000000-0xc01fffff,0xc0600000-0xc067ffff irq 52 at device 0.0 on pci4 vgapci0: Boot video device hdac0: mem 0xc06c8000-0xc06cbfff irq 53 at de= vice 0.1 on pci4 pci4: at device 0.2 (no driver attached) xhci0: mem 0xc0400000-0xc04fffff irq 55= at device 0.3 on pci4 xhci0: 64 bytes context size, 64-bit DMA xhci0: Unable to map MSI-X table=20 usbus0: waiting for BIOS to give up control xhci_interrupt: host controller halted usbus0 on xhci0 usbus0: 5.0Gbps Super Speed USB v3.0 pci4: at device 0.5 (no driver attached) hdac1: mem 0xc06c0000-0xc06c7fff irq 54 at de= vice 0.6 on pci4 isab0: at device 20.3 on pci0 isa0: on isab0 acpi_lid0: on acpi0 acpi_button0: on acpi0 ig4iic_acpi0: iomem 0xfedc4000-0xfedc4fff irq 1= 4 on acpi0 ig4iic_acpi0: controller error during attach-1 ig4iic_acpi1: iomem 0xfedc5000-0xfedc5fff irq 6= on acpi0 ig4iic_acpi2: iomem 0xfedc2000-0xfedc2fff irq 1= 0 on acpi0 ig4iic_acpi2: controller error during attach-1 ig4iic_acpi3: iomem 0xfedc3000-0xfedc3fff irq 1= 1 on acpi0 ig4iic_acpi3: controller error during attach-1 acpi_iichid0: on acpi0 atkbdc0: port 0x60,0x64 irq 1 on acpi0 atkbd0: irq 1 on atkbdc0 kbd0 at atkbd0 atkbd0: [GIANT-LOCKED] battery0: on acpi0 acpi_acad0: on acpi0 hwpstate0: on cpu0 ZFS filesystem version: 5 ZFS storage pool version: features support (5000) Timecounters tick every 1.000 msec ugen0.1: <0x1022 XHCI root HUB> at usbus0 uhub0: <0x1022 XHCI root HUB, class 9/0, rev 3.00/1.00, addr 1> on usbus0 nvd0: NVMe namespace nvd0: 122104MB (250069680 512 byte sectors) hdacc0: at cad 0 on hdac0 hdaa0: at nid 1 on hdacc0 pcm0: at nid 3 on hdaa0 hdacc1: at cad 0 on hdac1 hdaa1: at nid 1 on hdacc1 pcm1: at nid 20,33 and 18 on hdaa1 pcm2: at nid 25 on hdaa1 iicbus0: on ig4iic_acpi0 iicbus1: on ig4iic_acpi1 iichid0 at addr 0x15 on iicbus1 iichid0: on iicbus1 iichid0: Interrupt setup failed. Fallback to sampling hidbus0: on iichid0 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 iicbus2: on ig4iic_acpi2 iicbus3: on ig4iic_acpi3 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hms0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hms0: 33 buttons and [XYWH] coordinates ID=3D1 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hmt0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hconf0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hmt0: Multitouch touchpad with 0 external buttons, click-pad hmt0: 5 contacts with [C] properties. Report range [0:0] - [3209:2097] hidraw0: on hidbus0 Trying to mount root from zfs:zroot/ROOT/default []... Root mount waiting for: usbus0 uhub0: 10 ports with 10 removable, self powered ugen0.2: at usbus0 Root mount waiting for: usbus0 ugen0.3: at usbus0 Root mount waiting for: usbus0 ugen0.4: at usbus0 [drm] radeon kernel modesetting enabled. acpi_video0: on vgapci0 lo0: link state changed to UP intsmb0: at device 20.0 on pci0 smbus0: on intsmb0 ums0 on uhub0 ums0: on us= bus0 ums0: 8 buttons and [XYZT] coordinates ID=3D0 ubt0 on uhub0 ubt0: on= usbus0 WARNING: attempt to domain_add(bluetooth) after domainfinalize() WARNING: attempt to domain_add(netgraph) after domainfinalize() Security policy loaded: MAC/ntpd (mac_ntpd) ugen0.5: at usbus0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: 42:7b:8f:db:2b:8f ugen0.5: at usbus0 (disconnected) urndis0: at uhub0, port 3, addr 4 (disconnected) urndis0: detached ugen0.5: at usbus0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: 9a:e4:bd:ad:cb:51 ugen0.5: at usbus0 (disconnected) urndis0: at uhub0, port 3, addr 4 (disconnected) urndis0: detached ugen0.5: at usbus0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: 9a:e4:bd:ad:cb:51 ugen0.5: at usbus0 (disconnected) urndis0: at uhub0, port 3, addr 4 (disconnected) urndis0: detached ugen0.5: at usbus0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: b6:20:05:6e:67:65 ugen0.5: at usbus0 (disconnected) urndis0: at uhub0, port 3, addr 4 (disconnected) urndis0: detached ugen0.5: at usbus0 ugen0.5: at usbus0 (disconnected) ugen0.5: at usbus0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: b2:15:75:7f:0b:9a ugen0.5: at usbus0 (disconnected) urndis0: at uhub0, port 3, addr 4 (disconnected) urndis0: detached ugen0.5: at usbus0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: 7e:57:13:e9:a8:18 [drm] amdgpu kernel modesetting enabled. Waiting (max 60 seconds) for system process `vnlru' to stop... done Waiting (max 60 seconds) for system process `syncer' to stop...=20 Syncing disks, vnodes remaining... 0 0 0 0 done Waiting (max 60 seconds) for system thread `bufdaemon' to stop... done Waiting (max 60 seconds) for system thread `bufspacedaemon-0' to stop... do= ne Waiting (max 60 seconds) for system thread `bufspacedaemon-1' to stop... do= ne Waiting (max 60 seconds) for system thread `bufspacedaemon-2' to stop... do= ne All buffers synced. Uptime: 18h17m21s ---<>--- Copyright (c) 1992-2019 The FreeBSD Project. Copyright (c) 1979, 1980, 1983, 1986, 1988, 1989, 1991, 1992, 1993, 1994 The Regents of the University of California. All rights reserved. FreeBSD is a registered trademark of The FreeBSD Foundation. FreeBSD 12.1-RELEASE-p10 GENERIC amd64 FreeBSD clang version 8.0.1 (tags/RELEASE_801/final 366581) (based on LLVM = 8.0.1) VT(vga): resolution 640x480 CPU: AMD Ryzen 3 3200U with Radeon Vega Mobile Gfx (2595.18-MHz K8-class = CPU) Origin=3D"AuthenticAMD" Id=3D0x810f81 Family=3D0x17 Model=3D0x18 Step= ping=3D1 Features=3D0x178bfbff Features2=3D0x7ed8320b AMD Features=3D0x2e500800 AMD Features2=3D0x35c233ff Structured Extended Features=3D0x209c01a9 XSAVE Features=3D0xf AMD Extended Feature Extensions ID EBX=3D0x1007 SVM: NP,NRIP,VClean,AFlush,DAssist,NAsids=3D32768 TSC: P-state invariant, performance statistics real memory =3D 8589934592 (8192 MB) avail memory =3D 6114369536 (5831 MB) Event timer "LAPIC" quality 600 ACPI APIC Table: FreeBSD/SMP: Multiprocessor System Detected: 4 CPUs FreeBSD/SMP: 1 package(s) x 2 core(s) x 2 hardware threads random: unblocking device. ioapic0: Changing APIC ID to 33 ioapic1: Changing APIC ID to 34 ioapic0 irqs 0-23 on motherboard ioapic1 irqs 24-55 on motherboard Launching APs: 1 2 3 Timecounter "TSC-low" frequency 1297591113 Hz quality 1000 Cuse v0.1.36 @ /dev/cuse random: entropy device external interface kbd1 at kbdmux0 000.000024 [4335] netmap_init netmap: loaded module [ath_hal] loaded module_register_init: MOD_LOAD (vesa, 0xffffffff8112f0f0, 0) error 19 random: registering fast source Intel Secure Key RNG random: fast provider: "Intel Secure Key RNG" [ath_dfs] loaded [ath_rate] loaded [ar9300] loaded [ar5212] loaded [ar5416] loaded [ar5211] loaded [ar5210] loaded [ath] loaded nexus0 vtvga0: on motherboard cryptosoft0: on motherboard acpi0: on motherboard Firmware Error (ACPI): Could not resolve [\134_SB.PCI0.GPP2.BCM5], AE_NOT_F= OUND (20181213/dswload2-312) ACPI Error: AE_NOT_FOUND, During name lookup/catalog (20181213/psobject-372) acpi0: Power Button (fixed) cpu0: on acpi0 hpet0: iomem 0xfed00000-0xfed003ff irq 0,8 on = acpi0 Timecounter "HPET" frequency 14318180 Hz quality 950 Event timer "HPET" frequency 14318180 Hz quality 450 Event timer "HPET1" frequency 14318180 Hz quality 450 Event timer "HPET2" frequency 14318180 Hz quality 450 atrtc0: port 0x70-0x71 on acpi0 atrtc0: registered as a time-of-day clock, resolution 1.000000s Event timer "RTC" frequency 32768 Hz quality 0 attimer0: port 0x40-0x43 on acpi0 Timecounter "i8254" frequency 1193182 Hz quality 0 Event timer "i8254" frequency 1193182 Hz quality 100 Timecounter "ACPI-fast" frequency 3579545 Hz quality 900 acpi_timer0: <32-bit timer at 3.579545MHz> port 0x408-0x40b on acpi0 acpi_ec0: port 0x62,0x66 on acpi0 pcib0: port 0xcf8-0xcff on acpi0 pci0: on pcib0 pci0: at device 0.2 (no driver attached) pcib1: at device 1.2 on pci0 pci1: on pcib1 sdhci_pci0: mem 0xc0801000-0xc0801fff,0xc0800000-0xc08007f= f irq 28 at device 0.0 on pci1 sdhci_pci0: 1 slot(s) allocated pcib2: at device 1.3 on pci0 pci2: on pcib2 pci2: at device 0.0 (no driver attached) pcib3: at device 1.7 on pci0 pci3: on pcib3 nvme0: mem 0xc0700000-0xc0703fff irq 48 at device 0.0= on pci3 pcib4: irq 43 at device 8.1 on pci0 pci4: on pcib4 vgapci0: port 0x1000-0x10ff mem 0xb0000000-0xbffff= fff,0xc0000000-0xc01fffff,0xc0600000-0xc067ffff irq 52 at device 0.0 on pci4 vgapci0: Boot video device hdac0: mem 0xc06c8000-0xc06cbfff irq 53 at de= vice 0.1 on pci4 pci4: at device 0.2 (no driver attached) xhci0: mem 0xc0400000-0xc04fffff irq 55= at device 0.3 on pci4 xhci0: 64 bytes context size, 64-bit DMA xhci0: Unable to map MSI-X table=20 usbus0: waiting for BIOS to give up control xhci_interrupt: host controller halted usbus0 on xhci0 usbus0: 5.0Gbps Super Speed USB v3.0 pci4: at device 0.5 (no driver attached) hdac1: mem 0xc06c0000-0xc06c7fff irq 54 at de= vice 0.6 on pci4 isab0: at device 20.3 on pci0 isa0: on isab0 acpi_lid0: on acpi0 acpi_button0: on acpi0 ig4iic_acpi0: iomem 0xfedc4000-0xfedc4fff irq 1= 4 on acpi0 ig4iic_acpi0: controller error during attach-1 ig4iic_acpi1: iomem 0xfedc5000-0xfedc5fff irq 6= on acpi0 ig4iic_acpi2: iomem 0xfedc2000-0xfedc2fff irq 1= 0 on acpi0 ig4iic_acpi2: controller error during attach-1 ig4iic_acpi3: iomem 0xfedc3000-0xfedc3fff irq 1= 1 on acpi0 ig4iic_acpi3: controller error during attach-1 acpi_iichid0: on acpi0 atkbdc0: port 0x60,0x64 irq 1 on acpi0 atkbd0: irq 1 on atkbdc0 kbd0 at atkbd0 atkbd0: [GIANT-LOCKED] battery0: on acpi0 acpi_acad0: on acpi0 hwpstate0: on cpu0 ZFS filesystem version: 5 ZFS storage pool version: features support (5000) Timecounters tick every 1.000 msec ugen0.1: <0x1022 XHCI root HUB> at usbus0 uhub0: <0x1022 XHCI root HUB, class 9/0, rev 3.00/1.00, addr 1> on usbus0 nvd0: NVMe namespace nvd0: 122104MB (250069680 512 byte sectors) hdacc0: at cad 0 on hdac0 hdaa0: at nid 1 on hdacc0 pcm0: at nid 3 on hdaa0 hdacc1: at cad 0 on hdac1 hdaa1: at nid 1 on hdacc1 pcm1: at nid 20,33 and 18 on hdaa1 pcm2: at nid 25 on hdaa1 iicbus0: on ig4iic_acpi0 iicbus1: on ig4iic_acpi1 iichid0 at addr 0x15 on iicbus1 iichid0: on iicbus1 iichid0: Interrupt setup failed. Fallback to sampling hidbus0: on iichid0 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 iicbus2: on ig4iic_acpi2 iicbus3: on ig4iic_acpi3 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hms0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hms0: 33 buttons and [XYWH] coordinates ID=3D1 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hmt0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hconf0: on hidbus0 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hid_get_item: Number of items(1040) truncated to 1024 hmt0: Multitouch touchpad with 0 external buttons, click-pad hmt0: 5 contacts with [C] properties. Report range [0:0] - [3209:2097] hidraw0: on hidbus0 Trying to mount root from zfs:zroot/ROOT/default []... Root mount waiting for: usbus0 uhub0: 10 ports with 10 removable, self powered ugen0.2: at usbus0 Root mount waiting for: usbus0 ugen0.3: at usbus0 Root mount waiting for: usbus0 ugen0.4: at usbus0 ugen0.5: at usbus0 [drm] amdgpu kernel modesetting enabled. lo0: link state changed to UP intsmb0: at device 20.0 on pci0 smbus0: on intsmb0 ums0 on uhub0 ums0: on us= bus0 ums0: 8 buttons and [XYZT] coordinates ID=3D0 urndis0 on uhub0 urndis0: on usbus0 ue0: on urndis0 ue0: Ethernet address: 7e:57:13:e9:a8:18 ubt0 on uhub0 ubt0: on= usbus0 WARNING: attempt to domain_add(bluetooth) after domainfinalize() WARNING: attempt to domain_add(netgraph) after domainfinalize() Security policy loaded: MAC/ntpd (mac_ntpd) --i4+hXSD0MH+kUt2u-- --PfMNkUu6w7uqAwHs Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iHUEARYKAB0WIQRJJMXN6/nibGTfWk0+WR6AK2efSAUCX+su9AAKCRA+WR6AK2ef SAkEAQCjWZ3U5TtZ4h6awErhsbEisyc40AeHTnePFkjDIaO6igEA0n9HSMDEOxrY UT6qp39i1/714mbsJyiKkaQj6vOEhgo= =zYDs -----END PGP SIGNATURE----- --PfMNkUu6w7uqAwHs-- From owner-freebsd-questions@freebsd.org Tue Dec 29 13:42:57 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4B3B74BF52A for ; Tue, 29 Dec 2020 13:42:57 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-io1-xd2d.google.com (mail-io1-xd2d.google.com [IPv6:2607:f8b0:4864:20::d2d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4wbN3MRPz4Zmg for ; Tue, 29 Dec 2020 13:42:56 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-io1-xd2d.google.com with SMTP id t8so12109587iov.8 for ; Tue, 29 Dec 2020 05:42:56 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=AmK2djR8baEBLfw1GZq+9iMsIdRezcJDn6TvaA1PmRI=; b=LXKn0xOBHZbZe5Aj41S7uEDt9oTqT4Plb9jbFa5kGHiTN2RPh6yIsnpU22FJqRwfP6 VjmjwJGjFqb8fmWL8FKnpXOwEW+kdiK7g2oc21aDlGuYMCIRz2kgSdku0FNiFAbBk2uY 0fASm6cKNHMWJXcH+Bkqg3xH3uKTAYR+1ewRV6ilXr80UQbkX9LrlhhAhxSVNUWwOS2H 93ZUiOHn8B4aiaQrD6cXwSvTWxqcgYOqTnoAnxErskO44tB0MA3Q/TJ1eRh8jq/WzFQx ZP7QW5B9l1UU8KhKF6vxkBxW6StiX4gUV1RIQWYaKaHtbrAazqhZaGqvD9cJUZyn5eiL +I/g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=AmK2djR8baEBLfw1GZq+9iMsIdRezcJDn6TvaA1PmRI=; b=dVqMwVibv5fwnjg78ASDPBqTL5o+x7THV+aWmM63s1i9nBYeH5ThX7PIx8AYoU7F6D ZA+CgnoEwRXNixtWpia8CECXSVUKs27n+Ud6qaLAGePjGRHYGPTh1ozJ/5XNKetZ9kfi 49Wn1FYlLcPfQ/xtRdeLtibdl7kgtQny3MW+TZas4AgJ0mrRNAovvSB9EEWi6o7B9cfM v/VSwRx67y6KyW+n/DaM9DHaryIJoADgcCMRHgclUjotg7ak7MKYxd+NQylHMj1hbdyH mwBQhMp52njBkK9S4z0d2lAXtc5FqgqhpR/Mm2WsJzGHI6w8bPVL/dHUPakFwXedh2gE Mldw== X-Gm-Message-State: AOAM531+duU69b4gxXhCRAHvBsk1Zc5MywV1KVo2aJ4dourxtw+3XUHe he22c3UxEpuln2vky4gPzsWOf9iRn1nH9jYIdBU= X-Google-Smtp-Source: ABdhPJxwHjO54awGNQ0UXCIcDMcXPjMnoW0AxAs3eKQ1Ab9jfp3nGWJyNtw1hpyudddHM5j/KCPtoNRXFt4vkjv8kQo= X-Received: by 2002:a02:6c50:: with SMTP id w77mr42532327jab.68.1609249375522; Tue, 29 Dec 2020 05:42:55 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Michael Schuster Date: Tue, 29 Dec 2020 14:42:41 +0100 Message-ID: Subject: Re: graphics on amd radeon vega To: Oskar Sharipov Cc: freeBSD Mailing List X-Rspamd-Queue-Id: 4D4wbN3MRPz4Zmg X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=LXKn0xOB; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::d2d as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d2d:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d2d:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d2d:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 13:42:57 -0000 If you search the archives for ryzen, amdgpu and Vega, you'll find a thread I started in July on a very similar topic. If your HW matches what I have, you're probably out of luck with 12, and even with CURRENT will have to wait for the next(?) update of drm to version 5.5, I believe, to get support for your GPU. (sorry for top posting, I'm typing this on my phone) HTH Michael On Tue, Dec 29, 2020, 14:28 Oskar Sharipov wrote: > On Tue, Dec 29, 2020 at 04:14:07PM +0300, Vasily Postnicov wrote: > > The interesting part of dmesg seems to be truncated: > > > > > [drm] radeon kernel modesetting enabled. > > > acpi_video0: on vgapci0 > > > > > > ... > > Yep, my fault. Wanted to not show everything that dmesg prints. > > > General hint: do not forget to add your user to the group called "video" > > (this is not relevant to driver loading, but you will not be able to use > > /dev/dri/* devices without this step). Also, for FreeBSD 12 with EFI > > bootloader add the following line to /boot/loader.conf: > > hw.syscons.disable="1" > > The user is in "video" group, it's shown by `groups username`. > hw.syscons.disable="1" is in /boot/loader.conf as well. > > > and this line in /etc/rc.conf: > > kld_list="amdgpu" > > Set it right now and rebooted. Nothing changed. > > I'm attaching dmesg again. Note: I rebooted PC a minute ago. > > -- > Oskar Sharipov > site (might be unpaid and cancelled): oskarsh.ru > e-mail (replace asterisk with dot): oskarsh at riseup * net > secondary e-mail (same): oskar * sharipov at tutanota * org > gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 > From owner-freebsd-questions@freebsd.org Tue Dec 29 13:46:22 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 011724BF707 for ; Tue, 29 Dec 2020 13:46:22 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: from mail-ot1-x32e.google.com (mail-ot1-x32e.google.com [IPv6:2607:f8b0:4864:20::32e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4wgJ6y8Yz4ZwH for ; Tue, 29 Dec 2020 13:46:20 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: by mail-ot1-x32e.google.com with SMTP id j12so11826503ota.7 for ; Tue, 29 Dec 2020 05:46:20 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=cn+IgJBaDGkDu8Nsd1J2HggTS/UMNLVyShcp4nUFwpY=; b=KmkAgzprVWZuavFRWu0K0wkPI/2Yyw5zS9AFlulxGwHqO3mKIkNP4KEDu1TA5WCjp0 nkfSjwWtLkI8jsXnMAcuPQIUbhIjx9W+/5CXrNuo2OaREVEpird5U60h1x5y/wOzxaiY nkJaTYcY0xSeUhXZZhvNjlYVpS3myopQv6X/4BF5PnhfAAtUw+cGkbHWQjxnZSdWAsZO 5HTohu5P9E8gpvkTgRUqn2UcJnbNG9Z06a/jIucdP8DSA2hCuMLYElila/2pdf1uphvY A3CXZYHgHz/c7TBo0p7fc87h37AI5fHR5tWdTsHTPOkOBIiVdvnby9fpb3TmvJCLRMcs IWdw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=cn+IgJBaDGkDu8Nsd1J2HggTS/UMNLVyShcp4nUFwpY=; b=MLB6OXIA4fmNz66ilVXnBzZ45NPBd/IF5rYJyOAfORnEAwFEBwPGm6Fouifs+5y0iy 4diqFE7m3mzQ7s7f4UXVmUm9wP4viGWAP2bqHWVd0A7QOuQbL59V1k1E6jVpToAYoRHa pjRgmWhg79nZ6IPW5ofD4czF2+ctoUYJsQHzxg3mdWD5+M2W96WpLQ03n45psFtL2HeF G2fvqO7NTlI9X/l3GDQdPa0S0s3x2VO5UPOg7rC8QOHByU9R/c/Gq0FIWOs3ghfPhzPp hzSh30YN/zc8VSghsLkrkavxM2pZdpXh8NgS1P/etdIKZcLzZPhNCy/LmXHXh3s/bYzz C8xQ== X-Gm-Message-State: AOAM531mEvLRg6Bc5gu4GH/cuSFtP0Qf+5vOOGIXgb6nBVihBXHnkxjq DefZuZMadCHM/7wFDNpEfQVnT66H1ys3QumH3cVQyPcj5SG5Tw== X-Google-Smtp-Source: ABdhPJzjaEQygmWDz8opZ0NKLSJGxUt4t3N/ozH3OI+HPoi0IwwBimtET/Ie9d7ed/6gf3DqboapVBnSwe+Q0d9q3rQ= X-Received: by 2002:a9d:37c4:: with SMTP id x62mr36968734otb.87.1609249579913; Tue, 29 Dec 2020 05:46:19 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Vasily Postnicov Date: Tue, 29 Dec 2020 16:46:09 +0300 Message-ID: Subject: Re: graphics on amd radeon vega To: Oskar Sharipov Cc: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4D4wgJ6y8Yz4ZwH X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=KmkAgzpr; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of shamazmazum@gmail.com designates 2607:f8b0:4864:20::32e as permitted sender) smtp.mailfrom=shamazmazum@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::32e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::32e:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::32e:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 13:46:22 -0000 Oh, so there is nothing interesting ;) It seems that the driver does not see your card (which is strange enough, I think amdgpu should support Vega). The normal output in looks like this (this is on Radeon RX580): https://pastebin.com/tjKx0hCd I can only suggest you to try 13-CURRENT with graphics/drm-current-kmod if you have time. Those drivers must be the most recent. =D0=B2=D1=82, 29 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3. =D0=B2 16:28, Oskar Shari= pov : > On Tue, Dec 29, 2020 at 04:14:07PM +0300, Vasily Postnicov wrote: > > The interesting part of dmesg seems to be truncated: > > > > > [drm] radeon kernel modesetting enabled. > > > acpi_video0: on vgapci0 > > > > > > ... > > Yep, my fault. Wanted to not show everything that dmesg prints. > > > General hint: do not forget to add your user to the group called "video= " > > (this is not relevant to driver loading, but you will not be able to us= e > > /dev/dri/* devices without this step). Also, for FreeBSD 12 with EFI > > bootloader add the following line to /boot/loader.conf: > > hw.syscons.disable=3D"1" > > The user is in "video" group, it's shown by `groups username`. > hw.syscons.disable=3D"1" is in /boot/loader.conf as well. > > > and this line in /etc/rc.conf: > > kld_list=3D"amdgpu" > > Set it right now and rebooted. Nothing changed. > > I'm attaching dmesg again. Note: I rebooted PC a minute ago. > > -- > Oskar Sharipov > site (might be unpaid and cancelled): oskarsh.ru > e-mail (replace asterisk with dot): oskarsh at riseup * net > secondary e-mail (same): oskar * sharipov at tutanota * org > gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 > From owner-freebsd-questions@freebsd.org Tue Dec 29 14:04:51 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2E8994C01D6 for ; Tue, 29 Dec 2020 14:04:51 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: from mail-oi1-x230.google.com (mail-oi1-x230.google.com [IPv6:2607:f8b0:4864:20::230]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4x4f1pjgz4cMH for ; Tue, 29 Dec 2020 14:04:50 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: by mail-oi1-x230.google.com with SMTP id w124so14696158oia.6 for ; Tue, 29 Dec 2020 06:04:50 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=JY1UquGa0HCjX86xASoHJ7Fk7ILRe5r/1mFp+1x5QQU=; b=kCayzUQXnW8TMEtF+jsLajKez6M+ZAncRPsOBv+QAAcPPBHILZlyfOTDOmIqjTduPw t8/YPPuo3EraVa0ndEex7MsT4e7+t5vWbbVPsY236zNsyvVcXb8DReu5zYgADt2RatO3 1Oi9KXGDazvN2Tu3LPGdf+B6QFZ88g/rk1Z9o5D6mtBlmGna55awDmWl5OkVRj3Oh3Lv sNtuhkWoAXF2a/mLKsBCK+hu/COeVOs3/AHqEGgow6n2kwmQTUKp8unts1H99viujeYZ ZyqfAp0J2BgUah2DgA1PlWDKZ/g68yan6oF40lwn4bhSULk6S6Y3KnWveGJFxnizulhk J8Ew== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=JY1UquGa0HCjX86xASoHJ7Fk7ILRe5r/1mFp+1x5QQU=; b=HIPHlV0SprnxVF/k+mcYOZQReQ4Fb66Pd+fA1+vbgdXOvcxFzsDSOVVyHqwJ4b5VDm IDxVgwouG/PeNl3cI7dymy6te+BfLY7uF9duPJDkg09YJC6LoUHlYQHxbQGLCwUEpoBz mGJRPBuz04KlJLuOCtP2WBWKs9+KynbPCy4smvqo7GRm/hDWndAg02+FbkZOc1Cu//XE kTUX7D02MoRuQDMVYfDHYCLeYMnPN2Q1dQ4uHtWcF1v8eGozUq86yDBUXcx6vlA9Jn1B HcrHnGO/vWlVNTKdRcnYvxNTQHrx6YFWYgMTsOAsNsr1PiTGM4cxVZv4h2EziKcqsbvR R4CQ== X-Gm-Message-State: AOAM533PPCymDHlEi2yr2mLWna8nprSoNhHjWZyXhVpnpZIBgqEf8G2X JU8pdNCuACrsrJfpBmwMa8KPgkfO2wY0kga2NTU= X-Google-Smtp-Source: ABdhPJxg0mS7CbXHATnFImyAG4JU4y1X489maZ2BbtFpLeASkHfmZD4BNOUyvZDYdY9G8EtN3r4foKuRbsF/2GyncdM= X-Received: by 2002:a54:400e:: with SMTP id x14mr2415161oie.21.1609250688997; Tue, 29 Dec 2020 06:04:48 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Vasily Postnicov Date: Tue, 29 Dec 2020 17:04:38 +0300 Message-ID: Subject: Re: graphics on amd radeon vega To: Michael Schuster Cc: Oskar Sharipov , freeBSD Mailing List X-Rspamd-Queue-Id: 4D4x4f1pjgz4cMH X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=kCayzUQX; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of shamazmazum@gmail.com designates 2607:f8b0:4864:20::230 as permitted sender) smtp.mailfrom=shamazmazum@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::230:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::230:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::230:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 14:04:51 -0000 13-CURRENT supports that chip. See https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm/amd/= amdgpu/amdgpu_drv.c > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, CHIP_RAVEN|AMD_IS_APU} =D0=B2=D1=82, 29 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3. =D0=B2 16:43, Michael Sch= uster : > If you search the archives for ryzen, amdgpu and Vega, you'll find a thre= ad > I started in July on a very similar topic. If your HW matches what I have= , > you're probably out of luck with 12, and even with CURRENT will have to > wait for the next(?) update of drm to version 5.5, I believe, to get > support for your GPU. > > (sorry for top posting, I'm typing this on my phone) > > HTH > Michael > > On Tue, Dec 29, 2020, 14:28 Oskar Sharipov wrote: > > > On Tue, Dec 29, 2020 at 04:14:07PM +0300, Vasily Postnicov wrote: > > > The interesting part of dmesg seems to be truncated: > > > > > > > [drm] radeon kernel modesetting enabled. > > > > acpi_video0: on vgapci0 > > > > > > > > ... > > > > Yep, my fault. Wanted to not show everything that dmesg prints. > > > > > General hint: do not forget to add your user to the group called > "video" > > > (this is not relevant to driver loading, but you will not be able to > use > > > /dev/dri/* devices without this step). Also, for FreeBSD 12 with EFI > > > bootloader add the following line to /boot/loader.conf: > > > hw.syscons.disable=3D"1" > > > > The user is in "video" group, it's shown by `groups username`. > > hw.syscons.disable=3D"1" is in /boot/loader.conf as well. > > > > > and this line in /etc/rc.conf: > > > kld_list=3D"amdgpu" > > > > Set it right now and rebooted. Nothing changed. > > > > I'm attaching dmesg again. Note: I rebooted PC a minute ago. > > > > -- > > Oskar Sharipov > > site (might be unpaid and cancelled): oskarsh.ru > > e-mail (replace asterisk with dot): oskarsh at riseup * net > > secondary e-mail (same): oskar * sharipov at tutanota * org > > gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 > > > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Tue Dec 29 14:35:03 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id ADF944C1187 for ; Tue, 29 Dec 2020 14:35:03 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D4xlT24b3z4dqC for ; Tue, 29 Dec 2020 14:35:00 +0000 (UTC) (envelope-from oskarsh@riseup.net) Received: from bell.riseup.net (bell-pn.riseup.net [10.0.1.178]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4D4xlJ23kGzFdxc for ; Tue, 29 Dec 2020 06:34:52 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1609252492; bh=ZZtcz+d/0NRDMBTaokifRlPYDfccV6T++8ueADD93rs=; h=Date:From:To:Subject:References:In-Reply-To:From; b=edfCeKvF8V3Sd7M5blaDgE5dL6ahDHQ8vFUJU6KKh2LpfaRBicoPK0eGS++/rvsf0 o4vMqZnppBqW8GxL59epGX83AX7C1GC3KcxV2gNkk58O1phcm4efbYvTJSw7X7onvK u9qmM/0TBm1mbLMXb+KpJ8OalalKk2WrywyLwSlg= X-Riseup-User-ID: 59B4CE75DD26E8A2DB4012C629B61D0ECEFED025291AD6FFC6AA6B5370202ED7 Received: from [127.0.0.1] (localhost [127.0.0.1]) by bell.riseup.net (Postfix) with ESMTPSA id 4D4xlH2l3BzJmmQ for ; Tue, 29 Dec 2020 06:34:51 -0800 (PST) Date: Tue, 29 Dec 2020 17:34:39 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: Re: graphics on amd radeon vega Message-ID: References: MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="VU+ljUHRIpd+og4y" Content-Disposition: inline In-Reply-To: X-Rspamd-Queue-Id: 4D4xlT24b3z4dqC X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=edfCeKvF; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of oskarsh@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=oskarsh@riseup.net X-Spamd-Result: default: False [-6.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 14:35:03 -0000 --VU+ljUHRIpd+og4y Content-Type: text/plain; protected-headers=v1; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Date: Tue, 29 Dec 2020 17:34:39 +0300 From: Oskar Sharipov To: freebsd-questions@freebsd.org Subject: Re: graphics on amd radeon vega On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: > 13-CURRENT supports that chip. See > https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm/am= d/amdgpu/amdgpu_drv.c >=20 > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, CHIP_RAVEN|AMD_IS_APU} Oh, wow. Then I will consider could I try CURRENT now or wait until it released. Thank you! --=20 Oskar Sharipov gpg fingerprint: BAC3 F049 748A D098 A144 BA89 0DC4 EA75 714C 75B5 --VU+ljUHRIpd+og4y Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iHUEARYKAB0WIQRJJMXN6/nibGTfWk0+WR6AK2efSAUCX+s+fwAKCRA+WR6AK2ef SBC0AP9l0ZpIVUBkXxf4m3W9lGfAFB5Jn40cR2fyQ/b7ZBLi3QD/XdJl1eAS9D1K yr6PbIUTnb4CLetXAWEIss7aXgjWlgI= =GUaj -----END PGP SIGNATURE----- --VU+ljUHRIpd+og4y-- From owner-freebsd-questions@freebsd.org Tue Dec 29 17:49:51 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 15A994C6805 for ; Tue, 29 Dec 2020 17:49:51 +0000 (UTC) (envelope-from doug@safeport.com) Received: from cyrus.watson.org (cyrus.watson.org [204.107.128.30]) by mx1.freebsd.org (Postfix) with ESMTP id 4D524G0wwGz4t0l for ; Tue, 29 Dec 2020 17:49:49 +0000 (UTC) (envelope-from doug@safeport.com) Received: from fledge.watson.org (fledge.watson.org [198.74.231.63]) by cyrus.watson.org (Postfix) with ESMTPS id 6601E8C564; Tue, 29 Dec 2020 17:40:10 +0000 (UTC) Received: from fledge.watson.org (doug@localhost [127.0.0.1]) by fledge.watson.org (8.16.1/8.16.1) with ESMTPS id 0BTHeA2M097175 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Tue, 29 Dec 2020 17:40:10 GMT (envelope-from doug@safeport.com) Received: from localhost (doug@localhost) by fledge.watson.org (8.16.1/8.16.1/Submit) with ESMTP id 0BTHe9UB097172; Tue, 29 Dec 2020 17:40:09 GMT (envelope-from doug@safeport.com) X-Authentication-Warning: fledge.watson.org: doug owned process doing -bs Date: Tue, 29 Dec 2020 17:40:09 +0000 (UTC) From: doug@safeport.com Reply-To: doug@fledge.watson.org To: Michael Schuster cc: Pete Wright , freeBSD Mailing List Subject: Re: Observations on virtual memory operations In-Reply-To: Message-ID: References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> MIME-Version: 1.0 Content-Type: text/plain; format=flowed; charset=US-ASCII X-Rspamd-Queue-Id: 4D524G0wwGz4t0l X-Spamd-Bar: +++++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=fail (mx1.freebsd.org: domain of doug@safeport.com does not designate 204.107.128.30 as permitted sender) smtp.mailfrom=doug@safeport.com X-Spamd-Result: default: False [7.50 / 15.00]; HAS_REPLYTO(0.00)[doug@fledge.watson.org]; REPLYTO_DN_EQ_FROM_DN(0.00)[]; HAS_XAW(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_ALL(0.00)[]; FREEMAIL_TO(0.00)[gmail.com]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[204.107.128.30:from]; ASN(0.00)[asn:11288, ipnet:204.107.128.0/24, country:US]; R_DKIM_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_SPF_FAIL(1.00)[-all:c]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(1.00)[1.000]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; DMARC_NA(0.00)[safeport.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[204.107.128.30:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; VIOLATED_DIRECT_SPF(3.50)[]; NEURAL_SPAM_LONG(1.00)[1.000]; FROM_NO_DN(0.00)[]; GREYLIST(0.00)[pass,body]; MAILMAN_DEST(0.00)[freebsd-questions] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 17:49:51 -0000 On Tue, 29 Dec 2020, Michael Schuster wrote: > On Tue, Dec 29, 2020, 00:37 Pete Wright wrote: > >> >> >> On 12/28/20 3:25 PM, doug wrote: >>> I have two servers running jails that "routinely" run out of swapspace >>> with >>> no demand paging activity. To try and get a handle on VM/swapspace >>> management I have been tracking swapinfo vs memory use as measured by >>> top. >>> The numbers do not exactly add up but I assume that is not involved in my >>> issue. >>> >> >>> >>> The other day I caught the system at 73% swapspace used. At this level >>> the >>> system was in a near thrashing state in that typing a key got it >>> echoed in >>> 10 <--> 30 seconds. There was about 600MB of swapspace at this point. I >>> would think there is no way to debug this except as a thought experiment. >> >> The first thing that comes to mind is do you have the ability to hook >> any metrics/monitoring onto this system. For example, I use collectd on >> my systems to report overall CPU/memory metrics as well as per-process >> memory metrics. >> >> Alternatively you could write a simple shell script that run's "ps" and >> parses the output of memory utilization on a per-process basis. >> >> either of the above approaches should give you some insight into where >> the memory leak is coming from (assuming you already do not know). >> >> one trick i use is to invoke a process with "limits" to ensure it does >> not exceed a certain amount of memory that I allocate to it. for example >> with firefox i do this: >> $ limits -m 6g -v 6g /usr/local/bin/firefox >> >> that should at least buy you enough time to investigate why the process >> needs so much memory and see what you can do about it. > Thank you all for the information and thoughts. If vmstat produces correct infomation there is no demand paging. The limiting condition on these systems is swapfile space rather than real memory. There are 69 sysctl elements dealing with paging and swapfile. If there is documentation (other than in C) on these that would be helpful perhaps. Most are totals, demand paging rates may be in this set, but not so as I can tell. The one time I caught the system dying the limiting resource was swapspace. There was no paging (last vmstat) and about 670MB left in the swapfile. In this state I could recover by restarting apache. From owner-freebsd-questions@freebsd.org Tue Dec 29 18:09:54 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 515874C6D74 for ; Tue, 29 Dec 2020 18:09:54 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from mail.nomadlogic.org (mail.nomadlogic.org [174.136.98.114]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mail.nomadlogic.org", Issuer "Let's Encrypt Authority X3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D52WP2Bdbz4v9b for ; Tue, 29 Dec 2020 18:09:52 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from [192.168.1.160] (cpe-24-24-163-126.socal.res.rr.com [24.24.163.126]) by mail.nomadlogic.org (OpenSMTPD) with ESMTPSA id 7c158b3f (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Tue, 29 Dec 2020 18:09:51 +0000 (UTC) Subject: Re: Observations on virtual memory operations To: doug@fledge.watson.org, Michael Schuster Cc: freeBSD Mailing List References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> From: Pete Wright Message-ID: <03553c65-c1c2-db2c-6ab9-a0f4d09c3e2d@nomadlogic.org> Date: Tue, 29 Dec 2020 10:09:50 -0800 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: 4D52WP2Bdbz4v9b X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pete@nomadlogic.org designates 174.136.98.114 as permitted sender) smtp.mailfrom=pete@nomadlogic.org X-Spamd-Result: default: False [-2.41 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[nomadlogic.org]; ARC_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[174.136.98.114:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[174.136.98.114:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.11)[-0.108]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEMAIL_TO(0.00)[fledge.watson.org,gmail.com]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:25795, ipnet:174.136.96.0/20, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 18:09:54 -0000 On 12/29/20 9:40 AM, doug@safeport.com wrote: > On Tue, 29 Dec 2020, Michael Schuster wrote: > >> On Tue, Dec 29, 2020, 00:37 Pete Wright wrote: >> >>> >>> >>> On 12/28/20 3:25 PM, doug wrote: >>>> I have two servers running jails that "routinely" run out of swapspace >>>> with >>>> no demand paging activity. To try and get a handle on VM/swapspace >>>> management I have been tracking swapinfo vs memory use as measured by >>>> top. >>>> The numbers do not exactly add up but I assume that is not involved >>>> in my >>>> issue. >>>> >>> >>>> >>>> The other day I caught the system at 73% swapspace used. At this level >>>> the >>>> system was in a near thrashing state in that typing a key got it >>>> echoed in >>>> 10 <--> 30 seconds. There was about 600MB of swapspace at this >>>> point. I >>>> would think there is no way to debug this except as a thought >>>> experiment. >>> >>> The first thing that comes to mind is do you have the ability to hook >>> any metrics/monitoring onto this system.  For example, I use >>> collectd on >>> my systems to report overall CPU/memory metrics as well as per-process >>> memory metrics. >>> >>> Alternatively you could write a simple shell script that run's "ps" and >>> parses the output of memory utilization on a per-process basis. >>> >>> either of the above approaches should give you some insight into where >>> the memory leak is coming from (assuming you already do not know). >>> >>> one trick i use is to invoke a process with "limits" to ensure it does >>> not exceed a certain amount of memory that I allocate to it. for >>> example >>> with firefox i do this: >>> $ limits -m 6g -v 6g /usr/local/bin/firefox >>> >>> that should at least buy you enough time to investigate why the process >>> needs so much memory and see what you can do about it. >> > Thank you all for the information and thoughts. If vmstat produces > correct infomation there is no demand paging. The limiting condition > on these systems is swapfile space rather than real memory. There are > 69 sysctl elements dealing with paging and swapfile. If there is > documentation (other than in C) on these that would be helpful > perhaps. Most are totals, demand paging rates may be in this set, but > not so as I can tell. > > The one time I caught the system dying the limiting resource was > swapspace. There was no paging (last vmstat) and about 670MB left in > the swapfile. In this state I could recover by restarting apache. I wouldn't go down that rabbit hole just yet.  If the issue is with apache-httpd causing your memory to run away I would instead focus on trying to determine *why* httpd is doing that.  Generally a well behaved process should not need to page out to disk if the system is appropriately sized and configured.  As such I would suggest starting at the application layer before trying to tweak how FreeBSD manages paging out to disk. For example, I remember issues back in the day where httpd would consume tons of memory if people were uploading files.  We were able to address this by being more aggressive in how we wrote files to disk in chunks during the upload process. -p -- Pete Wright pete@nomadlogic.org @nomadlogicLA From owner-freebsd-questions@freebsd.org Tue Dec 29 20:09:50 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A53BB4C98F9 for ; Tue, 29 Dec 2020 20:09:50 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.17.10]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D559n2W0Sz3LQM for ; Tue, 29 Dec 2020 20:09:48 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([178.12.114.132]) by mrelayeu.kundenserver.de (mreue109 [212.227.15.183]) with ESMTPA (Nemesis) id 1Mgek6-1kOJPy1L9Y-00h3g8; Tue, 29 Dec 2020 21:09:46 +0100 Date: Tue, 29 Dec 2020 21:09:45 +0100 From: Polytropon To: "Kevin P. Neal" Cc: Rahul Bharadwaj , freebsd-questions@freebsd.org Subject: Re: What does =?UTF-8?Q?=E2=80=9CNo_anode=E2=80=9D?= mean in errno 55 when socket connection fails? Message-Id: <20201229210945.74b0f682.freebsd@edvax.de> In-Reply-To: References: Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:zEKjFbneQKGcsBSz+Bts7BeXn+Dnp3MHTMx1wINi7UsJ24vVUcD BHNeGqm7+ebRBQYKApHtuxRw1G8K91RbA/gnfA2pALZXDERqrtOukIJMS9/NmQ5mVK5KKSI sn+w/fFIRxAm58xIty0Lu9/Gg1W9rBH38fQKqdX7g371lITJFUaS/mTmZ+j58Wfx7IHTe2U vrAnzRpuBI/U9lojhuT4Q== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:Sm95uFmbqgE=:LoA74K+grBbQFSzkySj9nF 92ALJjDztCr18XQ2Li3DIeuoWZdPOgJagxVwk+B0rjBYT+s0ICO7ujn5VQW3GbeFwzxdrBBEz aKyEaUyjupP5zQ4qUx99Q+JWWEMCBPwdYHDDcSuzkF3C7TFSTvn7XEscy0Tq5waZh4HxEKNQz oX0PMJ/dAUqTyBMrLE0ux+x/5gGd0ErjxCNC4Gtl356Mp7jDeiTC8ivW5mLk46mAyslYkfpb2 nTaXNtq/7CajOUuWyDpR4KMfDfjxrAFU36enGwvhOwqqMtfeOAm1Y1O/iiJnGuH/mvRYJEVXf 5GMsJ31gproUlhO8ywThR6vkjHRUqER5FNx5s2Z7uZp09mO/kg7eFU6UiLTniU1zBmxqbkloa G5OQ66lcSVjyHjFxxlHSeOd2IaD/pm0Hw8rVxFRuHifnKgZouHGLmIvSfUdF8 X-Rspamd-Queue-Id: 4D559n2W0Sz3LQM X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of freebsd@edvax.de has no SPF policy when checking 212.227.17.10) smtp.mailfrom=freebsd@edvax.de X-Spamd-Result: default: False [0.40 / 15.00]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.17.10:from]; RECEIVED_SPAMHAUS_PBL(0.00)[178.12.114.132:received]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[212.227.17.10:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[212.227.17.10:from]; RCVD_TLS_LAST(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.17.10:from]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 20:09:50 -0000 On Tue, 29 Dec 2020 13:53:24 -0500, Kevin P. Neal wrote: > On Sun, Dec 27, 2020 at 11:03:17PM +0530, Rahul Bharadwaj wrote: > > I was doing a few performance tests on a local server and once in a while I > > hit an error where opening a socket connection fails. > > > > i.e. considering the simplest code: > > > > #include > > #include > > > > int main() { > > /* code to create socket object */ > > > > int ret = connect(sock, (struct sockaddr *)&serv_addr, > > sizeof(serv_addr)); > > if (ret < 0) { > > fprintf(stderr, "connect() failed with: %d\n", errno); // <---- *get > > errno as 55* > > exit(1); > > } > > /* other code */ > > } > > > > There is no explanation for this error number "55". In every place, the > > only mention is "No anode". There is no mention of what "anode" means and > > what "No anode" specifically means. > > > > Can someone please help me with what this errno means or point me to some > > documentation explaining the same. > > Call strerror(errno) to get a char* that describes what the various errno > values mean. Pass that char* to fprintf with the usual "%s" format string. Or use perror(), which technically does the same thing (and allows you to add a custom error message prefix): The perror() function finds the error message corresponding to the cur- rent value of the global variable errno (intro(2)) and writes it, fol- lowed by a newline, to the standard error file descriptor. If the argu- ment string is non-NULL and does not point to the null character, this string is prepended to the message string and separated from it by a colon and space (``: ''); otherwise, only the error message string is printed. See "man 3 perror" for details. There is also a perror program, which can be used to check: % perror 55 No buffer space available See "man 1 perror" for details respectively. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From owner-freebsd-questions@freebsd.org Tue Dec 29 22:27:40 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E0D484CC821 for ; Tue, 29 Dec 2020 22:27:40 +0000 (UTC) (envelope-from dave@jetcafe.org) Received: from fedex2.jetcafe.org (fedex2.jetcafe.org [205.147.26.23]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA512 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "fedex2.jetcafe.org", Issuer "Let's Encrypt Authority X3" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D58Dq6G15z3kX5 for ; Tue, 29 Dec 2020 22:27:39 +0000 (UTC) (envelope-from dave@jetcafe.org) X-Envelope-To: freebsd-questions@freebsd.org Received: from bigus.dream-tech.com (bigus.jetcafe.org [205.147.26.7]) by fedex2.jetcafe.org (8.15.2/8.15.2) with ESMTPS id 0BTMRbVc016923 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Tue, 29 Dec 2020 14:27:38 -0800 (PST) (envelope-from dave@jetcafe.org) Date: Tue, 29 Dec 2020 14:27:37 -0800 From: Dave Hayes To: Victor Sudakov Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201229142737.3b2b3692@bigus.dream-tech.com> In-Reply-To: <20201229074017.GA9211@admin.sibptus.ru> References: <20201224134403.GB13527@admin.sibptus.ru> <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> <20201229022714.GA95031@admin.sibptus.ru> <20201228191306.3edcdab1@bigus.dream-tech.com> <20201229034211.GA98610@admin.sibptus.ru> <20201228225756.30870717@bigus.dream-tech.com> <20201229074017.GA9211@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spam-Score: -1 ( out of 6) ALL_TRUSTED,SHORTCIRCUIT X-Spam-Checker-Version: SpamAssassin version 3.4.4-jetcafeglobal X-Scanned-By: MIMEDefang 2.83 X-Rspamd-Queue-Id: 4D58Dq6G15z3kX5 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of dave@jetcafe.org designates 205.147.26.23 as permitted sender) smtp.mailfrom=dave@jetcafe.org X-Spamd-Result: default: False [-3.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[jetcafe.org]; RBL_DBL_DONT_QUERY_IPS(0.00)[205.147.26.23:from]; SPAMHAUS_ZRD(0.00)[205.147.26.23:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:7397, ipnet:205.147.0.0/18, country:US]; MAILMAN_DEST(0.00)[freebsd-questions]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 22:27:40 -0000 On Tue, 29 Dec 2020 14:40:17 +0700 Victor Sudakov wrote: > Dave Hayes wrote: > > > > > Was this happening over network (PXE boot) or from a physical medium > > > > > like USB drive/CD-ROM ? > > > > > > > > Actually both. However, this thread implied that the mfsBSD/ramdisk > > > > techniques did not work, and I wanted to provide a datapoint to the > > > > contrary. > > > > > > > > We have one installation which gets the ISO image over FTP and boots > > > > from that, > > > > > > Can you please elaborate on that? Is this installation using UEFI or > > > legacy mode loader? What tools are used? pxelinux/memdisk or anything > > > else? > > > > This particular installation is a Dell DRAC that has the capability of > > booting given an http url for a bootable iso. There actually is still some > > problem booting the hybrid disk in BIOS mode, but UEFI works just fine. > > Highly effective on an isolated network. > > Ah, is this more like IPMI booting, where you can attach an ISO image to > the IPMI console which has its own networking stack, management > interface etc? I am not too familiar with IPMI, but what you describe is what we have been working with. > Therefore my cheat sheet for making a UEFI bootable freebsd UFS volume is > like this: > > gpart create -s gpt ada1 # will become ada0 > gpart add -s200M -t efi ada1 > gpart add -s2G -t freebsd-swap ada1 > gpart add -t freebsd-ufs ada1 > gpart bootcode -p /boot/boot1.efifat -i 1 ada1 > > Instead of "gpart bootcode -p /boot/boot1.efifat -i 1 ada1" we can just > as well run > "newfs_msdos /dev/ada1p1 ; mount_msdosfs /dev/ada1p1 /mnt ; rsync -r ... /mnt" Of course my 'cheat sheet', being /usr/src/release/amd64/mkisoimages.sh is probably amd specific, and I don't ever put boot code on a hard disk these days unless I have to. Nevertheless, I seem to be using /boot/pmbr as the actual boot code and I have the GPT image being created with mkimg(1) which gets dropped into the iso by dd(1). UEFI appears to be sensitive to large sizes of mfsroots. I had to make EFI_STAGING_SIZE 300 and NKPT 220 to get this to all work properly. -- Dave Hayes - Consultant - LA CA, USA - dave@dream-tech.com >>>> *The opinions expressed above are entirely my own* <<<< One of the most common defenses against really learning something is to believe that one knows it already. From owner-freebsd-questions@freebsd.org Tue Dec 29 22:55:16 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 77B534CD43B for ; Tue, 29 Dec 2020 22:55:16 +0000 (UTC) (envelope-from 4250.82.1d4c70002170516.8d095245c1dd8ee98423fd0e83a446ac@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D58rg39Qmz3m6M for ; Tue, 29 Dec 2020 22:55:15 +0000 (UTC) (envelope-from 4250.82.1d4c70002170516.8d095245c1dd8ee98423fd0e83a446ac@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1609282515; x=1611874515; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=4YBMHKrn1ubhgRQh0hyYrAMwEhQukwCIJx56701Zubs=; b=rOu4wEc3RMlFgm/NdQQ6jiUcgqS3OJl7UYdmNB/WkgjhpqOdJVCZD21TtXoTxncCkO0EOJCoWbWBxXzTkoUZHeEy4pJXYDGNiXxzY2q5eGWidcKuJVMkzhsUZ/yoWDjQzdvb6ZdSgeKYu9bp69PrOJ+G4PqSQVmOJtxjGTJGzGo= X-Thread-Info: NDI1MC45Mi4xZDRjNzAwMDIxNzA1MTYuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r1.us-east-2.aws.in.socketlabs.com (r1.us-east-2.aws.in.socketlabs.com [142.0.189.1]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Tue, 29 Dec 2020 17:55:08 -0500 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r1.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Tue, 29 Dec 2020 17:55:07 -0500 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1kuNtR-000KST-QL; Tue, 29 Dec 2020 22:55:05 +0000 Date: Tue, 29 Dec 2020 22:55:05 +0000 From: Steve O'Hara-Smith To: Polytropon Cc: "Kevin P. Neal" , Rahul Bharadwaj , freebsd-questions@freebsd.org Subject: Re: What does =?UTF-8?B?4oCcTm8gYW5vZGXigJ0=?= mean in errno 55 when socket connection fails? Message-Id: <20201229225505.164d7782ada7a7efa48155b2@sohara.org> In-Reply-To: <20201229210945.74b0f682.freebsd@edvax.de> References: <20201229210945.74b0f682.freebsd@edvax.de> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D58rg39Qmz3m6M X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=rOu4wEc3; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4c70002170516.8d095245c1dd8ee98423fd0e83a446ac@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4c70002170516.8d095245c1dd8ee98423fd0e83a446ac@email-od.com X-Spamd-Result: default: False [-1.70 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; RWL_MAILSPIKE_GOOD(0.00)[142.0.176.198:from]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4c70002170516.8d095245c1dd8ee98423fd0e83a446ac@email-od.com]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4c70002170516.8d095245c1dd8ee98423fd0e83a446ac@email-od.com]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[142.0.176.198:from]; FREEMAIL_CC(0.00)[neutralgood.org,gmail.com,freebsd.org]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 29 Dec 2020 22:55:16 -0000 On Tue, 29 Dec 2020 21:09:45 +0100 Polytropon wrote: > There is also a perror program, which can be used to check: > > % perror 55 > No buffer space available Now that's handy, I didn't notice that turning up (see elsethread about discoverability) the function has been there for a *long* time of course. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Wed Dec 30 01:03:09 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 05A6C4D0B94 for ; Wed, 30 Dec 2020 01:03:09 +0000 (UTC) (envelope-from doug@safeport.com) Received: from cyrus.watson.org (cyrus.watson.org [204.107.128.30]) by mx1.freebsd.org (Postfix) with ESMTP id 4D5ChC6YR7z3v9d for ; Wed, 30 Dec 2020 01:03:07 +0000 (UTC) (envelope-from doug@safeport.com) Received: from fledge.watson.org (fledge.watson.org [198.74.231.63]) by cyrus.watson.org (Postfix) with ESMTPS id CFE531996B; Wed, 30 Dec 2020 01:03:06 +0000 (UTC) Received: from fledge.watson.org (doug@localhost [127.0.0.1]) by fledge.watson.org (8.16.1/8.16.1) with ESMTPS id 0BU136lr071801 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO); Wed, 30 Dec 2020 01:03:06 GMT (envelope-from doug@safeport.com) Received: from localhost (doug@localhost) by fledge.watson.org (8.16.1/8.16.1/Submit) with ESMTP id 0BU135NO071797; Wed, 30 Dec 2020 01:03:06 GMT (envelope-from doug@safeport.com) X-Authentication-Warning: fledge.watson.org: doug owned process doing -bs Date: Wed, 30 Dec 2020 01:03:05 +0000 (UTC) From: doug@safeport.com Reply-To: doug@fledge.watson.org To: Pete Wright cc: Michael Schuster , freeBSD Mailing List Subject: Re: Observations on virtual memory operations In-Reply-To: <03553c65-c1c2-db2c-6ab9-a0f4d09c3e2d@nomadlogic.org> Message-ID: References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> <03553c65-c1c2-db2c-6ab9-a0f4d09c3e2d@nomadlogic.org> MIME-Version: 1.0 X-Rspamd-Queue-Id: 4D5ChC6YR7z3v9d X-Spamd-Bar: ++++++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=fail (mx1.freebsd.org: domain of doug@safeport.com does not designate 204.107.128.30 as permitted sender) smtp.mailfrom=doug@safeport.com X-Spamd-Result: default: False [8.41 / 15.00]; HAS_REPLYTO(0.00)[doug@fledge.watson.org]; REPLYTO_DN_EQ_FROM_DN(0.00)[]; HAS_XAW(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_ALL(0.00)[]; CTYPE_MIXED_BOGUS(1.00)[]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[204.107.128.30:from]; ASN(0.00)[asn:11288, ipnet:204.107.128.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; R_DKIM_NA(0.00)[]; R_SPF_FAIL(1.00)[-all]; ARC_NA(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(0.91)[0.911]; MIME_GOOD(-0.10)[multipart/mixed,text/plain]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; DMARC_NA(0.00)[safeport.com]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[204.107.128.30:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; VIOLATED_DIRECT_SPF(3.50)[]; NEURAL_SPAM_LONG(1.00)[1.000]; FROM_NO_DN(0.00)[]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org]; GREYLIST(0.00)[pass,meta]; MAILMAN_DEST(0.00)[freebsd-questions] X-Spam: Yes Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8BIT X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 01:03:09 -0000 On Tue, 29 Dec 2020, Pete Wright wrote: > > > On 12/29/20 9:40 AM, doug@safeport.com wrote: >> On Tue, 29 Dec 2020, Michael Schuster wrote: >> >>> On Tue, Dec 29, 2020, 00:37 Pete Wright wrote: >>> >>>> >>>> >>>> On 12/28/20 3:25 PM, doug wrote: >>>>> I have two servers running jails that "routinely" run out of >>>>> swapspace with no demand paging activity. To try and get a handle on >>>>> VM/swapspace management I have been tracking swapinfo vs memory use >>>>> as measured by top. The numbers do not exactly add up but I assume >>>>> that is not involved in my issue. >>>>> >> Thank you all for the information and thoughts. If vmstat produces >> correct infomation there is no demand paging. The limiting condition >> on these systems is swapfile space rather than real memory. There are >> 69 sysctl elements dealing with paging and swapfile. If there is >> documentation (other than in C) on these that would be helpful >> perhaps. Most are totals, demand paging rates may be in this set, but >> not so as I can tell. >> >> The one time I caught the system dying the limiting resource was >> swapspace. There was no paging (last vmstat) and about 670MB left in >> the swapfile. In this state I could recover by restarting apache. > > I wouldn't go down that rabbit hole just yet.  If the issue is with > apache-httpd causing your memory to run away I would instead focus on > trying to determine *why* httpd is doing that.  Generally a well behaved > process should not need to page out to disk if the system is > appropriately sized and configured.  As such I would suggest starting at > the application layer before trying to tweak how FreeBSD manages paging > out to disk. > > For example, I remember issues back in the day where httpd would consume > tons of memory if people were uploading files.  We were able to address > this by being more aggressive in how we wrote files to disk in chunks > during the upload process. I do not seem to be able to say clearly enough, there is no memory problem, the is a problem with the paging subsystem filling up swapspace. I have monitored memory with vmstat, systat, top, a perl program I found that makes a report using sysctl, and a python program I wrote to see how swap space is allocated among the jails. As far as I can see other than forking, there is no paging and assuming 100% of active memory is backed up, there is ample swap space. All that said there are so many data elements that sorta match that making definitive statements with a pretty good understanding of the code is risky. when the system starts with the 'out of swap space' message being logged, the console is totally locked up and pretty much the rest of these system along with it. I keep an xterm with an apache shutdown command handy as one enter key will get thourgh quicker than I can enlist the data center personel to do a manual reboot. It would appear at this point this issue is unique to me. In reading Dillon's writeup on VM processing it seems possbile that space allocated to the inactive and/or laundry queues is not being cleared. I found one guy suggesting that directing all console output to a file at least prevents losing the serial console. I wonder if anyone has experience with that. If there is a program that will fill up the swap file I could test this. I am somewhat reluctant to try this on a production system without having any experience with the fall out of doing this. From owner-freebsd-questions@freebsd.org Wed Dec 30 06:06:53 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8E3494D7C79 for ; Wed, 30 Dec 2020 06:06:53 +0000 (UTC) (envelope-from 4250.82.1d4c700021c9702.c32295275e4ccd9c507105269619081a@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5LQg6fwpz4h2l for ; Wed, 30 Dec 2020 06:06:51 +0000 (UTC) (envelope-from 4250.82.1d4c700021c9702.c32295275e4ccd9c507105269619081a@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1609308412; x=1611900412; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=wT1fPkAHIU072b6GkrWdf3n2eNI5mnnt8jKmJvZ8JAE=; b=tFw1zRFOag5aO1OqtNHuAa3qaNaqdm9GzV21QTbxQaBgEPmUwEeYcsGvrBlEawu2W3xXt+j7tmMh03jSWQNQtLhEN7/51F4P+HUMcyoDA8TZvcerig2/Vr0QbXlZTqbvWzjGzF0VdUrNoXvKl2f6LWRDvaDHkzCt/NvILOE9UFE= X-Thread-Info: NDI1MC45Mi4xZDRjNzAwMDIxYzk3MDIuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.us-east-1.aws.in.socketlabs.com (r3.us-east-1.aws.in.socketlabs.com [142.0.191.3]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Wed, 30 Dec 2020 01:06:49 -0500 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.us-east-1.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Wed, 30 Dec 2020 01:06:49 -0500 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1kuUdD-000NKm-K6; Wed, 30 Dec 2020 06:06:47 +0000 Date: Wed, 30 Dec 2020 06:06:47 +0000 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Cc: doug@fledge.watson.org Subject: Re: Observations on virtual memory operations Message-Id: <20201230060647.38938a75f69e6c045802f655@sohara.org> In-Reply-To: References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> <03553c65-c1c2-db2c-6ab9-a0f4d09c3e2d@nomadlogic.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D5LQg6fwpz4h2l X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=tFw1zRFO; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4c700021c9702.c32295275e4ccd9c507105269619081a@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4c700021c9702.c32295275e4ccd9c507105269619081a@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; RWL_MAILSPIKE_GOOD(0.00)[142.0.176.198:from]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-0.995]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4c700021c9702.c32295275e4ccd9c507105269619081a@email-od.com]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; MID_RHS_MATCH_FROM(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4c700021c9702.c32295275e4ccd9c507105269619081a@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[142.0.176.198:from]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 06:06:53 -0000 On Wed, 30 Dec 2020 01:03:05 +0000 (UTC) doug@safeport.com wrote: > I do not seem to be able to say clearly enough, there is no memory > problem, the is a problem with the paging subsystem filling up swapspace. Are you using tmpfs or swap backed md ? -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Wed Dec 30 06:56:48 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C74064B8D9F for ; Wed, 30 Dec 2020 06:56:48 +0000 (UTC) (envelope-from vas@sibptus.ru) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5MXH60rRz4jVL for ; Wed, 30 Dec 2020 06:56:47 +0000 (UTC) (envelope-from vas@sibptus.ru) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=In-Reply-To:Message-ID:Subject:To:From:Date; bh=9X68sb5fpQoplTVR8nArmzcr+rZ3iq7vwp5OB7hQFBY=; b=iqOb+KrECtkOfRp/VGa0dLvREZ 70PGpESCK/b2yqGWoUSHx6cChZzfUBjYs+nO2al2qJqWD69vBeFcZPsrVctPMgGc5c0xEtR0X4AYl Qur+ujrkJJoslZoka6fD26Rs8THZzINlWn565TNlBprmyEjg4R5DJRYTFXx9zAvZF2UQ=; Received: from vas by admin.sibptus.ru with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1kuVPW-000L3Z-LQ; Wed, 30 Dec 2020 13:56:42 +0700 Date: Wed, 30 Dec 2020 13:56:42 +0700 From: Victor Sudakov To: Dave Hayes Cc: Rick Miller , Graham Perrin , FreeBSD Questions Subject: Re: EFI, UEFI, PXE: FreeBSD-12.1-RELEASE-amd64-bootonly.iso boot from SAN device failed, error 0x7f22208e Message-ID: <20201230065642.GA79433@admin.sibptus.ru> References: <20201225084305.GA60871@admin.sibptus.ru> <20201228152202.4ba4fec9@bigus.dream-tech.com> <20201229022714.GA95031@admin.sibptus.ru> <20201228191306.3edcdab1@bigus.dream-tech.com> <20201229034211.GA98610@admin.sibptus.ru> <20201228225756.30870717@bigus.dream-tech.com> <20201229074017.GA9211@admin.sibptus.ru> <20201229142737.3b2b3692@bigus.dream-tech.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="yrj/dFKFPuw6o+aM" Content-Disposition: inline In-Reply-To: <20201229142737.3b2b3692@bigus.dream-tech.com> X-PGP-Key: http://admin.sibptus.ru/~vas/ X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 X-Rspamd-Queue-Id: 4D5MXH60rRz4jVL X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sibptus.ru header.s=20181118 header.b=iqOb+KrE; dmarc=pass (policy=none) header.from=sibptus.ru; spf=pass (mx1.freebsd.org: domain of vas@sibptus.ru designates 2001:19f0:5001:21dc::10 as permitted sender) smtp.mailfrom=vas@sibptus.ru X-Spamd-Result: default: False [-6.09 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:19f0:5001:21dc::10:from]; R_DKIM_ALLOW(-0.20)[sibptus.ru:s=20181118]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; SPAMHAUS_ZRD(0.00)[2001:19f0:5001:21dc::10:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[sibptus.ru:+]; DMARC_POLICY_ALLOW(-0.50)[sibptus.ru,none]; NEURAL_HAM_SHORT(-0.99)[-0.987]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:20473, ipnet:2001:19f0:5000::/38, country:US]; MAILMAN_DEST(0.00)[freebsd-questions]; FREEMAIL_CC(0.00)[gmail.com,freebsd.org] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 06:56:48 -0000 --yrj/dFKFPuw6o+aM Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Dave Hayes wrote: [dd] >=20 > > Therefore my cheat sheet for making a UEFI bootable freebsd UFS volume = is > > like this: > >=20 > > gpart create -s gpt ada1 # will become ada0 > > gpart add -s200M -t efi ada1 > > gpart add -s2G -t freebsd-swap ada1 > > gpart add -t freebsd-ufs ada1 > > gpart bootcode -p /boot/boot1.efifat -i 1 ada1 =20 > >=20 > > Instead of "gpart bootcode -p /boot/boot1.efifat -i 1 ada1" we can just > > as well run=20 > > "newfs_msdos /dev/ada1p1 ; mount_msdosfs /dev/ada1p1 /mnt ; rsync -r ..= =2E /mnt" >=20 > Of course my 'cheat sheet', being /usr/src/release/amd64/mkisoimages.sh > is probably amd specific, and I don't ever put boot code on a hard disk t= hese > days unless I have to. Nevertheless, I seem to be using /boot/pmbr as the You don't need /boot/pmbr nor any other MBR for UEFI booting. The UEFI BIOS does not care what's in the MBR, all it needs is a GPT with an efi partition. But maybe it's safe to have a pmbr after all, in case you attach your disk somewhere else, where a stupid "Disk Doctor" can be surprised by the absence of an MBR. > actual boot code and I have the GPT image being created with mkimg(1) whi= ch > gets dropped into the iso by dd(1).=20 Oh, I did not even know about mkimg(1). When I needed a disk image, I would mount a file via mdconfig. Thank you for this information, because mkimg seems to know many image formats (vhd, vmdk...), not only raw. Can be useful. >=20 > UEFI appears to be sensitive to large sizes of mfsroots. I had to make > EFI_STAGING_SIZE 300 and NKPT 220 to get this to all work properly. How and where do you adjust EFI_STAGING_SIZE and NKPT when building an mfsr= oot? --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --yrj/dFKFPuw6o+aM Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJf7CSqAAoJEA2k8lmbXsY0oy0H/iw7qZdfQnBJPdiU8fgl/SV0 Kekx6Y2/gCki73mT2nmvR1wWCfXpOoyhez4xEK9xyIkUiIGiz7p4+cvQ2ibUCEuC XXffjj+7SMczVRrEUJHIRvgj2iFL5HDfWq4Yr6ZlLKqtizEkLGprt2QfBXru4jZd 4G4nXlvII4ODLXAlPFA54KzFurhLo08nsjZVwpNR8BCAlpEYUhjb6bQA/+7hruPj VLBF2JjYAajAp9htSJ37t0R99vo+mNveNKl9vxY4jUKG7oLrI80/gXs/13lpoQHN gOTo5e//iLxJ3+d5RZpZ0Ibnm9dujQahJAzI25FPjgdX/1KdCdex8cq3bMv+UYI= =AQ7e -----END PGP SIGNATURE----- --yrj/dFKFPuw6o+aM-- From owner-freebsd-questions@freebsd.org Wed Dec 30 12:17:22 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C2AD64C139E for ; Wed, 30 Dec 2020 12:17:22 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-io1-xd2d.google.com (mail-io1-xd2d.google.com [IPv6:2607:f8b0:4864:20::d2d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5VfB125vz3JWl for ; Wed, 30 Dec 2020 12:17:21 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-io1-xd2d.google.com with SMTP id 81so14510307ioc.13 for ; Wed, 30 Dec 2020 04:17:21 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=onkygcTRUvpeMTCC0e5Gw33+/PHUkw3hkuRm8g3aR8Y=; b=IJgw2fvnYt9CNbvIChB7WmolVVyx7xzReZxgLDAF5CL5jqeBamtPXutuRQX5w9PMdT 5JVDt4h4rWXTM54J5jNCERtjidAzQZgOgh3UqfkYb0CY2Es+CdoKtkUaplKRNNQyp0bh yhoPIobIyMnhZOSnQz9UYDjJZhdXsRQSjHVbAoOwezFJNorpI/zGJaRJs+DClfrui+C3 dMnaxl3Q0BnnfRhf2O1jel8JUxEtKLr6UfcLnRoXdA2PBCZbeRfZgkeBEHpAqCiHJD9p Pycr08zL0wDVJhHDXBEu2KE4EMjgVCVpoxEY/XdUl2b6XsNoL1x1t4gchckw0V/sAtcK 0jbA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=onkygcTRUvpeMTCC0e5Gw33+/PHUkw3hkuRm8g3aR8Y=; b=gYzMkggoZKxB1J2+hZOXC7VeenVZkElRZ+LzTFnNXTUBLkyqRFJF4iXaqkzakuhWBQ 6K2E80Urf3ssMqoslPRCDsSwhn/NRQJhlwk5fHT4Zk2FwYn+rr1qYTiZrFcaNPToC7QZ tRBGDEYk5FAS/EdcI1h0KgrrSH5WWfGA3tIak15RY6fbWGs7PzAvPhYu82H+nOv29Psi PPvDG8mj7w5YPx7Vl0nvhgepuVtTVfv+vXwDywuQg6TZgwQvoXIKy68eGpEyU870XB2o 0FK/ZKUfnOR6Vh0J0AWybzX5FDVVMjHH40qyAidD8hf4Ic+ipI5t9bYTCpx/F0ouw9TS Q4xA== X-Gm-Message-State: AOAM530EfuNJMugmjPC5hILvE62bWYD2zAIlinnsbdSksyXkXXa7ofmW 9UEhMYTyenlKdHO910kgUDlYwOEppIgQmE9UlJY= X-Google-Smtp-Source: ABdhPJwhXLqsXA1beu/JnQkg0I9Lkl1WEXqoR/oXwPhHahoqJDP5r5M4Vz42//gY1U1NHfYhYSt5/lvP3rismGeJOzo= X-Received: by 2002:a6b:c414:: with SMTP id y20mr43213044ioa.150.1609330640765; Wed, 30 Dec 2020 04:17:20 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Michael Schuster Date: Wed, 30 Dec 2020 13:17:10 +0100 Message-ID: Subject: Re: graphics on amd radeon vega To: Oskar Sharipov Cc: freeBSD Mailing List X-Rspamd-Queue-Id: 4D5VfB125vz3JWl X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=IJgw2fvn; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::d2d as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d2d:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d2d:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d2d:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 12:17:22 -0000 On Tue, Dec 29, 2020 at 3:35 PM Oskar Sharipov wrote: > On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: > > 13-CURRENT supports that chip. See > > > https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm/amd/amdgpu/amdgpu_drv.c > > > > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, CHIP_RAVEN|AMD_IS_APU} > > Oh, wow. Then I will consider could I try CURRENT now or wait > until it released. Thank you! > when I Install this version on current as of today, I see this in /var/log/messages: Dec 30 13:11:56 hbeast kernel: [drm] amdgpu kernel modesetting enabled. Dec 30 13:11:56 hbeast kernel: drmn0: on vgapci0 Dec 30 13:11:56 hbeast kernel: [drm] This hardware requires experimental hardware support. Dec 30 13:11:56 hbeast kernel: See modparam exp_hw_support Dec 30 13:11:56 hbeast kernel: device_attach: drmn0 attach returned 19 sorry if this is an FAQ, but I couldn't find an answer: how do I enable/modify "modparam exp_hw_support"? thx Michael -- Michael Schuster http://recursiveramblings.wordpress.com/ recursion, n: see 'recursion' From owner-freebsd-questions@freebsd.org Wed Dec 30 13:01:54 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DBEC64C284C for ; Wed, 30 Dec 2020 13:01:54 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: from mail-ot1-x32c.google.com (mail-ot1-x32c.google.com [IPv6:2607:f8b0:4864:20::32c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5WdY6l3Rz3N3j for ; Wed, 30 Dec 2020 13:01:53 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: by mail-ot1-x32c.google.com with SMTP id d20so15329674otl.3 for ; Wed, 30 Dec 2020 05:01:53 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=4F0sOW7pDeCg2KHCt7G0OoMyx9ZrbH8cf2BvmJE3PHc=; b=g9COizztp1NfkS0NJOgfppNQ8yG6NPwUMFxdZo8tchNrpfXyLnYTHzy0aQ1I1Hpd88 4sVajw/8R6yRgIOJUxfVsWUYf+l4EqYwTzOglP5oY3QUn7vU0J3rP9c/2806myjYX5Nz 7XakKsdr5zHJXRSb/7/jgecSFyq7gvcefwjE4M4MZRmzgG7LOHU/TDa/tMqP2X0v8+xk 0tyxU4ZcCKu6owmH5XpH2Ia4jC/Y3y/DeolPsA/yY6FNbt4xC3z6LmAXURIZg1mOY+zO EzzADzye1KPOIfAWBLkaCkOB3xiJ0DxuUCr/1p8+ys70saxffVluv+kFSvezeAyO7X29 EoXQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=4F0sOW7pDeCg2KHCt7G0OoMyx9ZrbH8cf2BvmJE3PHc=; b=kLPDxpBYM90u+s0tm36vmm77YCIjA4o7KOe0iJCWb8/vNIdo6HrnGxfRafqPp0Sfnt efDXJpCimFBaGbMGJLTxh6cM7LE7BH3dy+VGWgg4ArgJuWYnaFNdcQz0efHM90j6L/yF JLVZC/b/PLRvqNCKiSGQ+uiAPzCEGo4aAEjqFiNDzHOvR7xW727KVVVIwXV69dZOmOjH Rp70YwMjmTcQLmIUsV1LNCOQ+J96siXyacrRfDu4+geceL09xTbqH67a+xvAjvx/n4Td a37q/7sahxsvYKnjBBhkU4zbel65QTknWhz0jBwopWJ5eRrw/KxUAszmOWBc2XYeJGmO 83Vg== X-Gm-Message-State: AOAM5311Zglt/jIN02t+CV6Ux4b/gmN9Va0ZVPr9GMpqyQ6fyH3r4XTn ixjfEAPgoJ1E+aOeeO+LnLHFKgJIyc1UHsu90/g= X-Google-Smtp-Source: ABdhPJx9XmPUOQi0Ny20hbaNsVM5epV79BUJTR1RHoWph/ler+VKkTdTS14yuv3t4mGRb9cHhJ5SjvUPKMeSiWU0a28= X-Received: by 2002:a05:6830:13d2:: with SMTP id e18mr40012466otq.366.1609333312828; Wed, 30 Dec 2020 05:01:52 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Vasily Postnicov Date: Wed, 30 Dec 2020 16:01:41 +0300 Message-ID: Subject: Re: graphics on amd radeon vega To: Michael Schuster Cc: Oskar Sharipov , freeBSD Mailing List X-Rspamd-Queue-Id: 4D5WdY6l3Rz3N3j X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=g9COizzt; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of shamazmazum@gmail.com designates 2607:f8b0:4864:20::32c as permitted sender) smtp.mailfrom=shamazmazum@gmail.com X-Spamd-Result: default: False [-3.55 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.55)[-0.553]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::32c:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::32c:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::32c:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 13:01:54 -0000 Does sysctl -a | grep exp_hw_support show anything? Usual way to tweak kernel parameters is via sysctl. But this is linux stuff so it can be anything else. If sysctl does not help, you can recompile the whole driver changing int amdgpu_exp_hw_support =3D 0; to int amdgpu_exp_hw_support =3D 1; in drivers/gpu/drm/amd/amdgpu/amdgpu_drv.c =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 15:17 Michael Schuster <= michaelsprivate@gmail.com>: > On Tue, Dec 29, 2020 at 3:35 PM Oskar Sharipov wrote= : > > > On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: > > > 13-CURRENT supports that chip. See > > > > > > https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm/am= d/amdgpu/amdgpu_drv.c > > > > > > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, CHIP_RAVEN|AMD_IS_AP= U} > > > > Oh, wow. Then I will consider could I try CURRENT now or wait > > until it released. Thank you! > > > > when I Install this version on current as of today, I see this in > /var/log/messages: > > Dec 30 13:11:56 hbeast kernel: [drm] amdgpu kernel modesetting enabled. > Dec 30 13:11:56 hbeast kernel: drmn0: on vgapci0 > Dec 30 13:11:56 hbeast kernel: [drm] This hardware requires experimental > hardware support. > Dec 30 13:11:56 hbeast kernel: See modparam exp_hw_support > Dec 30 13:11:56 hbeast kernel: device_attach: drmn0 attach returned 19 > sorry if this is an FAQ, but I couldn't find an answer: how do I > enable/modify "modparam exp_hw_support"? > > thx > Michael > > -- > Michael Schuster > http://recursiveramblings.wordpress.com/ > recursion, n: see 'recursion' > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Wed Dec 30 13:25:23 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1BD404C3898 for ; Wed, 30 Dec 2020 13:25:23 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-io1-xd2f.google.com (mail-io1-xd2f.google.com [IPv6:2607:f8b0:4864:20::d2f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5X8f2qPlz3Pp0 for ; Wed, 30 Dec 2020 13:25:22 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-io1-xd2f.google.com with SMTP id 81so14648758ioc.13 for ; Wed, 30 Dec 2020 05:25:22 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=8cZDWUOCJ3f9SCALAAYTkn1e6V5TfI+WGnMyvz5LTvU=; b=iz5Pggc0pkjJ3pXK5Gx3M7kzQQy28xOXxPOUM+JilNKD7UzUYACoUDiG6yjLePeGPL puOhtDqWdktJwAeyO7FRzs4jKCQXE8xFe0BYdPYEjk6NO9TF2Myl4ADgjrybQZWKdPIb p291Rr1u7FR1XCd71++OSXnpthIGti2jpBzeqBaRDYG1UN4WbPNT07oL0pVT2pukv28N 88uERBmHrLoS02UC5mXAFx0SIcDDYJXigkR5bfY+GxS01NJNhJ52LjoQ0IweG0EefqJE q/lkbQJY10oOkND8GJ+/N0rU7Jp61wOXoi0jN3i4gonPMTZbRVkiujaPMoHtnPtbQSQm hU3A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=8cZDWUOCJ3f9SCALAAYTkn1e6V5TfI+WGnMyvz5LTvU=; b=GcIz7YmWrgRnmT7tz/7S29OYowZr/AoeZ3LAAWONzVA2u9flYRUD2NH2YeeZpFDIYj Zx1YvewP1CySxMYoXxyR5+3txUJYsxDx+B4xmmkeqMLuxXGIM20i9/Zfv1OKFh/6D91G B/ShHyl6AlOYOkZdxhGnrJitboUC7GGxMxEfCZ4hlg0DwKZ4AEYfIyFuL1bOJCYd5As5 oG6aLCj1jAVByXXL660RuiqDb3Arkyhl9TANkZUNqYkGACw8GaW4ek8XWtBDqfIeM5kI /J0XajQXu/dsADiI1DxKHSk3BWKveUsf1zjKPQDW7Vau+E3SLPEY8mDogQq0oWkRi/aU y8Ug== X-Gm-Message-State: AOAM532Mkzpljg/he/ck2HZTGhNbaTa8dcOfyvzpVe/0OaWzrqrr4L90 zLB63LewqOUhPqLRNmsIIZ/VDA6oXQ7s2GVr3cQ= X-Google-Smtp-Source: ABdhPJyO40JrOlywLhaSXIbRH+8U+cxZ5Z5RpuTfzBBXMTFk1yCpgPgnJxJK0N+9iFAUhs7LiTF5L4TOSBoaQX9WY9U= X-Received: by 2002:a5d:970c:: with SMTP id h12mr43029960iol.103.1609334720546; Wed, 30 Dec 2020 05:25:20 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Michael Schuster Date: Wed, 30 Dec 2020 14:25:09 +0100 Message-ID: Subject: Re: graphics on amd radeon vega To: Vasily Postnicov Cc: Oskar Sharipov , freeBSD Mailing List X-Rspamd-Queue-Id: 4D5X8f2qPlz3Pp0 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=iz5Pggc0; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::d2f as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-2.04 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d2f:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(0.96)[0.958]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d2f:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d2f:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 13:25:23 -0000 On Wed, Dec 30, 2020 at 2:01 PM Vasily Postnicov wrote: > Does sysctl -a | grep exp_hw_support show anything? > indeed it does: $ sysctl -a | grep exp_hw_support hw.amdgpu.exp_hw_support: 0 compat.linuxkpi.amdgpu_exp_hw_support: 0 $ > Usual way to tweak kernel parameters is via sysctl. > from looking at other settings, I would guess I need to put this in /boot/loader.conf to make this persistent across reboot ... correct? (again, sorry if that's an FAQ - feel free to point me to documentation about this) > But this is linux stuff so it can be anything else. > > If sysctl does not help, you can recompile the whole driver changing > int amdgpu_exp_hw_support =3D 0; > to > int amdgpu_exp_hw_support =3D 1; > in drivers/gpu/drm/amd/amdgpu/amdgpu_drv.c > I already found that, though I wanted to keep that as a very last resort :-= ) thx Michael > > =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 15:17 Michael Schuster= : > >> On Tue, Dec 29, 2020 at 3:35 PM Oskar Sharipov >> wrote: >> >> > On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: >> > > 13-CURRENT supports that chip. See >> > > >> > >> https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm/a= md/amdgpu/amdgpu_drv.c >> > > >> > > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, >> CHIP_RAVEN|AMD_IS_APU} >> > >> > Oh, wow. Then I will consider could I try CURRENT now or wait >> > until it released. Thank you! >> > >> >> when I Install this version on current as of today, I see this in >> /var/log/messages: >> >> Dec 30 13:11:56 hbeast kernel: [drm] amdgpu kernel modesetting enabled. >> Dec 30 13:11:56 hbeast kernel: drmn0: on vgapci0 >> Dec 30 13:11:56 hbeast kernel: [drm] This hardware requires experimental >> hardware support. >> Dec 30 13:11:56 hbeast kernel: See modparam exp_hw_support >> Dec 30 13:11:56 hbeast kernel: device_attach: drmn0 attach returned 19 >> sorry if this is an FAQ, but I couldn't find an answer: how do I >> enable/modify "modparam exp_hw_support"? >> >> thx >> Michael >> >> -- >> Michael Schuster >> http://recursiveramblings.wordpress.com/ >> recursion, n: see 'recursion' >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to " >> freebsd-questions-unsubscribe@freebsd.org" >> > --=20 Michael Schuster http://recursiveramblings.wordpress.com/ recursion, n: see 'recursion' From owner-freebsd-questions@freebsd.org Wed Dec 30 13:54:21 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B57024C3E6B for ; Wed, 30 Dec 2020 13:54:21 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: from mail-ot1-x330.google.com (mail-ot1-x330.google.com [IPv6:2607:f8b0:4864:20::330]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5Xp41Vd3z3R7w for ; Wed, 30 Dec 2020 13:54:19 +0000 (UTC) (envelope-from shamaz.mazum@gmail.com) Received: by mail-ot1-x330.google.com with SMTP id w3so15401110otp.13 for ; Wed, 30 Dec 2020 05:54:19 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=6lYnFnNgR1G39uwHxyu2GIUDf2C1fVvHERIzwbmjkU4=; b=AWamKtb3KW/MQrskCK6/mJWfwOf81SFWM+ivIGurNpDpJ6C4uC0bet4lRVGWyEy+WJ gkqIAd3UG3iwHmc6z1sNpkBNnpLvjMGpuBc+RQQ8lDYlR3YSLN48NnPtvi8p/5r2K2MI yGzDm31SHFrpfQFr4EPZUkUPfhh76XKMhxCE2gpi4PqPCTAnAjHQYXg7mEmTRmRgAsx+ gs47XeU146thmrmiLbNdTqHLObaBXcmMWyOa6gchX/EWXrdgd0iWUBstk3GewwCsUkls e6LUMg6e+/nJpqJSdGKdAKbGrrwT0+Vtz1Pk6JTli/LxJjfk9G7WvG9GO3gEApIG+3yh on3w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=6lYnFnNgR1G39uwHxyu2GIUDf2C1fVvHERIzwbmjkU4=; b=YQ8hSNL/WoBjdTtC++o3VrZX06r1OhOxvncROlMxkXRmFKsx7xw6+R3gt1vUKWR3Qr DlbySVMnGpyGUhZeQdTPFUcSTBdpL30+w6rGUoqiEMXHFa+b9AVseJFVVpDwjFwR8ZjE tqPY27XKhGWFDLEdPslt/H2+uo0XNATehRBPzOYCFVpHtvr5UznyxIZ8vbfjPJq+8PxK ri+dJdC6lpsWZalUk1IjcO4jXECId8IbTJjgzwNFC8D8bxx70gUtetP2TRWA2CX+879a 89FyUux1+GPioOVBEvRtSKrHiIb1dfp/tGlXZpa0F82F5ggKpbFYMJQiDaEahgFLcIzw Fn0Q== X-Gm-Message-State: AOAM531U1jjoEKBVMIYfE7Jt1krC6Ye8DCF23M20O7WpmXGlyG7SMbIG rWKUjIZQXVsOE8evwiA4IW8+FRV0Oz7lpKFCGYY= X-Google-Smtp-Source: ABdhPJzO4V5yaTVx+8vp/464bb2NU5x7kHMvABB0pUN678F/ufFb/6cYt4yrubYHKFKSghYZyhuPm4T66uvlv0sxzrM= X-Received: by 2002:a05:6830:13d2:: with SMTP id e18mr40150511otq.366.1609336458836; Wed, 30 Dec 2020 05:54:18 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Vasily Postnicov Date: Wed, 30 Dec 2020 16:54:07 +0300 Message-ID: Subject: Re: graphics on amd radeon vega To: Michael Schuster Cc: Oskar Sharipov , freeBSD Mailing List X-Rspamd-Queue-Id: 4D5Xp41Vd3z3R7w X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=AWamKtb3; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of shamazmazum@gmail.com designates 2607:f8b0:4864:20::330 as permitted sender) smtp.mailfrom=shamazmazum@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::330:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::330:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::330:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 13:54:21 -0000 Cannot say for sure where you need to place that. Its either /boot/loader.conf or /etc/sysctl.conf The second sets sysctls later in the boot process. And it can not set tunables, of course. I suggest you figure it yourself) =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 16:25 Michael Schuster <= michaelsprivate@gmail.com>: > > > On Wed, Dec 30, 2020 at 2:01 PM Vasily Postnicov > wrote: > >> Does sysctl -a | grep exp_hw_support show anything? >> > > indeed it does: > $ sysctl -a | grep exp_hw_support > hw.amdgpu.exp_hw_support: 0 > compat.linuxkpi.amdgpu_exp_hw_support: 0 > $ > >> Usual way to tweak kernel parameters is via sysctl. >> > > from looking at other settings, I would guess I need to put this in > /boot/loader.conf to make this persistent across reboot ... correct? > (again, sorry if that's an FAQ - feel free to point me to documentation > about this) > >> But this is linux stuff so it can be anything else. >> >> If sysctl does not help, you can recompile the whole driver changing >> int amdgpu_exp_hw_support =3D 0; >> to >> int amdgpu_exp_hw_support =3D 1; >> in drivers/gpu/drm/amd/amdgpu/amdgpu_drv.c >> > > I already found that, though I wanted to keep that as a very last resort > :-) > > thx > Michael > >> >> =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 15:17 Michael Schuste= r : >> >>> On Tue, Dec 29, 2020 at 3:35 PM Oskar Sharipov >>> wrote: >>> >>> > On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: >>> > > 13-CURRENT supports that chip. See >>> > > >>> > >>> https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm/= amd/amdgpu/amdgpu_drv.c >>> > > >>> > > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, >>> CHIP_RAVEN|AMD_IS_APU} >>> > >>> > Oh, wow. Then I will consider could I try CURRENT now or wait >>> > until it released. Thank you! >>> > >>> >>> when I Install this version on current as of today, I see this in >>> /var/log/messages: >>> >>> Dec 30 13:11:56 hbeast kernel: [drm] amdgpu kernel modesetting enabled. >>> Dec 30 13:11:56 hbeast kernel: drmn0: on vgapci0 >>> Dec 30 13:11:56 hbeast kernel: [drm] This hardware requires experimenta= l >>> hardware support. >>> Dec 30 13:11:56 hbeast kernel: See modparam exp_hw_support >>> Dec 30 13:11:56 hbeast kernel: device_attach: drmn0 attach returned 19 >>> sorry if this is an FAQ, but I couldn't find an answer: how do I >>> enable/modify "modparam exp_hw_support"? >>> >>> thx >>> Michael >>> >>> -- >>> Michael Schuster >>> http://recursiveramblings.wordpress.com/ >>> recursion, n: see 'recursion' >>> _______________________________________________ >>> freebsd-questions@freebsd.org mailing list >>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>> To unsubscribe, send any mail to " >>> freebsd-questions-unsubscribe@freebsd.org" >>> >> > > -- > Michael Schuster > http://recursiveramblings.wordpress.com/ > recursion, n: see 'recursion' > From owner-freebsd-questions@freebsd.org Wed Dec 30 14:41:46 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DDADA4C55A0 for ; Wed, 30 Dec 2020 14:41:46 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-io1-xd33.google.com (mail-io1-xd33.google.com [IPv6:2607:f8b0:4864:20::d33]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5Yrn6LBcz3kfq for ; Wed, 30 Dec 2020 14:41:45 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-io1-xd33.google.com with SMTP id 81so14814809ioc.13 for ; Wed, 30 Dec 2020 06:41:45 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=HzL1acdNYzOZdRoJCb78Jnu8qadA1Uzfee5g0CqeHkI=; b=rqyeFm1xTmySIvRNMnEAteN7DxJ+WGPneUfxEJLuieKZvWJjMRncQKDrSZ72Q+XefP Jk64RjaXxCrmtJz2E8h/IsNplvEaEt7SqZHQR8pN2AHoGRpI46d4OUta6oy22BMthuJ1 XspU7lENM2SAdvvjBuFmpTffjW9wWmPZW5DJRuu7u1B+ttO5NLkIga4aSiIVeN5vQxin ttdhgpBHuJh1Wf4KYPqE8jbw0H464zZH1QELz6eJRSoX/b/bk9J3GnOABhNSa5nf21lm Hfcy+m72qYOs+8q81I0hVKgI2pF/lMEFMQy//Ibgr8b8kivMpsjTxLRUJBNG+GzkERgk S05A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=HzL1acdNYzOZdRoJCb78Jnu8qadA1Uzfee5g0CqeHkI=; b=Z/foHZ3/Zn6OX2mentQKK/MdINMluXIOQ55nWR25TDShx1dHeduSJ0HWs2kInyy+P8 vJNG0osRC5jBeqEKpnq2vfMeQXvliYRER6KHZkspur9dKO3TJY37EDhgrszK4f/kDT4x qkczVfLDs12/HBikPZW4YVYmlzRQd9SkXuPLkzTAIevNLZjhwA+jSRCR6QbjCerZx0p7 0edwUceDSap+UsdcVk1gRgniV8IaPB5EuOzbHmfWZtfezRA20477E05LqDHFuEwpoBOG P0qF+B1tNpcgYAXZ/SIEoaDDrREkmWrC1HRFL5UEseYZrGtP6XoOjpGoviAVMbDrVYaQ 2UPQ== X-Gm-Message-State: AOAM5307YYxpcFM6FVNzv7zSPi91kWJ5tzz2KTW7M7A7VYZ/wXOtfVYx agl+T0b6W/Nd6Td422KNTfyeIC+CuOXjdYOLo6Fn8QKHakW/Dw== X-Google-Smtp-Source: ABdhPJzYB1l/RNCLOBxejz/AZBaBDsVhWDTjxRWSMrLfkzmO6UjQGDhKZMF2lRycSJOSLmogN2PcICbOzM297q50w8c= X-Received: by 2002:a02:354a:: with SMTP id y10mr47321212jae.126.1609339304491; Wed, 30 Dec 2020 06:41:44 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Michael Schuster Date: Wed, 30 Dec 2020 15:41:39 +0100 Message-ID: Subject: Re: graphics on amd radeon vega To: Vasily Postnicov Cc: Oskar Sharipov , freeBSD Mailing List X-Rspamd-Queue-Id: 4D5Yrn6LBcz3kfq X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=rqyeFm1x; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::d33 as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d33:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d33:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d33:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 14:41:46 -0000 On Wed, Dec 30, 2020 at 2:54 PM Vasily Postnicov wrote: > Cannot say for sure where you need to place that. Its either > /boot/loader.conf or /etc/sysctl.conf > > The second sets sysctls later in the boot process. And it can not set > tunables, of course. > > I suggest you figure it yourself) > will do, many thanks! Michael > > =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 16:25 Michael Schuster= : > >> >> >> On Wed, Dec 30, 2020 at 2:01 PM Vasily Postnicov >> wrote: >> >>> Does sysctl -a | grep exp_hw_support show anything? >>> >> >> indeed it does: >> $ sysctl -a | grep exp_hw_support >> hw.amdgpu.exp_hw_support: 0 >> compat.linuxkpi.amdgpu_exp_hw_support: 0 >> $ >> >>> Usual way to tweak kernel parameters is via sysctl. >>> >> >> from looking at other settings, I would guess I need to put this in >> /boot/loader.conf to make this persistent across reboot ... correct? >> (again, sorry if that's an FAQ - feel free to point me to documentation >> about this) >> >>> But this is linux stuff so it can be anything else. >>> >>> If sysctl does not help, you can recompile the whole driver changing >>> int amdgpu_exp_hw_support =3D 0; >>> to >>> int amdgpu_exp_hw_support =3D 1; >>> in drivers/gpu/drm/amd/amdgpu/amdgpu_drv.c >>> >> >> I already found that, though I wanted to keep that as a very last resort >> :-) >> >> thx >> Michael >> >>> >>> =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 15:17 Michael Schust= er : >>> >>>> On Tue, Dec 29, 2020 at 3:35 PM Oskar Sharipov >>>> wrote: >>>> >>>> > On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: >>>> > > 13-CURRENT supports that chip. See >>>> > > >>>> > >>>> https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/drm= /amd/amdgpu/amdgpu_drv.c >>>> > > >>>> > > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, >>>> CHIP_RAVEN|AMD_IS_APU} >>>> > >>>> > Oh, wow. Then I will consider could I try CURRENT now or wait >>>> > until it released. Thank you! >>>> > >>>> >>>> when I Install this version on current as of today, I see this in >>>> /var/log/messages: >>>> >>>> Dec 30 13:11:56 hbeast kernel: [drm] amdgpu kernel modesetting enabled= . >>>> Dec 30 13:11:56 hbeast kernel: drmn0: on vgapci0 >>>> Dec 30 13:11:56 hbeast kernel: [drm] This hardware requires experiment= al >>>> hardware support. >>>> Dec 30 13:11:56 hbeast kernel: See modparam exp_hw_support >>>> Dec 30 13:11:56 hbeast kernel: device_attach: drmn0 attach returned 19 >>>> sorry if this is an FAQ, but I couldn't find an answer: how do I >>>> enable/modify "modparam exp_hw_support"? >>>> >>>> thx >>>> Michael >>>> >>>> -- >>>> Michael Schuster >>>> http://recursiveramblings.wordpress.com/ >>>> recursion, n: see 'recursion' >>>> _______________________________________________ >>>> freebsd-questions@freebsd.org mailing list >>>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>>> To unsubscribe, send any mail to " >>>> freebsd-questions-unsubscribe@freebsd.org" >>>> >>> >> >> -- >> Michael Schuster >> http://recursiveramblings.wordpress.com/ >> recursion, n: see 'recursion' >> > --=20 Michael Schuster http://recursiveramblings.wordpress.com/ recursion, n: see 'recursion' From owner-freebsd-questions@freebsd.org Wed Dec 30 17:30:41 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DAC624C95F6 for ; Wed, 30 Dec 2020 17:30:41 +0000 (UTC) (envelope-from dalescott@shaw.ca) Received: from smtp-out-no.shaw.ca (smtp-out-no.shaw.ca [64.59.134.9]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5dbh4yJ3z3vxm for ; Wed, 30 Dec 2020 17:30:40 +0000 (UTC) (envelope-from dalescott@shaw.ca) Received: from cds220.dcs.int.inet ([10.0.153.144]) by shaw.ca with ESMTP id ufIzktkU5tdldufJ0k6ycV; Wed, 30 Dec 2020 10:30:39 -0700 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=shaw.ca; s=s20180605; t=1609349439; bh=gfSkvXsD/5fFVzZvZuf6rXp0pz3A1UNNdbrv/skWdx4=; h=Date:From:To:Cc:In-Reply-To:References:Subject; b=GATdmK8xcDeqYrbi22Qa/BbZ3xueLUnLRA6Gr+sNMK/Sgekb+YNkRrxB3VdH2z1rk fCZQ2yz9En4leOGwecs7KVjnqqF2J83lJHWPoa502rKdlp2Ni+YE7cWSryK9Nb3+mv A5ZV4DBHMrGEEczGgctZqVoI/d3mxG8idZFQhvZF1nvomMpxq7TY0Twi9I88DfoLDC bwAG9RM7uafAFqX29EhygOrCAjxbiUZFdLKGlBBqakj/VGWZVtZAhBZJWtQVwnc6LL JlVV+tuNC0q6PWuDqx/+idvjux6ZAr2Hs7QOoD4YViqhelJOfME1SkE1b6Vx2u80eO R90zjxCAy87eA== X-Authority-Analysis: v=2.4 cv=INe8tijG c=1 sm=1 tr=0 ts=5fecb93f a=YjOmSjUxhsfmstj0eziGpw==:117 a=FKkrIqjQGGEA:10 a=on0NmgUIp3IA:10 a=IkcTkHD0fZMA:10 a=4yi-b2ezAAAA:8 a=VVlED5B4AAAA:8 a=6I5d2MoRAAAA:8 a=-ZeFNFY7iW2JdypIDtQA:9 a=QEXdDO2ut3YA:10 a=TQxA5NB98t1WezocIkIN:22 a=IjZwj45LgO3ly-622nXo:22 Date: Wed, 30 Dec 2020 10:30:37 -0700 (MST) From: Dale Scott To: "Kevin P. Neal" , CerebrosuS Cc: freebsd-questions Message-ID: <29490187.204174646.1609349437600.JavaMail.zimbra@shaw.ca> In-Reply-To: References: Subject: Re: Project information - SMBv2+ MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 7bit X-Originating-IP: [162.223.103.50, 162.223.103.50] X-Mailer: Zimbra 8.8.15_GA_3968 (ZimbraWebClient - GC87 (Win)/8.8.15_GA_3968) Thread-Topic: Project information - SMBv2+ Thread-Index: lmuEDp3H8kRlHbMBVN7xqFbFsC2mzQ== X-CMAE-Envelope: MS4xfG/HNrL7vNfCfX2j0+pGLotkDvh3L94jAZZ7q7/j2WAoSQpt3vJy5KeUu+cyBqUXQnAEG6q2hohX6gVlMQSYliOss2Lj7OIpn8W5WY2AWtV3AaJTyUpM 1HI/UzfWEg6Ph0ePGbbMJceCusCCrrfb+sGw0XPLHAYZ7FjhXKNPmIhstMO9NRgvjHjUzbbOexkvQa4pjGSneO/U8hTlRssLNTTxoMbzqaO8AdMsV+HJCFOc 8vH7Gza/fVyDNwKJPSZtikEafK9s8ftJwfGFV8L5HHQ= X-Rspamd-Queue-Id: 4D5dbh4yJ3z3vxm X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=shaw.ca header.s=s20180605 header.b=GATdmK8x; dmarc=pass (policy=none) header.from=shaw.ca; spf=pass (mx1.freebsd.org: domain of dalescott@shaw.ca designates 64.59.134.9 as permitted sender) smtp.mailfrom=dalescott@shaw.ca X-Spamd-Result: default: False [-4.10 / 15.00]; HAS_XOIP(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[64.59.134.9:from]; R_SPF_ALLOW(-0.20)[+ip4:64.59.134.0/25]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[shaw.ca:+]; DMARC_POLICY_ALLOW(-0.50)[shaw.ca,none]; NEURAL_HAM_SHORT(-1.00)[-0.996]; FREEMAIL_TO(0.00)[neutralgood.org,gmx.net]; RCVD_IN_DNSWL_LOW(-0.10)[64.59.134.9:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[64.59.134.9:from]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[shaw.ca:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[shaw.ca:s=s20180605]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; ASN(0.00)[asn:6327, ipnet:64.59.128.0/20, country:CA]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_LAST(0.00)[]; SPAMHAUS_ZRD(0.00)[64.59.134.9:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 17:30:41 -0000 ----- Original Message ----- > From: "Kevin P. Neal" > To: "CerebrosuS" > Cc: "freebsd-questions" > Sent: Tuesday, December 29, 2020 7:35:51 PM > Subject: Re: Project information - SMBv2+ > On Mon, Dec 28, 2020 at 10:13:07PM +0100, CerebrosuS wrote: >> Hello at all, >> >> the community and developer at FreeBSD seem to know, that SMBv1 for >> clients is nearly over and that the included mount_smbfs doesn't support >> newer versions. So good, so far... >> >> So I can find multiple information about the situation, but no clear >> path on how FreeBSD community and developer will go on to solve this >> missing function. (Just got the information on: >> https://wiki.freebsd.org/MateuszPiotrowski/AccessingSmbSharesWithSambaClient) Can someone give a quick big picture? What would this mean for someone e.g. wanting to build an enterprise file server? Can FreeBSD currently serve (I see latest samba413 is in ports), but not connect as client to other (newer) servers? Thanks > > Two days with no response... I suggest trying the freebsd-hackers list > instead, or the freebsd-arch list if that doesn't work, and my last > guess would be freebsd-current. Only try one list at a time. > From owner-freebsd-questions@freebsd.org Wed Dec 30 17:54:34 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8B6914C9ECB for ; Wed, 30 Dec 2020 17:54:34 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) Received: from mout.gmx.net (mout.gmx.net [212.227.15.15]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5f7F3kDCz4Rf6 for ; Wed, 30 Dec 2020 17:54:33 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1609350867; bh=9qrR102FBfW4t360T8/ZrdVvcg3+peF9UMMpGqFhPIg=; h=X-UI-Sender-Class:Subject:To:Cc:References:From:Date:In-Reply-To; b=NlxGcVs3431TEGEu55K/D6Tf60xtcpw9SWHTvzvk+NT6sdNKVk0wd3GHxZslapf3L BZ8mqhfPC0/oiOx5nJIcSOlVrBjwU9plhWYLV/2uXYOSd5ffuQnHVt2X89F/dIeff5 3rub1Rcw3yYDpnSwggb7M1IaRwV/+cXAjQbn9Z9I= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from [2.2.3.2] ([87.122.30.127]) by mail.gmx.com (mrgmx004 [212.227.17.190]) with ESMTPSA (Nemesis) id 1N7R1T-1jwJjS14Wr-017paW; Wed, 30 Dec 2020 18:54:27 +0100 Subject: Re: Project information - SMBv2+ To: Dale Scott , "Kevin P. Neal" Cc: freebsd-questions References: <29490187.204174646.1609349437600.JavaMail.zimbra@shaw.ca> From: CerebrosuS Message-ID: Date: Wed, 30 Dec 2020 18:54:26 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: <29490187.204174646.1609349437600.JavaMail.zimbra@shaw.ca> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: quoted-printable X-Provags-ID: V03:K1:K5E/0N6w3v2ojP1AszycJmzLqPT/ijdTmXiyGHAmZrWAsq+i940 2yT1NA2RSHtGlF3OhvH78fM7svEg+8m0B4ezIZuvN+B7xpU8+OTQfXgoL7BqPuzi+++6MAZ Z4r3KfODalumtwmM9YyV07cXOm6lsD2jmFmRgfXnMcTocWWFyWI4WhaDC07H0He3b0gZlWw NmBnluRRcvbJS4865yhWw== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:zdY9GnorZNM=:dCRIhMXXUkbMfp2QVQas/l HTtooTYoQXUlOWFMG2Q/Yx35pw2f9fXhTqM+9g2GOUlAT4gV/DqTF+SqoxIo44i0LzYmspXZP REgKN8xp8iVzA08yVnUjaoZr+fV+4BqruXQKY26Sb/9o2MlwNU8KqZSOUdDD/qNOwWVoyzR7Q GhP8TOG5BQB8rmTxQLdQuSB7cV+/yZQDNU4+kdAT+TlOoe1iLPCufMC63z+TTcr5h49wOX+Ot Z4HNp0b93Fmp8sgyyOrLeRLeIlys5L58XPPbEqoVnmWxJuxdrlm2ZIbMQqoluMaB3lmRK1/0b 8bBYDyRPCodveJXzts5UYZaKZIbhkZDa7cRO6ZTl5dFHIpRMI9uDsAJGsqpiDu9BihhZjX4l6 SBJoRiZdeWS/OSBQhJL1BSzs/j14ii4ePVeVlwB+/v2e+2nB6M2c5pQwZ3LLLHaQRMjLPquD4 mWwJOm+Y8cTLaW47N8MDrhlw75RCz8yY20O/GYkqb5Odb3y+ypm082787CUyWMtxiUWHCMLCz O7WhisXkeGwJ2KjB8rVzH0k00PWZ4CnTi8801e+shmFzAnevaZL7M8xA+zRMgEMdZ6MSBZOSI x3rsmfUlCyuzJPbhwels6RwhR3YnSB3zte3aagcvJHUyocwIoBP7Gwsc3hschtMCZAa3Z862Q 0bPmothtYf9vm0p8T5/eTBdXNi9jgO/iR5oEG8hZrAYixkVy+V0l0Rj1ylOB2h3VF03yR88p9 Df2HOibAh8TN2VjAPjS0Yd4s6tEn57BbEIHg0t+NTh8EsU82Px/Lkzu1K/6R0fUJ6GbeENnHS 5i1Jpjrzr0qoILULD8ygjmvM8UPxhKd2MgtVwu4OrHddLPKL+bDKVYuSbckHSFpijr+FrY6lU xlDEvYYBq6RJ1SUw9H0w== X-Rspamd-Queue-Id: 4D5f7F3kDCz4Rf6 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmx.net header.s=badeba3b8450 header.b=NlxGcVs3; dmarc=pass (policy=none) header.from=gmx.net; spf=pass (mx1.freebsd.org: domain of CerebrosuS@gmx.net designates 212.227.15.15 as permitted sender) smtp.mailfrom=CerebrosuS@gmx.net X-Spamd-Result: default: False [-2.77 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmx.net]; R_SPF_ALLOW(-0.20)[+ip4:212.227.15.0/25]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmx.net:+]; DMARC_POLICY_ALLOW(-0.50)[gmx.net,none]; RCVD_IN_DNSWL_LOW(-0.10)[212.227.15.15:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmx.net]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.15.15:from]; DWL_DNSWL_NONE(0.00)[gmx.net:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmx.net:s=badeba3b8450]; RECEIVED_SPAMHAUS_PBL(0.00)[87.122.30.127:received]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; NEURAL_SPAM_SHORT(0.33)[0.333]; SPAMHAUS_ZRD(0.00)[212.227.15.15:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.15.15:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 17:54:34 -0000 Am 30.12.20 um 18:30 schrieb Dale Scott: > ----- Original Message ----- >> From: "Kevin P. Neal" >> To: "CerebrosuS" >> Cc: "freebsd-questions" >> Sent: Tuesday, December 29, 2020 7:35:51 PM >> Subject: Re: Project information - SMBv2+ > >> On Mon, Dec 28, 2020 at 10:13:07PM +0100, CerebrosuS wrote: >>> Hello at all, >>> >>> the community and developer at FreeBSD seem to know, that SMBv1 for >>> clients is nearly over and that the included mount_smbfs doesn't suppo= rt >>> newer versions. So good, so far... >>> >>> So I can find multiple information about the situation, but no clear >>> path on how FreeBSD community and developer will go on to solve this >>> missing function. (Just got the information on: >>> https://wiki.freebsd.org/MateuszPiotrowski/AccessingSmbSharesWithSamba= Client) > > Can someone give a quick big picture? What would this mean for someone e= .g. > wanting to build an enterprise file server? Can FreeBSD currently serve = (I see > latest samba413 is in ports), but not connect as client to other (newer)= servers? > > Thanks The problem is using FreeBSD as an SMB client. SMBv1 is possible through mount_smbfs. SMBv2+ is possible with gvfs and smbnetfs from fuse. SMBv1 has some bad security issues (thats' why everyone is switching to SMBv2+) and MS Windows 10 switched to SMBv2+ meaning, SMBv1 is not supported by default. The fuse module is known be slow and unstable. I read the "unstable" and "slow" argument for gvfs too, but have only tested the fuse module. Third party packages are also problematic when using with /etc/fstab (there seem to be some workarounds with extension scripts). So to use freebsd as an SMB client would need to extend the mount_smbfs module or invest time to speed up smbnetfs/gvfs to make it usable. For an enterprise file server serving samba is no problem as far as I know and as long as you don't need to mount SMB sources to serve the data. Anyone might want to correct me, if my collected information are wrong. :-= ) > >> >> Two days with no response... I suggest trying the freebsd-hackers list >> instead, or the freebsd-arch list if that doesn't work, and my last >> guess would be freebsd-current. Only try one list at a time. >> > > > > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.= org" > From owner-freebsd-questions@freebsd.org Wed Dec 30 18:02:23 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C7F114CA2F4 for ; Wed, 30 Dec 2020 18:02:23 +0000 (UTC) (envelope-from ml@netfence.it) Received: from soth.netfence.it (mailserver.netfence.it [78.134.96.152]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mailserver.netfence.it", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5fJG1zlZz4ST5 for ; Wed, 30 Dec 2020 18:02:21 +0000 (UTC) (envelope-from ml@netfence.it) Received: from alamar.ventu (alamar.local.netfence.it [10.1.2.18]) (authenticated bits=0) by soth.netfence.it (8.16.1/8.16.1) with ESMTPSA id 0BUI2CBx072808 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO); Wed, 30 Dec 2020 19:02:13 +0100 (CET) (envelope-from ml@netfence.it) X-Authentication-Warning: soth.netfence.it: Host alamar.local.netfence.it [10.1.2.18] claimed to be alamar.ventu Subject: Re: Project information - SMBv2+ To: CerebrosuS , Dale Scott , "Kevin P. Neal" Cc: freebsd-questions References: <29490187.204174646.1609349437600.JavaMail.zimbra@shaw.ca> From: Andrea Venturoli Message-ID: Date: Wed, 30 Dec 2020 19:02:11 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4D5fJG1zlZz4ST5 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=pass (policy=none) header.from=netfence.it; spf=pass (mx1.freebsd.org: domain of ml@netfence.it designates 78.134.96.152 as permitted sender) smtp.mailfrom=ml@netfence.it X-Spamd-Result: default: False [-3.78 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+ip4:78.134.96.152]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; HAS_XAW(0.00)[]; ARC_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[78.134.96.152:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-0.98)[-0.979]; DMARC_POLICY_ALLOW(-0.50)[netfence.it,none]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmx.net,shaw.ca,neutralgood.org]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:35612, ipnet:78.134.0.0/17, country:IT]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RBL_DBL_DONT_QUERY_IPS(0.00)[78.134.96.152:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 18:02:23 -0000 On 12/30/20 6:54 PM, CerebrosuS wrote: > Anyone might want to correct me, if my collected information are wrong. :-) I think you exposed everything correctly. Also I would add: if booting from the live ISO image, you only have mount_smbfs (which is nowaday useless) and hardly any chance to install packages. So I was hit when I tried to use FreeBSD as an emergency tool. (I know it was not meant to be that and there are probably better alternatives, but, as I said, it was emergency and that's what I had at hand). bye av. From owner-freebsd-questions@freebsd.org Wed Dec 30 18:20:24 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7D4994CACFB for ; Wed, 30 Dec 2020 18:20:24 +0000 (UTC) (envelope-from kurt.buff@gmail.com) Received: from mail-ed1-x52d.google.com (mail-ed1-x52d.google.com [IPv6:2a00:1450:4864:20::52d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5fj35W0Tz4Ts3 for ; Wed, 30 Dec 2020 18:20:23 +0000 (UTC) (envelope-from kurt.buff@gmail.com) Received: by mail-ed1-x52d.google.com with SMTP id u19so16193115edx.2 for ; Wed, 30 Dec 2020 10:20:23 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=gGXRlvOCM3CEPpv2Yk/t/OBBpwKI6murFTBQ0cqScuo=; b=runZNaQ/PhWrYQevBf0IhfSBrD6m0dsLzbM5Mp1UDX9LdFsLtlRLgQJdG/dV6E9t0X 0h37BoeczEnl+dunzpZMM4W3TFSt8k3TVYJ0MZE2fhNvs1QGI/37t47QmkHDs+fC5WgO 0ypUlwEnScrcfdzwW4WQKQrAubmE6iCPDrZtBG++1Orxe7nAjvuuaaPl5baGcK4S81wx ejaU1OAjCuto9I3wXXUSch6OYxZ6xrdCihbz3styQgiCYCkIyR/zZWTLPIUbHTIefbqp B40aKDVJoUqmHJmKiB0mkuex0YLHT7pQLn1/58TZtBYRMFq8RZAdZo218sONHFAkaEUu At7g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=gGXRlvOCM3CEPpv2Yk/t/OBBpwKI6murFTBQ0cqScuo=; b=g/0qAhcn03qFzxycw7ltsbuKVpzbzvFTjboOTYPxnj82GNvMkTVTYrWECQVqjIc+uy ZqpWUbzc9qjTaqKsAru5HEPM8BhD2MMjkavHXzcd3CPfzEA0kRsPvlRTJhF3JTepzT+u uCGM0otiZ2oGP/p6D+UYY9Q1AYSmqh8vPAbP47mPqabMTx4aHO2xToPuKnzjhwDo39sj US80zSEFljgwJLl4vzIf8SN6fQt8CNKsmdU9TQR1vVJ30uDlEJuH/XS5BWBupr7jnjMC ZI3IsJSLCvC/42VohjYrC/SmX+jxkiZAahBGtDC/1K0mBbyRrIEQqCHg/SfOvtA4jiHB Xedw== X-Gm-Message-State: AOAM533+f1nOJXPcyn44S+zEDT9Wrx/mqxhE9Oy9VBhQrT4v2axvxcTE Yre4DpLwH6E+PsjVy1LZhmF3CQcWJpfROtFdiq4TQ4Ke91A= X-Google-Smtp-Source: ABdhPJz8kRyo1JazV7vgKehOt9ZAw9RDY/KxTnOF/67FXCsyGf/++8AMHa+OFEpP1pfM/Rk8G2N46m3nZOmJvgd/Ras= X-Received: by 2002:a05:6402:3048:: with SMTP id bu8mr51721182edb.49.1609352422365; Wed, 30 Dec 2020 10:20:22 -0800 (PST) MIME-Version: 1.0 References: <29490187.204174646.1609349437600.JavaMail.zimbra@shaw.ca> In-Reply-To: From: "Kurt Buff, GSEC/GCIH/PCIP" Date: Wed, 30 Dec 2020 11:20:08 -0700 Message-ID: Subject: Re: Project information - SMBv2+ To: freebsd-questions Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4D5fj35W0Tz4Ts3 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=runZNaQ/; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kurtbuff@gmail.com designates 2a00:1450:4864:20::52d as permitted sender) smtp.mailfrom=kurtbuff@gmail.com X-Spamd-Result: default: False [-2.04 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::52d:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::52d:from:127.0.2.255]; NEURAL_SPAM_SHORT(0.96)[0.957]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::52d:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 18:20:24 -0000 On Wed, Dec 30, 2020 at 10:54 AM CerebrosuS wrote: > > Am 30.12.20 um 18:30 schrieb Dale Scott: > > ----- Original Message ----- > >> From: "Kevin P. Neal" > >> To: "CerebrosuS" > >> Cc: "freebsd-questions" > >> Sent: Tuesday, December 29, 2020 7:35:51 PM > >> Subject: Re: Project information - SMBv2+ > > > >> On Mon, Dec 28, 2020 at 10:13:07PM +0100, CerebrosuS wrote: > >>> Hello at all, > >>> > >>> the community and developer at FreeBSD seem to know, that SMBv1 for > >>> clients is nearly over and that the included mount_smbfs doesn't support > >>> newer versions. So good, so far... > >>> > >>> So I can find multiple information about the situation, but no clear > >>> path on how FreeBSD community and developer will go on to solve this > >>> missing function. (Just got the information on: > >>> https://wiki.freebsd.org/MateuszPiotrowski/AccessingSmbSharesWithSambaClient) > > > > Can someone give a quick big picture? What would this mean for someone e.g. > > wanting to build an enterprise file server? Can FreeBSD currently serve (I see > > latest samba413 is in ports), but not connect as client to other (newer) servers? > > > > Thanks > > The problem is using FreeBSD as an SMB client. SMBv1 is possible through > mount_smbfs. SMBv2+ is possible with gvfs and smbnetfs from fuse. SMBv1 > has some bad security issues (thats' why everyone is switching to > SMBv2+) and MS Windows 10 switched to SMBv2+ meaning, SMBv1 is not > supported by default. > > The fuse module is known be slow and unstable. I read the "unstable" and > "slow" argument for gvfs too, but have only tested the fuse module. > Third party packages are also problematic when using with /etc/fstab > (there seem to be some workarounds with extension scripts). > > So to use freebsd as an SMB client would need to extend the mount_smbfs > module or invest time to speed up smbnetfs/gvfs to make it usable. > > For an enterprise file server serving samba is no problem as far as I > know and as long as you don't need to mount SMB sources to serve the data. > > Anyone might want to correct me, if my collected information are wrong. :-) Not wrong, but using SMBv1 to serve files to machines which don't like that version of SMB will be an exercise in frustration. Kurt From owner-freebsd-questions@freebsd.org Wed Dec 30 19:53:01 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AC6D44CDA88 for ; Wed, 30 Dec 2020 19:53:01 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-il1-x134.google.com (mail-il1-x134.google.com [IPv6:2607:f8b0:4864:20::134]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D5hlx05lcz4bTW for ; Wed, 30 Dec 2020 19:53:00 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-il1-x134.google.com with SMTP id w17so15692629ilj.8 for ; Wed, 30 Dec 2020 11:53:00 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=nu7vlMftqhztSX3bvBfvAAj0OcZfMAs0L6NMfku8dOo=; b=bp1OmvZ/VgUif+FH6wEDdgZOGtTZ4/Qy9VNaAR/qNyP14KYF1Wv/WElhsNNHccFXT8 juWvhAiqm3hDsN3E6QiRxIKD1g4CKokxKdtOCbCO5bWF4fvRzgOo4KHUUR7w+KApmuw4 gvDFJROOYexJxGg60OnCDguZpqT0//kRGjjN4ON37Ck1VsM2J0wY3lMKO32BOHmonfZ5 qpX4F3iiWadiENs/uin9rYqC9hXmOUWz8qf8+uOc/Pl3NBvnomF4m+V+DDhCvtJV2ork S2YBlwH/4BMDhSHwfFTEqXvX6q89HylyP0RYky2UNWXTQW5x2b0j/PECztaAgwENQyr8 GqYQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=nu7vlMftqhztSX3bvBfvAAj0OcZfMAs0L6NMfku8dOo=; b=EGTReqX95WnEFFtMieQkTZPH4RYBCR9yEbA1QyFjSSVPcZgV3OccxphVhzHdKf+pnb 2bBtylyEdFN0OMfVU9eog2NbvMgzFKyICTad/vzpJjUqlFJzrVFn31FAjcoSe8UGt5OH 7dy5ri4I0qsS4LF9lKkuBCWicVrBICXfewZOY7z32BSsSr1o+wxj+J/RIylRP/jUtf6F KCcYfS0QYjNTpAkJFGsiyWkEkT+BbBdgdAqoFpgp/vrQHFvAT7eFrvS/IMKF6bJczPkp 220RnzdwsNRdpNVRi6QtLE5+tt2/AgRfPir3xL0EDDC0e+J0jqws+dESIrqWMVQ56kMB nodw== X-Gm-Message-State: AOAM533qYjiZyuK4zD/d/2XRfI9jO/Iw4fRN4Z3cDFyIQhFqMw/9WihJ AVsrjYxAXJiPEwRu/F+9sCaJq2+FsyEYCqRaPT0= X-Google-Smtp-Source: ABdhPJyoHKQOd+UETSL1gpHeDiRRN8kUhjjnr7EJNj+jUMM36niycdtCPHqKCZuGhptwV/sdUAPt3DsK9DsOEavZxSY= X-Received: by 2002:a05:6e02:1010:: with SMTP id n16mr52412712ilj.3.1609357980002; Wed, 30 Dec 2020 11:53:00 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Michael Schuster Date: Wed, 30 Dec 2020 20:52:49 +0100 Message-ID: Subject: Re: graphics on amd radeon vega To: Vasily Postnicov Cc: Oskar Sharipov , freeBSD Mailing List X-Rspamd-Queue-Id: 4D5hlx05lcz4bTW X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=bp1OmvZ/; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::134 as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-2.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::134:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::134:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::134:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 19:53:01 -0000 On Wed, Dec 30, 2020 at 3:41 PM Michael Schuster wrote: > > > On Wed, Dec 30, 2020 at 2:54 PM Vasily Postnicov > wrote: > >> Cannot say for sure where you need to place that. Its either >> /boot/loader.conf or /etc/sysctl.conf >> >> The second sets sysctls later in the boot process. And it can not set >> tunables, of course. >> >> I suggest you figure it yourself) >> > > will do, many thanks! > Michael > >> >> =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 16:25 Michael Schuste= r : >> >>> >>> >>> On Wed, Dec 30, 2020 at 2:01 PM Vasily Postnicov >>> wrote: >>> >>>> Does sysctl -a | grep exp_hw_support show anything? >>>> >>> >>> indeed it does: >>> $ sysctl -a | grep exp_hw_support >>> hw.amdgpu.exp_hw_support: 0 >>> compat.linuxkpi.amdgpu_exp_hw_support: 0 >>> $ >>> >>>> Usual way to tweak kernel parameters is via sysctl. >>>> >>> I set hw.amdgpu.exp_hw_support=3D"1" in /boot/loader.conf, which seemed to work, because I now see messages like this in /var/log/messages: Dec 30 20:02:10 hbeast kernel: amdgpu: [powerplay] smu driver if version = =3D 0x0000000a, smu fw if version =3D 0x0000000e, smu fw version =3D 0x00373800 (55.56.0) Dec 30 20:02:10 hbeast kernel: amdgpu: [powerplay] SMU driver if version not matched Dec 30 20:02:10 hbeast kernel: amdgpu: [powerplay] dpm has been disabled Dec 30 20:02:10 hbeast kernel: amdgpu: [powerplay] SMU is initialized successfully! Dec 30 20:02:10 hbeast kernel: [drm] VCN decode and encode initialized successfully(under DPG Mode). Dec 30 20:02:10 hbeast kernel: drmn0: ring gfx uses VM inv eng 0 on hub 0 Dec 30 20:02:10 hbeast kernel: drmn0: ring comp_1.0.0 uses VM inv eng 1 on hub 0 [...] Dec 30 20:02:10 hbeast kernel: drmn0: ring vcn_jpeg uses VM inv eng 6 on hub 1 Dec 30 20:02:10 hbeast kernel: [drm] Initialized amdgpu 3.35.0 20150101 for drmn0 on minor 0 which seems an improvement over before, though every invocation of "sysctl -a" causes a crash dump with this stack: (kgdb) bt #0 0xffffffff80c14083 in sched_switch () #1 0xffffffff80bf0635 in mi_switch () #2 0xffffffff80c3fe69 in sleepq_switch () #3 0xffffffff80c40246 in sleepq_catch_signals () #4 0xffffffff80c3ffa9 in sleepq_wait_sig () #5 0xffffffff80befb4a in _sleep () #6 0xffffffff80c5a3fa in pipe_read () #7 0xffffffff80c56fc1 in dofileread () #8 0xffffffff80c56b3c in sys_read () #9 0xffffffff81035fde in amd64_syscall () #10 #11 0x000000080039ee6a in ?? () ... so I reverted (or rather, returned to the previous build environment). cheers & thx Michael >>> from looking at other settings, I would guess I need to put this in >>> /boot/loader.conf to make this persistent across reboot ... correct? >>> (again, sorry if that's an FAQ - feel free to point me to documentation >>> about this) >>> >>>> But this is linux stuff so it can be anything else. >>>> >>>> If sysctl does not help, you can recompile the whole driver changing >>>> int amdgpu_exp_hw_support =3D 0; >>>> to >>>> int amdgpu_exp_hw_support =3D 1; >>>> in drivers/gpu/drm/amd/amdgpu/amdgpu_drv.c >>>> >>> >>> I already found that, though I wanted to keep that as a very last resor= t >>> :-) >>> >>> thx >>> Michael >>> >>>> >>>> =D1=81=D1=80, 30 =D0=B4=D0=B5=D0=BA. 2020 =D0=B3., 15:17 Michael Schus= ter >>> >: >>>> >>>>> On Tue, Dec 29, 2020 at 3:35 PM Oskar Sharipov >>>>> wrote: >>>>> >>>>> > On Tue, Dec 29, 2020 at 05:04:38PM +0300, Vasily Postnicov wrote: >>>>> > > 13-CURRENT supports that chip. See >>>>> > > >>>>> > >>>>> https://github.com/freebsd/drm-kmod/blob/drm_v5.4.62_4/drivers/gpu/dr= m/amd/amdgpu/amdgpu_drv.c >>>>> > > >>>>> > > > {0x1002, 0x15d8, PCI_ANY_ID, PCI_ANY_ID, 0, 0, >>>>> CHIP_RAVEN|AMD_IS_APU} >>>>> > >>>>> > Oh, wow. Then I will consider could I try CURRENT now or wait >>>>> > until it released. Thank you! >>>>> > >>>>> >>>>> when I Install this version on current as of today, I see this in >>>>> /var/log/messages: >>>>> >>>>> Dec 30 13:11:56 hbeast kernel: [drm] amdgpu kernel modesetting enable= d. >>>>> Dec 30 13:11:56 hbeast kernel: drmn0: on vgapci0 >>>>> Dec 30 13:11:56 hbeast kernel: [drm] This hardware requires >>>>> experimental >>>>> hardware support. >>>>> Dec 30 13:11:56 hbeast kernel: See modparam exp_hw_support >>>>> Dec 30 13:11:56 hbeast kernel: device_attach: drmn0 attach returned 1= 9 >>>>> sorry if this is an FAQ, but I couldn't find an answer: how do I >>>>> enable/modify "modparam exp_hw_support"? >>>>> >>>>> thx >>>>> Michael >>>>> >>>>> -- >>>>> >>>> -- Michael Schuster http://recursiveramblings.wordpress.com/ recursion, n: see 'recursion' From owner-freebsd-questions@freebsd.org Wed Dec 30 22:53:25 2020 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0A4684D1E8B for ; Wed, 30 Dec 2020 22:53:25 +0000 (UTC) (envelope-from doug@fledge.watson.org) Received: from cyrus.watson.org (cyrus.watson.org [204.107.128.30]) by mx1.freebsd.org (Postfix) with ESMTP id 4D5mm40NSsz4njd for ; Wed, 30 Dec 2020 22:53:24 +0000 (UTC) (envelope-from doug@fledge.watson.org) Received: from fledge.watson.org (fledge.watson.org [198.74.231.63]) by cyrus.watson.org (Postfix) with ESMTPS id 4199A5FC83 for ; Wed, 30 Dec 2020 22:53:17 +0000 (UTC) Received: from fledge.watson.org (doug@localhost [127.0.0.1]) by fledge.watson.org (8.16.1/8.16.1) with ESMTPS id 0BUMrH6u088178 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO) for ; Wed, 30 Dec 2020 22:53:17 GMT (envelope-from doug@fledge.watson.org) Received: from localhost (doug@localhost) by fledge.watson.org (8.16.1/8.16.1/Submit) with ESMTP id 0BUMrH19088174 for ; Wed, 30 Dec 2020 22:53:17 GMT (envelope-from doug@fledge.watson.org) Date: Wed, 30 Dec 2020 21:46:47 +0000 (UTC) From: doug Reply-To: doug@safeport.com To: "Steve O'Hara-Smith" Subject: Re: Observations on virtual memory operations In-Reply-To: <20201230060647.38938a75f69e6c045802f655@sohara.org> Message-ID: References: <167603f-a82a-7031-6850-2d08f17a36@fledge.watson.org> <8f3a278a-56cd-c732-68a0-cf6fa5d50a3f@nomadlogic.org> <03553c65-c1c2-db2c-6ab9-a0f4d09c3e2d@nomadlogic.org> <20201230060647.38938a75f69e6c045802f655@sohara.org> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII; format=flowed ReSent-Date: Wed, 30 Dec 2020 22:52:47 +0000 (UTC) ReSent-From: doug ReSent-To: freebsd-questions@FreeBSD.ORG ReSent-Subject: Re: Observations on virtual memory operations ReSent-Message-ID: <1a1be3d6-15fc-d581-292b-da8b47c2d6@fledge.watson.org> X-Rspamd-Queue-Id: 4D5mm40NSsz4njd X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of doug@fledge.watson.org has no SPF policy when checking 204.107.128.30) smtp.mailfrom=doug@fledge.watson.org X-Spamd-Result: default: False [0.63 / 15.00]; HAS_REPLYTO(0.00)[doug@safeport.com]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[204.107.128.30:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_DOM_NEQ_FROM_DOM(0.00)[]; DMARC_NA(0.00)[watson.org]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[204.107.128.30:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_ALL(0.00)[]; NEURAL_SPAM_MEDIUM(0.71)[0.707]; NEURAL_HAM_SHORT(-0.08)[-0.079]; R_SPF_NA(0.00)[no SPF record]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:11288, ipnet:204.107.128.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 30 Dec 2020 22:53:25 -0000 On Wed, 30 Dec 2020, Steve O'Hara-Smith wrote: > On Wed, 30 Dec 2020 01:03:05 +0000 (UTC) > doug@safeport.com wrote: > >> I do not seem to be able to say clearly enough, there is no memory >> problem, the is a problem with the paging subsystem filling up swapspace. > > Are you using tmpfs or swap backed md ? > Neither: swapctl -l Device: 1024-blocks Used: /dev/aacd0p3 4194304 1857780 from vmstat: procs memory page faults cpu r b w avm fre flt re pi po fr sr in sy cs us sy id 2 0 16 13G 1.7G 2557 0 0 0 3044 435 509 5523 875 7 1 93 0 0 16 14G 1.5G 8582 0 0 0 7366 428 491 6410 731 6 1 92 0 0 16 14G 1.5G 2945 0 0 0 2934 480 511 4313 780 6 1 93 0 0 16 14G 1.6G 3795 0 0 0 3950 457 434 4910 716 5 1 94 1 0 16 14G 1.6G 589 0 0 0 1128 431 777 2128 1481 2 1 98 2 0 16 14G 1.6G 3273 0 1 0 3329 446 715 5871 1266 5 1 94 And the perl pgm that develops counts from vm.stats.vm SYSTEM MEMORY INFORMATION: mem_wire: 1520701440 ( 1450MB) [ 18%] Wired: disabled for paging out mem_active: + 957276160 ( 912MB) [ 11%] Active: recently referenced mem_inactive:+ 3454586880 ( 3294MB) [ 41%] Inactive: recently not referenced mem_cache: + 0 ( 0MB) [ 0%] Cached: almost avail. for allocation mem_free: + 1823854592 ( 1739MB) [ 21%] Free: fully available for allocation mem_gap_vm: + 549380096 ( 523MB) [ 6%] Memory gap: UNKNOWN -------------- ------------ ----------- ------ mem_all: = 8305799168 ( 7921MB) [100%] Total real memory managed mem_gap_sys: + 240508928 ( 229MB) Memory gap: Kernel?! -------------- ------------ ----------- mem_phys: = 8546308096 ( 8150MB) Total real memory available mem_gap_hw: + 43626496 ( 41MB) Memory gap: Segment Mappings?! -------------- ------------ ----------- mem_hw: = 8589934592 ( 8192MB) Total real memory installed SYSTEM MEMORY SUMMARY: mem_used: 3311493120 ( 3158MB) [ 38%] Logically used memory mem_avail: + 5278441472 ( 5033MB) [ 61%] Logically available memory -------------- ------------ ----------- ------ mem_total: = 8589934592 ( 8192MB) [100%] Logically total memory The system I have the save a command on is older so an apache/php memory leak is not out of the question. The dipicted here is 11.3, apache24 and php7. I keep this one up by restarting one or more jails with swap space usage >50%. When it so it is almost instantaneous in both cases. From owner-freebsd-questions@freebsd.org Fri Jan 1 20:47:36 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B72D94D3A58 for ; Fri, 1 Jan 2021 20:47:36 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id 4D6xt02lw8z3ppw for ; Fri, 1 Jan 2021 20:47:36 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 5C80A4D38FE; Fri, 1 Jan 2021 20:47:36 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5C4364D3A57 for ; Fri, 1 Jan 2021 20:47:36 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D6xsy6fdDz3py5 for ; Fri, 1 Jan 2021 20:47:34 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1609534053; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=TJJz3suMOKXkIoaBIBJtnx/upYY=; b=SD2F83tL4sk/uw5Xtialq7GkjPef0g7YAWpgm6rp/6gaaP4ILjqa9MLQ6EAH5D2n RwpLtup4QDXBZHnOJ5GcoFK+k3ZveRamGpfO9OLSajQfzBCQoYHrzUqkQhtlEzuq QjC7xnaUUMa/7/taudRrGCov05GsaRMX/gUSfkoIuWHkoTIVeeFHvOEoD84WFT9I x5kK1YV2jHH+wUghWiCEq0pKFiD1Vpj9PdQ2wLX2WUa4oPxZvwuxZAUqY80cuyw6 cN9j0yl+nN3sXXBcpYs866VrBQVZ9i8ye+gYpSOOakcLDS2fVQaeLdw0Ay7XPr0g Gomxbnsz6nzsK97vm77v4w==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.3 cv=GfZpYjfL c=1 sm=1 tr=0 cx=a_idp_x a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=EmqxpYm9HcoA:10 a=48faUk6PgeAA:10 a=KLMCzc11lrDyOP_fxQMA:9 a=CjuIK1q_8ugA:10 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:24708] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id A6/A3-50009-56A8FEF5; Fri, 01 Jan 2021 15:47:33 -0500 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24559.35428.827584.263560@jerusalem.litteratus.org> Date: Fri, 1 Jan 2021 15:47:32 -0500 From: Robert Huff To: questions@freebsd.org Subject: converting docs to git X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verditct: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgedujedrvddvjedgudeggecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfujgfpteevqfftnfgvrghrnhhinhhgpdftvefppdfqfgfvnecuuegrihhlohhuthemuceftddunecunecujfgurhepgggtgffkfffhvffuofesthejredtredtvdenucfhrhhomheptfhosggvrhhtucfjuhhffhcuoehrohgsvghrthhhuhhffhesrhgtnhdrtghomheqnecuggftrfgrthhtvghrnhepudefudegteeiledufefhiedtffetkeegjefhkeeukeegveffkeelvdejvdelgeefnecukfhppedvtdelrdeirddvfedtrdegkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdeirddvfedtrdegkeenpdhmrghilhhfrhhomheprhhosggvrhhthhhufhhfsehrtghnrdgtohhmnedprhgtphhtthhopehquhgvshhtihhonhhssehfrhgvvggsshgurdhorhhgne X-Rspamd-Queue-Id: 4D6xsy6fdDz3py5 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=SD2F83tL; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-3.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[rcn.com:+]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; INTRODUCTION(2.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[69.168.97.78:from]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; MIME_TRACE(0.00)[0:+]; RCVD_IN_DNSWL_LOW(-0.10)[69.168.97.78:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[69.168.97.78:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[rcn.com:dkim]; RWL_MAILSPIKE_POSSIBLE(0.00)[69.168.97.78:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 01 Jan 2021 20:47:36 -0000 Hello: Does anyone here know the correct invocation for the initial download of the doc source tree using git? I found an example that seems to have worked for src, but not for doc. This will be a read-only copy. Respectfully, Robert Huff -- Hello ... my name is SARS-CoV-2. You are not wearing a mask? Prepare to die! From owner-freebsd-questions@freebsd.org Fri Jan 1 21:00:37 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4F59C4D415C for ; Fri, 1 Jan 2021 21:00:37 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4D6y9101zJz3qrr for ; Fri, 1 Jan 2021 21:00:37 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) Received: by mailman.nyi.freebsd.org (Postfix) id 00D114D3EE0; Fri, 1 Jan 2021 21:00:37 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 009574D3EDF for ; Fri, 1 Jan 2021 21:00:37 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) Received: from mout.gmx.net (mout.gmx.net [212.227.17.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.gmx.net", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D6y903njNz3r4l for ; Fri, 1 Jan 2021 21:00:36 +0000 (UTC) (envelope-from CerebrosuS@gmx.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=gmx.net; s=badeba3b8450; t=1609534832; bh=kRsqcYjVM+NcbyioJlYRAgfnbUPe6n21o5uWNC2Buho=; h=X-UI-Sender-Class:Subject:To:References:From:Date:In-Reply-To; b=HRMmf77RliEpVcJrfQKSxzSua7XNMPH1XvKe08GZFbeovjshJJo1/tALfftKX4XFz jk5A+Cpc7lEYhQtFsFyvWHrkHl4Q3P12gK1zZgOD/jxgGwEZVWbk1j1FkBHaFBMNkg 9g8QTpMpi16AIIt6av1syEdP/dzU2foTL2t3Ihkc= X-UI-Sender-Class: 01bb95c1-4bf8-414a-932a-4f6e2808ef9c Received: from [2.2.3.2] ([87.122.30.47]) by mail.gmx.com (mrgmx104 [212.227.17.168]) with ESMTPSA (Nemesis) id 1MWzjt-1kX50z2Pft-00XOOl; Fri, 01 Jan 2021 22:00:32 +0100 Subject: Re: converting docs to git To: Robert Huff , questions@freebsd.org References: <24559.35428.827584.263560@jerusalem.litteratus.org> From: CerebrosuS Message-ID: <603a2388-f738-ec4a-8b52-7b34d93e08f7@gmx.net> Date: Fri, 1 Jan 2021 22:00:32 +0100 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: <24559.35428.827584.263560@jerusalem.litteratus.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-US X-Provags-ID: V03:K1:CR/vdRq0fChh8/LB0X9oJmR513NuKhiA2hzEkbUX92s31PfEJXZ TQ6DAXFlegRy7vx/nKPSkL7cD/7opdMERMVKh8o4SL88PdjmuB0d15kZOH6tPlQsBq7pgMQ MY198F0xKSFM8W07A4SStCY+vWDlrm1d+c7YH9VlE0sJXuJFWjeNJm3C5kfLJFjtxQFqBbv zOnu3FBDI+4NX8iX0mKWw== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:orqZLF6ZRWk=:PKXS8ILDsXuYvCqsojejl8 qGNkABx8nvN7XOQtbok/X1uMj2uHccsAqbQPUXXZaSXdy69/YX0iYkzxAtPFLiH3tAWILYn5t 1lbtEpXABCi17g0jtmxSvNyWBxlzcvVo3CrRpvHhWrf+BqOIhZnxROw4Gdzql7HILWfwFHt5P LHOAmEUJNZHSqPLHFFic5bwIEzWs65tSYjo5t/F1l5hN6KZTKsn149sqjnNi8HqDE/MHOd2Xp dxG4axLeI6P+jSnZMdIwUyNvEw76eGl4CpDEi67culaHZlKFwaLteetefaomwtkKXqwpAnW+g VhI07IcTLFXaFwESe7YALZeTBNot1bSrq5I8HPKoEiFRVR3euzEjLC9MRAzv/r475sikQEGa6 HumMPocHLAGN9s7owmJv1SRZPJY53MIMZAkyIljOYHm8/LA9TyGLygNS8uzd1wtzHA0kEb4qS l89QTOm0UaO4XbBn5xmW+vea179mc+4aNovZrkalQbA6c1CH/qyUU1Fl6y1b6uDG7w/Oq/lFW xrXbAbBwxB5zNHL3u9bVHQsD4/E8sBU7mp5hzkGPUVHxadnopYt/QHfg6WDnm9B+XzdVV+qn/ 68zor8n6MI8mG6p35+YaEEBbgMfwEu1X2BlxHiwjOakuYq1EPCkDzUO0NKEm0n8Y4SX0DpKai weunxxy/zlT5x+OlTtbedQeMR9GIqg6v8CLxxI1kC/IO/7wVKgTX/Gj9CM5caDsajdHMJJYYw amIz0SUMzeCCu52OQNlGC9NKC+KS1ZazeuuYLQZOYPQzStIOliwaxAsSF5bF0q8ltSi/Yj9XV C5Vw1d5kJbcsmoELgneewcgvxAQG8lQnG2XzI83g/dz6hqip9X9q7ZpnHXbmgtwp3rm9zwt1s kUqYT82nS78POn3uq+hQ== X-Rspamd-Queue-Id: 4D6y903njNz3r4l X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 01 Jan 2021 21:00:37 -0000 Hello, git clone https://github.com/freebsd/freebsd-doc.git Maybe? Am 01.01.21 um 21:47 schrieb Robert Huff: > Hello: > Does anyone here know the correct invocation for the initial > download of the doc source tree using git? I found an example that > seems to have worked for src, but not for doc. This will be a > read-only copy. > > > Respectfully, > > > Robert Huff > From owner-freebsd-questions@freebsd.org Fri Jan 1 21:47:10 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DA9AB4D4960 for ; Fri, 1 Jan 2021 21:47:10 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-wr1-x434.google.com (mail-wr1-x434.google.com [IPv6:2a00:1450:4864:20::434]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D6zBj5Yw8z3tG1 for ; Fri, 1 Jan 2021 21:47:09 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-wr1-x434.google.com with SMTP id c5so22958120wrp.6 for ; Fri, 01 Jan 2021 13:47:09 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=gUV1LTVLctpQ2kH0jyCAlvO9+XDQRdaBrgjGEfqXKn4=; b=TKNnhC/39r6Wx+D7lquZCEokD65utsCOTXPkcF2KR8Ku0wiRPAZymrHOW9YDYgbDCR 1Me8ZDf5jg4/bPcEgGkZ76AaGSzm3se7F/sez37+n5rYMPpowXEFpZxMyXB8Lw9PT6KE V5hnt4f6270cY/EwCtfp/V+a3q4hwE3/FltqyBYlEqlqVm05cg78jyXTSMr6qwDLYqiw /KXrxu0gG4CKNmv/4WJSFzOuyC0dNG7vX2IijZnslNTKIZNgjSKBlVSl1W3GUUI/OfUU Ur53PxkCsCEHkLyhlGYb89KEgisnlvohdYtbfFXCpX5wiYT/HvUgfN7ld1OpBW1zCyqQ 4/Ag== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=gUV1LTVLctpQ2kH0jyCAlvO9+XDQRdaBrgjGEfqXKn4=; b=LmUSvwQpFYz3bGnzFEWvYERQLClMoeGcMr/npPmxQ5M0k6F/gx/xuwD0ahx06O2FPX YSDbHxi7Jg+chjPUUycZSLgnCjB9+kDtPTZ+StdCMv1bSsI9DpYo0p1UPIGDw02Sts6J +nCvokjBqt0IDLQ8U2WabYhvOwhaa5x8ue2hKsBGJDEoFHwQZ1BpVIV7TxeW4k0laJFf Q2fdBtccmB4D4qYfbWHX4rdkqAsMFhPFgrft5Zl8JbfOjWTSArTOV+RJ4AIML0mEcZDp +zeCEHIAPS4FHv3g83wtWrcj/Satx3yXnL/wMAH6eq5+/kW0WYxl2LmiXlBbImd+nqzF 3Vyg== X-Gm-Message-State: AOAM532e1iwordLGO3R2//OgAM/EShd76kKD/9VDjzs388Mjm4BubCEw RaHpzOx+TZtpcTXsOgYuAqnCgaEjSAuoRg== X-Google-Smtp-Source: ABdhPJxPEkizUMqzBT5X1VvsAWEwjp09eFYQ89GTwYcb3RlFvM7zHUUuVO1qDQ/xMiC2ZubJQyRJow== X-Received: by 2002:a5d:4c4d:: with SMTP id n13mr70034400wrt.356.1609537627512; Fri, 01 Jan 2021 13:47:07 -0800 (PST) Received: from [192.168.1.11] (79-66-147-78.dynamic.dsl.as9105.com. [79.66.147.78]) by smtp.gmail.com with ESMTPSA id a62sm19043159wmf.7.2021.01.01.13.47.06 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Fri, 01 Jan 2021 13:47:06 -0800 (PST) Subject: =?UTF-8?Q?cd_/usr/src_=26=26_git_clone_=e2=80=a6_https=3a//git=2efr?= =?UTF-8?Q?eebsd=2eorg/doc=2egit_=e2=80=a6_=28was=3a_converting_docs_to_git?= =?UTF-8?Q?=29?= To: freebsd-questions@freebsd.org References: <24559.35428.827584.263560@jerusalem.litteratus.org> <603a2388-f738-ec4a-8b52-7b34d93e08f7@gmx.net> From: Graham Perrin Message-ID: <6a6256a1-2645-dc14-aaa3-535620455493@gmail.com> Date: Fri, 1 Jan 2021 21:47:06 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.6.0 MIME-Version: 1.0 In-Reply-To: <603a2388-f738-ec4a-8b52-7b34d93e08f7@gmx.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-GB X-Rspamd-Queue-Id: 4D6zBj5Yw8z3tG1 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=TKNnhC/3; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::434 as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-3.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-0.997]; RECEIVED_SPAMHAUS_PBL(0.00)[79.66.147.78:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::434:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; URL_IN_SUBJECT(1.00)[git.freebsd.org]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::434:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::434:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 01 Jan 2021 21:47:10 -0000 On 01/01/2021 21:00, CerebrosuS wrote: > Hello, > > git clone https://github.com/freebsd/freebsd-doc.git > > Maybe? > > Am 01.01.21 um 21:47 schrieb Robert Huff: >> Hello: >>     Does anyone here know the correct invocation for the initial >> download of the doc source tree using git?  I found an example that >> seems to have worked for src, but not for doc.  This will be a >> read-only copy. … Taking a hint from the foot of , here's mine: cd /usr/src && git clone --depth 1 https://git.freebsd.org/doc.git doc Subsequent updates: git -C /usr/src/doc pull --ff-only Example ======= root@mowa219-gjp4-8570p:~ # cd /usr/src && git clone --depth 1 https://git.freebsd.org/doc.git doc Cloning into 'doc'... remote: Enumerating objects: 13158, done. remote: Counting objects: 100% (13158/13158), done. remote: Compressing objects: 100% (10824/10824), done. remote: Total 13158 (delta 4045), reused 8506 (delta 1966), pack-reused 0 Receiving objects: 100% (13158/13158), 87.20 MiB | 868.00 KiB/s, done. Resolving deltas: 100% (4045/4045), done. Updating files: 100% (11379/11379), done. root@mowa219-gjp4-8570p:/usr/src # ls -hl total 17 drwxr-xr-x  23 root  wheel    27B Jan  1 21:42 doc drwxr-xr-x  26 root  wheel    44B Dec 31 17:36 freebsd-current root@mowa219-gjp4-8570p:/usr/src # cd root@mowa219-gjp4-8570p:~ # git -C /usr/src/doc pull --ff-only Already up to date. root@mowa219-gjp4-8570p:~ # ---- YMMV From owner-freebsd-questions@freebsd.org Fri Jan 1 22:21:30 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 727114D5F16 for ; Fri, 1 Jan 2021 22:21:30 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4D6zyL2C2Xz3wQ5 for ; Fri, 1 Jan 2021 22:21:30 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 4943A4D5F8C; Fri, 1 Jan 2021 22:21:30 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 490AD4D5F15 for ; Fri, 1 Jan 2021 22:21:30 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D6zyK3pZxz4QlB for ; Fri, 1 Jan 2021 22:21:29 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1609539688; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=LNRew6Xsu21+m6hLRLCXy+AxVuQ=; b=B7F0Mq5D6M2wCdIjG/EDARMQz7h1j7zNC30I/beqx0hlRyo4742bS5E6v9ExpWEC IfRVD5d/6xVi9mZVLRAP2p5vWgO9mo+9FsZp31QSV2nN6kwY1gYlwcGdN8YSc8KM KOW76X9Lm3j42N99tdbCnJV26yprzNW8WCIP/vws646TIOMTYH4uTsnGIVzg771P yCDaRjzjaOOGqVHM8Qg07EAcbHdbSBSZeNogn++sNzx6QVylaKFbbF3KDRcK+j7T mkSPJNyCg2eO6A512/67KJcYWSg+OVMTzHGrBFvlzbTW8KbZybRNPaM9TZ8JJNPj Tia3l8CkV2UCc//wt9OEeA==; X_CMAE_Category: , , X-CNFS-Analysis: v=2.3 cv=GfZpYjfL c=1 sm=1 tr=0 cx=a_idp_x a=9TgA2UwI6Wy+6BV4wQM/cQ==:117 a=9TgA2UwI6Wy+6BV4wQM/cQ==:17 a=T0PQMq6UAAAA:8 a=kUCByv9wAAAA:8 a=KGjhK52YXX0A:10 a=kj9zAlcOel0A:10 a=XRQyMpdBKAEA:10 a=EmqxpYm9HcoA:10 a=48faUk6PgeAA:10 a=5KLPUuaC_9wA:10 a=3uq_gbMhPCS8ksHpUmkA:9 a=CjuIK1q_8ugA:10 a=FKrGPzDVcKhioqDyiPg0:22 a=bu_5hG6eGWxBxPYBRUjp:22 a=pHzHmUro8NiASowvMSCR:22 a=6VlIyEUom7LUIeUMNQJH:22 X-CM-Score: 0 X-Scanned-by: Cloudmark Authority Engine X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:49809] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id D1/84-50009-860AFEF5; Fri, 01 Jan 2021 17:21:28 -0500 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24559.41063.660409.457688@jerusalem.litteratus.org> Date: Fri, 1 Jan 2021 17:21:27 -0500 From: Robert Huff To: Graham Perrin CC: questions@freebsd.org Subject: =?UTF-8?Q?cd_/usr/src_=26=26_git_clone_=e2=80=a6_https=3a//git=2efr?= =?UTF-8?Q?eebsd=2eorg/doc=2egit_=e2=80=a6_=28was=3a_converting_docs_to_git?= =?UTF-8?Q?=29?= In-Reply-To: <6a6256a1-2645-dc14-aaa3-535620455493@gmail.com> References: <24559.35428.827584.263560@jerusalem.litteratus.org> <603a2388-f738-ec4a-8b52-7b34d93e08f7@gmx.net> <6a6256a1-2645-dc14-aaa3-535620455493@gmail.com> X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verditct: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgedujedrvddvjedgudeifecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfujgfpteevqfftnfgvrghrnhhinhhgpdftvefppdfqfgfvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeggtgfgkfffhffvufgjfhfosehtjeertdertddvnecuhfhrohhmpeftohgsvghrthcujfhufhhfuceorhhosggvrhhthhhufhhfsehrtghnrdgtohhmqeenucggtffrrghtthgvrhhnpefhvdehkedvuedvgfeigfekvdetueetffeljeegiefhkeduhfefkeefvdelteefkeenucffohhmrghinhepfhhrvggvsghsugdrohhrghenucfkphepvddtledriedrvdeftddrgeeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledriedrvdeftddrgeeknedpmhgrihhlfhhrohhmpehrohgsvghrthhhuhhffhesrhgtnhdrtghomhenpdhrtghpthhtohepghhrrghhrghmphgvrhhrihhnsehgmhgrihhlrdgtohhmne X-Rspamd-Queue-Id: 4D6zyK3pZxz4QlB X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=B7F0Mq5D; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24]; DKIM_TRACE(0.00)[rcn.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; INTRODUCTION(2.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[69.168.97.78:from]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; MIME_TRACE(0.00)[0:+]; RCVD_IN_DNSWL_LOW(-0.10)[69.168.97.78:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; URL_IN_SUBJECT(1.00)[git.freebsd.org]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DWL_DNSWL_LOW(-1.00)[rcn.com:dkim]; SPAMHAUS_ZRD(0.00)[69.168.97.78:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[69.168.97.78:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 01 Jan 2021 22:21:30 -0000 Graham's example seems to have done it. Thank you. Respectfully, Robert Huff -- Hello ... my name is SARS-CoV-2. You are not wearing a mask? Prepare to die! From owner-freebsd-questions@freebsd.org Sat Jan 2 14:57:35 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C391D4D2521; Sat, 2 Jan 2021 14:57:35 +0000 (UTC) (envelope-from vas@sibptus.ru) Received: from admin.sibptus.ru (admin.sibptus.ru [IPv6:2001:19f0:5001:21dc::10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4D7Q3g0dKxz4TPK; Sat, 2 Jan 2021 14:57:34 +0000 (UTC) (envelope-from vas@sibptus.ru) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=sibptus.ru; s=20181118; h=Message-ID:Subject:To:From:Date:In-Reply-To; bh=OVKajvKTxY+L+Fw/If679L9Gbx5Fd9UO8fJ1g0OjbBI=; b=lY0NTpSSBcaSIdO8V1zwDiinuO 6oCR0lFKmjLoWciJmdwz1hAeI5ZnvVoAy/dz1lPat6HRCiwy/cZDujH5OrNHxbTV7WL9OSvg1DgN9 262XiBTUn3TFZDqKeb8I6AuIutNYONbsf2kgOd7Cs67Ck9WcMcQo7eOSxZk8SkOQezpI=; Received: from vas by admin.sibptus.ru with local (Exim 4.94 (FreeBSD)) (envelope-from ) id 1kviLP-000Gco-17; Sat, 02 Jan 2021 21:57:27 +0700 Date: Sat, 2 Jan 2021 21:57:27 +0700 From: Victor Sudakov To: freebsd-net@freebsd.org Cc: freebsd-questions@freebsd.org Subject: FreeBSD does not reply to IPv6 Neighbor Solicitations Message-ID: <20210102145727.GA62235@admin.sibptus.ru> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="WIyZ46R2i8wDzkSu" Content-Disposition: inline X-PGP-Key: http://admin.sibptus.ru/~vas/ X-PGP-Fingerprint: 10E3 1171 1273 E007 C2E9 3532 0DA4 F259 9B5E C634 X-Rspamd-Queue-Id: 4D7Q3g0dKxz4TPK X-Spamd-Bar: ------ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=sibptus.ru header.s=20181118 header.b=lY0NTpSS; dmarc=pass (policy=none) header.from=sibptus.ru; spf=pass (mx1.freebsd.org: domain of vas@sibptus.ru designates 2001:19f0:5001:21dc::10 as permitted sender) smtp.mailfrom=vas@sibptus.ru X-Spamd-Result: default: False [-6.10 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2001:19f0:5001:21dc::10:from]; R_DKIM_ALLOW(-0.20)[sibptus.ru:s=20181118]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; TO_DN_NONE(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[2001:19f0:5001:21dc::10:from:127.0.2.255]; DKIM_TRACE(0.00)[sibptus.ru:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[sibptus.ru,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; SIGNED_PGP(-2.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:20473, ipnet:2001:19f0:5000::/38, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-net,freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 02 Jan 2021 14:57:35 -0000 --WIyZ46R2i8wDzkSu Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Dear Colleagues, Why could it be that a FreeBSD 12.2 host does not reply to ICMPv6 Neighbor Solicitations from the router? Interface configuration on host: $ ifconfig re1 re1: flags=3D8843 metric 0 mtu 1500 options=3D8209b ether c4:12:f5:33:c9:7c inet 192.168.170.5/24 broadcast 192.168.170.255 inet6 fe80::c612:f5ff:fe33:c97c%re1/64 scopeid 0x2 inet6 2001:470:ecba:3::5/64 media: Ethernet autoselect (1000baseT ) status: active nd6 options=3D21 $=20 Interface configuration on router: [admin@MikroTik] > /ipv6 address print where interface=3Dbridge Flags: X - disabled, I - invalid, D - dynamic, G - global, L - link-local= =20 # ADDRESS FROM-POOL INTERFACE=20 0 DL fe80::4a8f:5aff:feab:b0c1/64 bridge 1 G 2001:470:ecba:3::1/64 bridge [admin@MikroTik] >=20 Packet dump: http://admin.sibptus.ru/~vas/nd1.pcapng where I ping a host in the IPv6 Internet from 2001:470:ecba:3::5, the router wants to learn the L2 address for 2001:470:ecba:3::5 to reply to, and receives no answer. Where could be the problem? --=20 Victor Sudakov, VAS4-RIPE, VAS47-RIPN 2:5005/49@fidonet http://vas.tomsk.ru/ --WIyZ46R2i8wDzkSu Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEcBAEBAgAGBQJf8InXAAoJEA2k8lmbXsY0ruEH+gIl9oRBnPA8fZmkzVOy2CIN +fWBzapWKN7EkcqAhcB3BpgtpyjmS9BwwFEN3NyF/AqWcUmahL8UIweai1fySaVu r6Ympy8T9HxKLU5C/STotfHs0xmWdNqff4scBnxEkwobyuHiqqe45mC7nf4mNrV8 uIutot2BfURlW41YhhOPjaI8bDpxPVu78Oz74KNyElXnME5405wpEsjtnFB8VvIl BdJwdFYVt0Sy8dRDAuDoCbbuUQXjVz9934Ix8JuZlx0wM++YLzladcQdZCQBraRk Hdo6ks9iz41bYghuV07IjBKJEGmoygb8oYHsTjORY1cJI8b/SenZ0MBvkyijAJg= =9W/G -----END PGP SIGNATURE----- --WIyZ46R2i8wDzkSu-- From owner-freebsd-questions@freebsd.org Sat Jan 2 17:43:05 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B1D724D887F for ; Sat, 2 Jan 2021 17:43:05 +0000 (UTC) (envelope-from rgacote@appropriatesolutions.com) Received: from mail-io1-xd35.google.com (mail-io1-xd35.google.com [IPv6:2607:f8b0:4864:20::d35]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D7Tkc3c2yz4hqp for ; Sat, 2 Jan 2021 17:43:04 +0000 (UTC) (envelope-from rgacote@appropriatesolutions.com) Received: by mail-io1-xd35.google.com with SMTP id o6so21219414iob.10 for ; Sat, 02 Jan 2021 09:43:04 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=appropriatesolutions.com; s=google; h=mime-version:from:date:message-id:subject:to; bh=EjvbREE2KTgo18LeKghtddyLsH/px01L2K7NfFbkWSQ=; b=oLq/45HT+ybRuh41hcwCs9HmFISSjH311e+4HRNMQZjSOdKsNt1WfHsqWWzBupFIbA ArvL1t8iszouEV8rElCM+QCFEF8UsxfijliwY7/fqdm+iXWFGhmUuPQXtoUpkIeygxXP gAz5JxYEZtbX3jFfbayGYiLt8syh/x1meBGcI= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=EjvbREE2KTgo18LeKghtddyLsH/px01L2K7NfFbkWSQ=; b=Ztl/Si2ikj2mQpFkeeomwXd99KAkEk2sxyKIrle5ZacNiCm4n848rV3SFG81g0mx0G c2XQ+6z8meQxHsThwZR4WtpdMBVamKMV48aRTqzoxKUaul4mqITx0tN3mAj7gYPdB8At pYAlkCD0mSjcdmBQIMkflAYFpqlITAACgxu3WMBHBaIiyx3BAkh56C/uTQXBsAD9YKrJ u817ymQg0Z2ue9xC/xSZ9YmSTmxOy+LRHWugAhjWU/J34QH7gwwWnGU2zlu0+3Vt2Rew 931QUsPP7AjUWg+NUR7Pspr5x45kmy/76T5huiAwizwPMBaSxAA9twDrR7XT54o+FMyr /K8g== X-Gm-Message-State: AOAM53199/zhW+6CXOdb/mKVjYMnm5DvZ+S9tPOWJ8AiS+JmcTBNhQWr /Azcs5LcsPUUfv/vHh68xhcIUTXU57ZCfesq85lV88mDC6nITw== X-Google-Smtp-Source: ABdhPJxhAueJoIt+SeYxLwFKVrsa5B+pwS9dDixZxyrQz87vPcWSnOLYQbuy/DhouEb9Ign09BatEjQ0gcDcFS0fjZU= X-Received: by 2002:a05:6602:3c9:: with SMTP id g9mr53121276iov.8.1609609381735; Sat, 02 Jan 2021 09:43:01 -0800 (PST) MIME-Version: 1.0 From: Ray Cote Date: Sat, 2 Jan 2021 12:42:35 -0500 Message-ID: Subject: pkg with dependency on Python 3.8 tries to install Python 3.7.3 To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4D7Tkc3c2yz4hqp X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=appropriatesolutions.com header.s=google header.b=oLq/45HT; dmarc=none; spf=pass (mx1.freebsd.org: domain of rgacote@appropriatesolutions.com designates 2607:f8b0:4864:20::d35 as permitted sender) smtp.mailfrom=rgacote@appropriatesolutions.com X-Spamd-Result: default: False [-1.50 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[appropriatesolutions.com:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d35:from:127.0.2.255]; DMARC_NA(0.00)[appropriatesolutions.com]; NEURAL_SPAM_SHORT(1.00)[1.000]; DKIM_TRACE(0.00)[appropriatesolutions.com:+]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d35:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d35:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 02 Jan 2021 17:43:05 -0000 Hello: I'm building and installing on FreeBSD 12.2. My package has the following two dependencies: deps = { bash = { version = "5.0.18,2"; origin = "shells/bash"; }, python = { version = "3.8_6,0"; origin = "lang/python"; }, }, After building the package, those are the dependencies I see: # pkg info -d -F pkg/app-2.0.0.txz app-2.0.0: bash-5.0.18,2 python-3.8_6,0 When I install it, it tries to install Python TBD # pkg install -U pkg/app-2.0.0.txz The following 3 package(s) will be affected (of 0 checked): New packages to be INSTALLED: python: 3.7_3,2 python3: 3_3 app: 2.0.0 Number of packages to be installed: 3 2 KiB to be downloaded. I already have Python 3.8.6 and 3.7.9 installed: # pkg info python* python37-3.7.9 python38-3.8.6 Any hints as to why I'm being prompted for an older (and older than installed) Python 3.7? I've searched the Manifest and the only place Python appears is in the dependencies listed above. This is my first attempt at packaging one of our custom applications, so perhaps I've missed something obvious. Thanks --Ray From owner-freebsd-questions@freebsd.org Sat Jan 2 18:43:16 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7E7F54DAA91 for ; Sat, 2 Jan 2021 18:43:16 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4D7W4364Fgz4mJj for ; Sat, 2 Jan 2021 18:43:15 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [IPv6:2607:fb90:a223:76e3:cf2:2081:65d5:7e7d] (unknown [172.58.140.215]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 8964A4E676; Sat, 2 Jan 2021 12:36:08 -0600 (CST) Content-Type: text/plain; charset=utf-8 Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.4\)) Subject: Re: pkg with dependency on Python 3.8 tries to install Python 3.7.3 From: Valeri Galtsev In-Reply-To: Date: Sat, 2 Jan 2021 12:36:06 -0600 Cc: freebsd-questions@freebsd.org Content-Transfer-Encoding: quoted-printable Message-Id: References: To: Ray Cote X-Mailer: Apple Mail (2.3608.120.23.2.4) X-Rspamd-Queue-Id: 4D7W4364Fgz4mJj X-Spamd-Bar: +++++++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [9.91 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; RCPT_COUNT_TWO(0.00)[2]; RCVD_NO_TLS_LAST(0.10)[]; RECEIVED_SPAMHAUS_PBL(0.00)[172.58.140.215:received]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; FROM_EQ_ENVFROM(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; ARC_NA(0.00)[]; RECEIVED_SPAMHAUS_XBL(5.00)[172.58.140.215:received]; RECEIVED_SPAMHAUS_CSS(4.00)[172.58.140.215:received]; NEURAL_HAM_MEDIUM(-0.99)[-0.989]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.30)[0.304]; MIME_GOOD(-0.10)[text/plain]; R_DKIM_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_SPAM_LONG(1.00)[0.996]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,body]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 02 Jan 2021 18:43:16 -0000 > On Jan 2, 2021, at 11:42 AM, Ray Cote = wrote: >=20 > Hello: >=20 > I'm building and installing on FreeBSD 12.2. > My package has the following two dependencies: >=20 > deps =3D { > bash =3D { > version =3D "5.0.18,2"; > origin =3D "shells/bash"; > }, > python =3D { > version =3D "3.8_6,0"; > origin =3D "lang/python"; > }, > }, >=20 What happens if in deps you use origin =3D =E2=80=9Clang/python38=E2=80=9D instead of =E2=80=9Clang/python=E2=80=9D ? The truth is that = /usr/ports/lang/python resembles version 3.7, that=E2=80=99s why that = version gets installed too. Valeri >=20 > After building the package, those are the dependencies I see: >=20 > # pkg info -d -F pkg/app-2.0.0.txz > app-2.0.0: >=20 > bash-5.0.18,2 >=20 > python-3.8_6,0 >=20 >=20 > When I install it, it tries to install Python TBD >=20 > # pkg install -U pkg/app-2.0.0.txz > The following 3 package(s) will be affected (of 0 checked): >=20 > New packages to be INSTALLED: >=20 > python: 3.7_3,2 >=20 > python3: 3_3 >=20 > app: 2.0.0 >=20 >=20 > Number of packages to be installed: 3 >=20 > 2 KiB to be downloaded. >=20 > I already have Python 3.8.6 and 3.7.9 installed: >=20 > # pkg info python* > python37-3.7.9 > python38-3.8.6 >=20 >=20 > Any hints as to why I'm being prompted for an older (and older than > installed) Python 3.7? >=20 > I've searched the Manifest and the only place Python appears is in the > dependencies listed above. >=20 > This is my first attempt at packaging one of our custom applications, = so > perhaps I've missed something obvious. >=20 > Thanks > --Ray > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" From owner-freebsd-questions@freebsd.org Sat Jan 2 19:49:35 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 51B944DD091 for ; Sat, 2 Jan 2021 19:49:35 +0000 (UTC) (envelope-from rgacote@appropriatesolutions.com) Received: from mail-il1-x12c.google.com (mail-il1-x12c.google.com [IPv6:2607:f8b0:4864:20::12c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D7XXZ4lcSz4sCL for ; Sat, 2 Jan 2021 19:49:34 +0000 (UTC) (envelope-from rgacote@appropriatesolutions.com) Received: by mail-il1-x12c.google.com with SMTP id k8so21717006ilr.4 for ; Sat, 02 Jan 2021 11:49:34 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=appropriatesolutions.com; s=google; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=mwa9bJi8diaQv8wm7I4CFysbtKKmhr7qZcJcrSFkoWA=; b=OFseIw/LZ5ntxak7XXDdWCfX3OaAFDNgg9fvW6My9vMfDl9GQtkcZUoTyMPZ4X/Yxd z0Sgsjg9cHzUnPM10FuRE4uOWoS3gvxrTYGJcs2LIfE04I1uBbfflBkU3VBLhDqiqjIt uxhP8CR8wCyLqWu1a2kQ1n4oXUvzpJgdwtoBo= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=mwa9bJi8diaQv8wm7I4CFysbtKKmhr7qZcJcrSFkoWA=; b=TEGZkKwAQpkWfJKOFuYyUlfj5Zfr2h07zEKxZrDPmfoGCuboKDSYhEzovtxMB+Pdoo +M4JVa+p+VzBg802KpCGvN2vjtH2B4u04JA0D8hR7TK4+mO9diHmU8KPqvDevJ3Bs572 LOCiiLOEEuNST8WlFfsFfvNJH2tW+qxIe5MWJ/2y5KRauhKE7MevoD58t6QRQ5jhn1BC TbO4+A6/o//FM9afmk0hKZVcXWoF3Rp7t7eNRVlsk7eryGAHkCM6IJFmrhBEg4MJmNEh ye365ZecdxX7W0j0c2pdtfzNaesAWHdqioigHfTh61bVPNIrDRwZs2wAvq6LgpjDH7M5 dEMQ== X-Gm-Message-State: AOAM533vV1Mu3fPEpK/eOkM/o5dti3LirZOkcI5z2/9ZjC7VhnYPtZF/ hD9sQNs5t5KrfQeMDHG31mRItrOvTXekLQv8JdvAbrhfr8yyWSz7 X-Google-Smtp-Source: ABdhPJzfVVIIZ1VWr0aTfLidiY/fX/X2IvLREQdnYm7vT4ut48J4p7BYeiE2be9DBTvBqv8yMi/oNZdphTKj4W6tfoo= X-Received: by 2002:a05:6e02:10c2:: with SMTP id s2mr62802958ilj.290.1609616973421; Sat, 02 Jan 2021 11:49:33 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Ray Cote Date: Sat, 2 Jan 2021 14:49:07 -0500 Message-ID: Subject: Re: pkg with dependency on Python 3.8 tries to install Python 3.7.3 To: Valeri Galtsev Cc: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4D7XXZ4lcSz4sCL X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=appropriatesolutions.com header.s=google header.b=OFseIw/L; dmarc=none; spf=pass (mx1.freebsd.org: domain of rgacote@appropriatesolutions.com designates 2607:f8b0:4864:20::12c as permitted sender) smtp.mailfrom=rgacote@appropriatesolutions.com X-Spamd-Result: default: False [-1.50 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[appropriatesolutions.com:s=google]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[appropriatesolutions.com]; NEURAL_SPAM_SHORT(1.00)[1.000]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::12c:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[appropriatesolutions.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::12c:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::12c:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 02 Jan 2021 19:49:35 -0000 On Sat, Jan 2, 2021 at 1:36 PM Valeri Galtsev wrote: > > > > On Jan 2, 2021, at 11:42 AM, Ray Cote > wrote: > > > > Hello: > > > > I'm building and installing on FreeBSD 12.2. > > My package has the following two dependencies: > > > > deps =3D { > > bash =3D { > > version =3D "5.0.18,2"; > > origin =3D "shells/bash"; > > }, > > python =3D { > > version =3D "3.8_6,0"; > > origin =3D "lang/python"; > > }, > > }, > > > > What happens if in deps you use > > origin =3D =E2=80=9Clang/python38=E2=80=9D > > instead of =E2=80=9Clang/python=E2=80=9D ? The truth is that /usr/ports/l= ang/python > resembles version 3.7, that=E2=80=99s why that version gets installed too= . > > Valeri Hi Valeri: Although that did not solve the problem, it made me consider an additional change. Switching 'python =3D' to 'python3.8 =3D' fixes the problem. Also clarifies for me the x =3D is not a random label but the name of an actual package. The dependency now looks like: python3.8 =3D { version =3D "3.8_6,0"; origin =3D "lang/python38"; }, Thanks for the help. --Ray > > > > > After building the package, those are the dependencies I see: > > > > # pkg info -d -F pkg/app-2.0.0.txz > > app-2.0.0: > > > > bash-5.0.18,2 > > > > python-3.8_6,0 > > > > > > When I install it, it tries to install Python TBD > > > > # pkg install -U pkg/app-2.0.0.txz > > The following 3 package(s) will be affected (of 0 checked): > > > > New packages to be INSTALLED: > > > > python: 3.7_3,2 > > > > python3: 3_3 > > > > app: 2.0.0 > > > > > > Number of packages to be installed: 3 > > > > 2 KiB to be downloaded. > > > > I already have Python 3.8.6 and 3.7.9 installed: > > > > # pkg info python* > > python37-3.7.9 > > python38-3.8.6 > > > > > > Any hints as to why I'm being prompted for an older (and older than > > installed) Python 3.7? > > > > I've searched the Manifest and the only place Python appears is in the > > dependencies listed above. > > > > This is my first attempt at packaging one of our custom applications, s= o > > perhaps I've missed something obvious. > > > > Thanks > > --Ray > > _______________________________________________ > > freebsd-questions@freebsd.org mailing list > > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > > --=20 Raymond Cote, CTO voice: +1.603.924.6079 email: rgacote@AppropriateSolutions.com skype: ray.cote Schedule a meeting: https://calendly.com/ray_cote/60min/ From owner-freebsd-questions@freebsd.org Sat Jan 2 20:17:29 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1D9514DDDD9 for ; Sat, 2 Jan 2021 20:17:29 +0000 (UTC) (envelope-from freebsd@dreamchaser.org) Received: from nightmare.dreamchaser.org (ns.dreamchaser.org [66.109.141.57]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "dreamchaser.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D7Y8l6PJyz4vT6 for ; Sat, 2 Jan 2021 20:17:27 +0000 (UTC) (envelope-from freebsd@dreamchaser.org) Received: from breakaway.dreamchaser.org (breakaway [192.168.151.122]) by nightmare.dreamchaser.org (8.15.2/8.15.2) with ESMTP id 102KHIic008509 for ; Sat, 2 Jan 2021 13:17:19 -0700 (MST) (envelope-from freebsd@dreamchaser.org) To: FreeBSD Mailing List Reply-To: freebsd@dreamchaser.org From: Gary Aitken Subject: rotate apache logs? Message-ID: <25261693-8d86-9c6f-eb87-c82da4fcc559@dreamchaser.org> Date: Sat, 2 Jan 2021 13:12:56 -0700 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:68.0) Gecko/20100101 Thunderbird/68.11.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Greylist: Sender IP whitelisted, not delayed by milter-greylist-4.6.2 (nightmare.dreamchaser.org [192.168.151.101]); Sat, 02 Jan 2021 13:17:19 -0700 (MST) X-Rspamd-Queue-Id: 4D7Y8l6PJyz4vT6 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of freebsd@dreamchaser.org designates 66.109.141.57 as permitted sender) smtp.mailfrom=freebsd@dreamchaser.org X-Spamd-Result: default: False [-0.31 / 15.00]; HAS_REPLYTO(0.00)[freebsd@dreamchaser.org]; ARC_NA(0.00)[]; NEURAL_SPAM_SHORT(0.99)[0.993]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[66.109.141.57:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; REPLYTO_ADDR_EQ_FROM(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[66.109.141.57:from:127.0.2.255]; SUBJECT_ENDS_QUESTION(1.00)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; DMARC_NA(0.00)[dreamchaser.org]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_TWO(0.00)[2]; ASN(0.00)[asn:21947, ipnet:66.109.128.0/19, country:US]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 02 Jan 2021 20:17:29 -0000 It I look at /var/log, many of the logs are rotated. However, apache logs are not, and I don't see a way in the apache config file /usr/local/etc/apache24/httpd.conf to do this. Do each of the programs that rotate their logs have their own mechanism for doing this, or is there a common mechanism that is used? I see that the sysutils/logrotate port is available to do this, but not installed. It seems strange that so many programs would rotate but not use a common utility for that purpose. Is logrotate the recommended way to rotate apache logs? Gary From owner-freebsd-questions@freebsd.org Sat Jan 2 20:39:02 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DBEF04DE272 for ; Sat, 2 Jan 2021 20:39:02 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [212.227.126.131]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.kundenserver.de", Issuer "TeleSec ServerPass Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4D7Ydd5PW6z3CVQ for ; Sat, 2 Jan 2021 20:39:01 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from r56.edvax.de ([178.12.36.81]) by mrelayeu.kundenserver.de (mreue011 [212.227.15.167]) with ESMTPA (Nemesis) id 1MZkYx-1kSsf70t6d-00WjDi; Sat, 02 Jan 2021 21:38:50 +0100 Date: Sat, 2 Jan 2021 21:38:48 +0100 From: Polytropon To: freebsd@dreamchaser.org Cc: FreeBSD Mailing List Subject: Re: rotate apache logs? Message-Id: <20210102213848.a90879bd.freebsd@edvax.de> In-Reply-To: <25261693-8d86-9c6f-eb87-c82da4fcc559@dreamchaser.org> References: <25261693-8d86-9c6f-eb87-c82da4fcc559@dreamchaser.org> Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Provags-ID: V03:K1:6DRpdQPZhk8B+aGM9PoZtxe2l8+mncA2Lg2vThtIlYsTuXN8ZRz +T0VimQvTtm6nUrYhIdzPxyOcKht4YIL5KULoWVh1lVT79rfAHD6qlZ9OQZU3ZsP2Y83o8z Gv3U9wJq/IeYNGChRGY2HECaAtMgMjjWKsGDWAvtFLnVq0HpGIdD55jfnlFrO6J1pmtuVef T1AX2Q53gVXu+esUUpe5Q== X-Spam-Flag: NO X-UI-Out-Filterresults: notjunk:1;V03:K0:/8lwNE39ANQ=:o2n/tYf9ZNlIUwsOhBjaKO REziA8PWUS3YZfCsBKCfjUcY/JAyXMBdcYKRWWv922zebi5nDgQ1pRr187bLkvx8wg9rowisG IhBCEh+CrKh8qGO+1ppqw+Gw8Kt+4Yu/p0x4wKpiaiBtNcMgjNNQ/cXoXNqGQ0IVXLo2glCG6 i52M6psuW5GJ6lWf3c7sSP/4tdakYgbO28956SdBoNEm3bHxoCXgqkX5sfHyFXnwbfP53xf9M 0Wyk4OZ3fmCu8vdEWImIrx+gat5xZ0gARmz8S4AWb33KMQaODm/nWtsMgv9qEwLjC8l372z0h qxuOVKvvuJSpqxEzI3x+wBwHLVNXQRVIfWsMYrNjX8mgLeSDuu901tszEeFdy5XFIrdIwq5lG GeC6R58fPorl/incRrwYLV6F8qOlBWZ6+m3Pv1NqdXxbPVu2da1XLOjevt4LR X-Rspamd-Queue-Id: 4D7Ydd5PW6z3CVQ X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of freebsd@edvax.de has no SPF policy when checking 212.227.126.131) smtp.mailfrom=freebsd@edvax.de X-Spamd-Result: default: False [0.41 / 15.00]; HAS_REPLYTO(0.00)[freebsd@edvax.de]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; HAS_ORG_HEADER(0.00)[]; NEURAL_HAM_SHORT(-0.99)[-0.994]; RCPT_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8560, ipnet:212.227.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[212.227.126.131:from]; RECEIVED_SPAMHAUS_PBL(0.00)[178.12.36.81:received]; SUBJECT_ENDS_QUESTION(1.00)[]; ARC_NA(0.00)[]; REPLYTO_EQ_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[edvax.de]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[212.227.126.131:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MID_CONTAINS_FROM(1.00)[]; RCVD_IN_DNSWL_NONE(0.00)[212.227.126.131:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[212.227.126.131:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 02 Jan 2021 20:39:02 -0000 On Sat, 2 Jan 2021 13:12:56 -0700, Gary Aitken wrote: > It I look at /var/log, many of the logs are rotated. > However, apache logs are not, and I don't see a way in the apache config file > /usr/local/etc/apache24/httpd.conf to do this. > > Do each of the programs that rotate their logs have their own mechanism for > doing this, or is there a common mechanism that is used? I see that the > sysutils/logrotate port is available to do this, but not installed. It seems > strange that so many programs would rotate but not use a common utility for > that purpose. You can use the newsyslog facility provided by the FreeBSD OS. See /etc/newsyslog.conf and "man 5 newsyslog.conf" for details. It's possible to add configuration files for user-installed programs in /usr/local/etc/newsyslog.conf.d/ instead of adding the settings to the global configuration file. Also see "man 8 newsyslog" and /etc/crontab for further details. -- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ...