From owner-freebsd-questions@freebsd.org Sun Mar 14 01:23:32 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1B94456CD5C for ; Sun, 14 Mar 2021 01:23:32 +0000 (UTC) (envelope-from rwmaillists@googlemail.com) Received: from mail-wm1-x32b.google.com (mail-wm1-x32b.google.com [IPv6:2a00:1450:4864:20::32b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DyhdZ65xWz4SWC for ; Sun, 14 Mar 2021 01:23:30 +0000 (UTC) (envelope-from rwmaillists@googlemail.com) Received: by mail-wm1-x32b.google.com with SMTP id r10-20020a05600c35cab029010c946c95easo17358666wmq.4 for ; Sat, 13 Mar 2021 17:23:30 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=9YehwQvsYJ5uqC4Gwcx4BVffqdZzfBZTispsoCVsyMc=; b=F8bxaNamp2vwPEcu8WSbL7mHrMZdHRcpAGSuu/nZB2bFLPeEs1CPL1l6j8rPeDpJX7 8tOyTP/2Bsc/Xcg80RB0yZlD6iL01mj0CfXlHyRldzZFUi7JeBIrf/427QhKLc2TeJ1c s2rlAZLeUqHPvYfyy9PKAT66MnSX9y0ARA6wQEdPchmlw9bDcoQQVZWKCnJhXsFAHwG3 mhww2AN4fUSfdNIJH7XAjiY96LB+7k43ktiBgwPPZxPJHLK4f01G6EXujn5Av2ZZ7UA9 SVTzdq53j84ggUvZMwMQTG9a3yokifreUz0ySLmPKNqoxJ/0JvsyhjIvELX35zus78Cy 6/6w== X-Gm-Message-State: AOAM530o4qJb6uEDYdbZbCJ8qlpA7f5dsSSIysCggV8J2Mx3u8TQbCy/ cNjTFniynmlYOvXeRiYmW40Sa5E+/ZY= X-Google-Smtp-Source: ABdhPJzfN+VB2s12UeII1wPRP6ipoG3+uQosqwMqOWjSRUMMf6gyvheUOaTPQ6VNeMT2Y3W9p8AJ3A== X-Received: by 2002:a1c:e383:: with SMTP id a125mr19790330wmh.125.1615685008968; Sat, 13 Mar 2021 17:23:28 -0800 (PST) Received: from gumby.homeunix.com (host-92-15-61-44.as43234.net. [92.15.61.44]) by smtp.gmail.com with ESMTPSA id e18sm985822wru.73.2021.03.13.17.23.28 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 13 Mar 2021 17:23:28 -0800 (PST) Date: Sun, 14 Mar 2021 01:23:27 +0000 From: RW To: freebsd-questions@freebsd.org Subject: Re: Standards: IEC Giga [re: FreeBSD image size confusion] Message-ID: <20210314012327.2bb13206@gumby.homeunix.com> In-Reply-To: References: X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DyhdZ65xWz4SWC X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[googlemail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[googlemail.com:+]; DMARC_POLICY_ALLOW(-0.50)[googlemail.com,quarantine]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[92.15.61.44:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[googlemail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::32b:from]; DWL_DNSWL_NONE(0.00)[googlemail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[googlemail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::32b:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::32b:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 01:23:32 -0000 On Sat, 13 Mar 2021 15:52:45 -0700 @lbutlr wrote: > On 13 Mar 2021, at 15:07, grarpamp wrote: > > "giga" = "G" = decimal prefix, powers of ten, 10^, base 10 > > underlying "gibi" = "Gi" = binary prefix, powers of two, 2^, base 2 > > underlying > > It will be a decade or three before we know if this shakes out the > way that ISO is trying to force on people. The simple fact is that GB > has been used for a binary number for decades, just as MB and KB, and > the moved from MB = 2^20 to MB = 1,000,000 was driven by Hard drive > manufacturers who wanted to market their 100MB drives as 104MB to > fool people into thinking the drives were larger than they were. Proper standards based multipliers have long since been preferred by hardware engineers wherever feasible. The misuse of decimal multipliers is limited to a few things where size is related to access by address lines, such as RAM, and only there for want of anything better. People who think this is driven by marketing typically have very limited experience. It's not just hard drives, telecoms also uses SI multipliers, as does the rest of engineering and science - your preferred misuse is the exception. The existence of proper binary multipliers is long overdue. From owner-freebsd-questions@freebsd.org Sun Mar 14 07:17:45 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 918D3575A88 for ; Sun, 14 Mar 2021 07:17:45 +0000 (UTC) (envelope-from bthcom@higonnet.net) Received: from ams101.greengeeks.net (ams101.greengeeks.net [107.6.161.162]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DyrVK0cvMz4shP for ; Sun, 14 Mar 2021 07:17:44 +0000 (UTC) (envelope-from bthcom@higonnet.net) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=higonnet.net; s=default; h=Content-Transfer-Encoding:Content-Type: MIME-Version:Date:Message-ID:Subject:From:To:Sender:Reply-To:Cc:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:In-Reply-To:References:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=X8BTq/ZBcSKFGM3myq6uCzOd3RZRcITt6cjdpSpTCGA=; b=Fcpq0HaIY/t1A1cva0mLLuGajv zk9ShcO9tnuShEIQ/xn964zck+OCfmjhL/3hN7WDsPKImGFvDVIHlYYjJSU6ngfKIAlHVboqdY04P wgzUzUnLtFUOKXDLK+7gp9EQnXQV3a7iNXedyGJnHY71Xeu2VYD9KxfyBOxPgX7uSAs073XIRigHb 39ZD+gt64ZOeAsAyA0EyVlMP6hkfcHFyVl3KzW63/AsEUiqkqxlYOHF/nRXmPCaufoxg0o+t/X2v1 RP7xPFkma3y/fPRwVLdRqDnVLyg9ubhJNnNl8GUMDc8Fw8vzpj8mX73erIE0avtbAzACpLGygSFVo RUBXuZfw==; Received: from [82.142.8.1] (port=28844 helo=bthejmhd.hd.free.fr) by ams101.greengeeks.net with esmtpsa (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 (Exim 4.94) (envelope-from ) id 1lLL0R-0002h8-74 for freebsd-questions@freebsd.org; Sun, 14 Mar 2021 08:17:43 +0100 To: freebsd-questions@freebsd.org From: "Bernard T. Higonnet" Subject: Where can I get libjpeg? - problem with mozjpeg Message-ID: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> Date: Sun, 14 Mar 2021 08:18:14 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-AntiAbuse: This header was added to track abuse, please include it with any abuse report X-AntiAbuse: Primary Hostname - ams101.greengeeks.net X-AntiAbuse: Original Domain - freebsd.org X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12] X-AntiAbuse: Sender Address Domain - higonnet.net X-Get-Message-Sender-Via: ams101.greengeeks.net: authenticated_id: bthcom@higonnet.net X-Authenticated-Sender: ams101.greengeeks.net: bthcom@higonnet.net X-Rspamd-Queue-Id: 4DyrVK0cvMz4shP X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=higonnet.net header.s=default header.b=Fcpq0HaI; dmarc=none; spf=pass (mx1.freebsd.org: domain of bthcom@higonnet.net designates 107.6.161.162 as permitted sender) smtp.mailfrom=bthcom@higonnet.net X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+a:c]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[higonnet.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; HAS_X_ANTIABUSE(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:32475, ipnet:107.6.160.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; HAS_X_AS(0.00)[bthcom@higonnet.net]; SUBJECT_HAS_QUESTION(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[higonnet.net:s=default]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[higonnet.net]; RCPT_COUNT_ONE(0.00)[1]; HAS_X_GMSV(0.00)[bthcom@higonnet.net]; RWL_MAILSPIKE_VERYGOOD(0.00)[107.6.161.162:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 07:17:45 -0000 I am running 12.2-RELEASE-p3 GENERIC amd64, my applications are all installed using pkg. Many applications will not start because I am missing libjpeg.so.8. I am able to find libjpeg.turbo but installing either (or both) of jpeg-turbo-2 and libjpeg-turbo-2 do not help. One bizarre particularity of my system is that if I do pkg install mozjpeg it comes back and tells me it will delete just about every package I have installed and will not attempt to re-install them: Number of packages to be removed: 207 Number of packages to be installed: 1 Number of packages to be reinstalled: 1 Any help appreciated. Bernard Higonnet From owner-freebsd-questions@freebsd.org Sun Mar 14 07:32:32 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1A5AA575E20 for ; Sun, 14 Mar 2021 07:32:32 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-oi1-x233.google.com (mail-oi1-x233.google.com [IPv6:2607:f8b0:4864:20::233]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DyrqM17DWz4tC4 for ; Sun, 14 Mar 2021 07:32:30 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: by mail-oi1-x233.google.com with SMTP id t83so21444094oih.12 for ; Sat, 13 Mar 2021 23:32:30 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=ZW5KYQmLpmH6o7tkJjZ+GCroI46qdJXqsSOl41JbMPk=; b=bzYld2BHUZT4Ld91siAVbCSiXKt5I+i2z+5ohtIAq2wlqTd2SEPs2M8ZeuFGXxkeHa ZA0//oZ0cY8zptONV9Amv4JVx1IlEcPy7IGl3POSE+UYLaZ3ehiVg3lCCkRTuBV19S9O TYP0DnwEBX3XnedHx18tdKTHXdCzIAn2GhRIu18anMAoZwtOUFQJy5l7lekNKV3cBaJY 7YJJQJpmMI5yTxjPaaJlXgdOXTFeQKUTbOYyotlE3LUnB8GFFp/8WJN62NtMtSBL+Cw9 Yo2MuoZTtcresHz7JuuphkFcGeks4uF05nHo8PwCT1gHBYD2VoCjqP7ziFuozBW1J6Oa KKjQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=ZW5KYQmLpmH6o7tkJjZ+GCroI46qdJXqsSOl41JbMPk=; b=huxs8POBWE43TsCqP2xZRUTVOfq+gw+xAjWG0thxv+BOSrq8E5xhem3Z4RU3RQUx1i g+PM2ZiEScOdTuMdhPEW1890azZxN+jz7iGOquWrqSilHwbJDGwcmUech7eBDi+yWdTd asjQocwZ51XGhm7ffYVa7wOk1ILvVDTwMNk1ZqA6DE70OZGUCO1mJlMou61xiKyY73j4 u8PAmtgjnF0QzTlrWIu+UjsaqMsdouuafC8iS/EkndJQp3VyrZue5wf4mJycGGU+vlAJ ANuUS8ZeDB3fj4MCtUHQunOgUVo8zE+CHa7xCDyCANe+EXNqu24PKeS/bz+Ex7IuX5Ac pYXA== X-Gm-Message-State: AOAM530+1Yz7saOiTx+iugxaUhu/kR5gJX+j9PBO2vz0DPnWRP2A1jSi sjaYr3DbOVU1n8TbMVVPATQnJMjAzjvWIM2Zd2jcSzaLI7E= X-Google-Smtp-Source: ABdhPJyV60Pn+EwzoLOczM0+HV72QGb61HKAxcHlYHTo9aQMDaj7VeiptKvF8WZjuW/6kj4buvgJKDEuKCMYurVZtGM= X-Received: by 2002:aca:ac04:: with SMTP id v4mr14801722oie.57.1615707150276; Sat, 13 Mar 2021 23:32:30 -0800 (PST) MIME-Version: 1.0 References: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> In-Reply-To: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> From: Kevin Oberman Date: Sat, 13 Mar 2021 23:32:08 -0800 Message-ID: Subject: Re: Where can I get libjpeg? - problem with mozjpeg To: "Bernard T. Higonnet" Cc: "freebsd-questions@freebsd.org" X-Rspamd-Queue-Id: 4DyrqM17DWz4tC4 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=bzYld2BH; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kob6558@gmail.com designates 2607:f8b0:4864:20::233 as permitted sender) smtp.mailfrom=kob6558@gmail.com X-Spamd-Result: default: False [-3.70 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[rkoberman@gmail.com,kob6558@gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[rkoberman@gmail.com,kob6558@gmail.com]; SUBJECT_HAS_QUESTION(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::233:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::233:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::233:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 07:32:32 -0000 On Sat, Mar 13, 2021 at 11:17 PM Bernard T. Higonnet wrote: > I am running 12.2-RELEASE-p3 GENERIC amd64, my applications are all > installed using pkg. > > Many applications will not start because I am missing libjpeg.so.8. I am > able to find libjpeg.turbo but installing either (or both) of > jpeg-turbo-2 and libjpeg-turbo-2 do not help. > > One bizarre particularity of my system is that if I do > > pkg install mozjpeg > > it comes back and tells me it will delete just about every package I > have installed and will not attempt to re-install them: > > Number of packages to be removed: 207 > Number of packages to be installed: 1 > Number of packages to be reinstalled: 1 > > Any help appreciated. > > Bernard Higonnet > I believe you want "pkg install graphics/jpeg-turbo". Do not put the "-2" onto it. If you already have a version of jpeg-turbo installed, "pkg upgrade jpeg-turbo". I am baffled as to why mozturbo wants to delete 207 ports, but deleting a port that you want to replace is done with the -f switch. It's best to make sure all libraries are available with "pkg check -B" and "pkg check -d" to confirm that all required libraries and dependencies are present. -- Kevin Oberman, Part time kid herder and retired Network Engineer E-mail: rkoberman@gmail.com PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683d From owner-freebsd-questions@freebsd.org Sun Mar 14 10:38:09 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id CC63757B307 for ; Sun, 14 Mar 2021 10:38:09 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DywxX6g6Cz3Mjn for ; Sun, 14 Mar 2021 10:38:08 +0000 (UTC) (envelope-from kremels@kreme.com) Content-Type: text/plain; charset=us-ascii Subject: Re: Standards: IEC Giga [re: FreeBSD image size confusion] From: "@lbutlr" In-Reply-To: <20210314012327.2bb13206@gumby.homeunix.com> Date: Sun, 14 Mar 2021 04:38:06 -0600 Content-Transfer-Encoding: quoted-printable Message-Id: <7D5A9BF6-290E-4DEE-92CF-DBD3A9BB0D2C@kreme.com> References: <20210314012327.2bb13206@gumby.homeunix.com> To: FreeBSD X-Mailer: Apple Mail (2.3654.80.0.2.41) X-Rspamd-Queue-Id: 4DywxX6g6Cz3Mjn X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [0.60 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.121.55.42:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; MISSING_MIME_VERSION(2.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; R_SPF_ALLOW(-0.20)[+mx]; DMARC_NA(0.00)[kreme.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.121.55.42:from:127.0.2.255]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_SPAM_SHORT(1.00)[0.998]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[65.121.55.42:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 10:38:09 -0000 On 13 Mar 2021, at 18:23, RW via freebsd-questions = wrote: > On Sat, 13 Mar 2021 15:52:45 -0700 @lbutlr wrote: >=20 >> On 13 Mar 2021, at 15:07, grarpamp wrote: >>> "giga" =3D "G" =3D decimal prefix, powers of ten, 10^, base 10 >>> underlying "gibi" =3D "Gi" =3D binary prefix, powers of two, 2^, = base 2 >>> underlying =20 >>=20 >> It will be a decade or three before we know if this shakes out the >> way that ISO is trying to force on people. The simple fact is that GB >> has been used for a binary number for decades, just as MB and KB, and >> the moved from MB =3D 2^20 to MB =3D 1,000,000 was driven by Hard = drive >> manufacturers who wanted to market their 100MB drives as 104MB to >> fool people into thinking the drives were larger than they were. >=20 > Proper standards based multipliers have long since been preferred by > hardware engineers wherever feasible. The misuse of decimal = multipliers > is limited to a few things where size is related to access by address > lines, such as RAM, and only there for want of anything better.=20 >=20 > People who think this is driven by marketing It absolutely was the case when 100MB drives started to becomes common. = Cheap marketers selling poor quality drives advertised "104MB" and = everyone else used 100MB; the drive were the same size and the "smaller" = size pf the usable space on the "104MB" drives was written off to = "formatting overhead". (ad hominem nonsense removed) > The existence of proper binary multipliers is long overdue.=20 We will see how that goes. It may be the "GiB" becomes common for = computer storage, but 2^10 2^20 2^30 are definitely "proper", and the = use of "GiB" is still well below the use of "GB", and as much as = official orgs TRY to force language usage, they have no actual ability = to change the language people use. --=20 It was not, it could not be real. But in the roaring air he knew that it was, for all who needed to believe, and in a belief so strong that truth was not the same as fact... he knew that for now, and yesterday, and tomorrow, both the thing, and the whole of the thing. From owner-freebsd-questions@freebsd.org Sun Mar 14 15:03:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id ACA455A9AB0 for ; Sun, 14 Mar 2021 15:03:06 +0000 (UTC) (envelope-from 93ab.82.c3720005f05003.d6d4255388d67d314d80e5dcb87b8b15@email-od.com) Received: from s1-b515.socketlabs.email-od.com (s1-b515.socketlabs.email-od.com [142.0.181.21]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dz2qF4sVKz3slf for ; Sun, 14 Mar 2021 15:03:05 +0000 (UTC) (envelope-from 93ab.82.c3720005f05003.d6d4255388d67d314d80e5dcb87b8b15@email-od.com) X-Thread-Info: OTNhYi4xMi5jMzcyMDAwNWYwNTAwMy5mcmVlYnNkLXF1ZXN0aW9ucz1mcmVlYnNkLm9yZw== Received: from r3.us-east-2.aws.in.socketlabs.com (r3.us-east-2.aws.in.socketlabs.com [142.0.189.3]) by mxh4.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 14 Mar 2021 11:02:57 -0400 Received: from oceanview.tundraware.com (oceanview.tundraware.com [45.55.60.57]) by r3.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sun, 14 Mar 2021 11:02:57 -0400 Received: from [192.168.0.2] (ozzie.tundraware.com [75.145.138.73]) (authenticated bits=0) by oceanview.tundraware.com (8.16.1/8.16.1) with ESMTPSA id 12EF2eg0055515 (version=TLSv1.2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128 verify=NO) for ; Sun, 14 Mar 2021 10:02:40 -0500 (CDT) (envelope-from tundra@tundraware.com) To: FreeBSD Mailing List From: Tim Daneliuk Subject: /usr/bin/nm? Autocrypt: addr=tundra@tundraware.com; prefer-encrypt=mutual; keydata= xsFNBFlVgYoBEADIYD9W4mbKz5cEleX923hagDWkxyJl4kRiMJnz+dNAH71MItSdErMb0cFt CPxVncb4dR4R2ec0c0MjPcgVINNtbY1DMWsF7t31TKD8NG9ZjLqF6fZDFjgkRejqHytgjmCI UejrMSCf0UJsLtg+I3N1ZVVxd7ALj2bCvC/uc5S7j+YbNnhQvSoBbdFj/xOTjyOGGpk7WfB7 e42PGKq1NSgnI7tcY6HSaSH+LHeoc0yUpBb5A1ge+RhR1N9JTniEFe0qvOBi+HgUltEoxsk4 xb6IhpkDOTsxHvEg5h0ukfl8kG9cu+LrEBqwPaC8lPw3UmoTEAU+lXHanPE12JCF/54EtVCc rb4W0vqgGmLJzn5dRU/fWkar0FKPq4eoV0XMbGZKIC6pWQnMEsxEMpNvh7oefK6Kyn+LO+59 +sNYHbv1RImDJccmfHTOA6/jHdwOcnYy37U8UF7e+mGrwNs8GsMQx2AaQbR6VErakH3GBgft bMFOGQxiaRBkbzba7BZCQ060yhiC3/Mb/xHoVi7PBEmKig1SErTMA7Fh3CYPYIRDphNs6OSr tf9O4hbzUAsjbU3rxOfiWQjP3fSOM0KUBj4wpIWZlMrjAGnMIz2wHb211wsBiLqSaGiiO1LR 7RrcvbIFZvHQHiWe2tdRyuH3N/h7A316yoLfx+yy1gyP5weWsQARAQABzSRUaW0gRGFuZWxp dWsgPHR1bmRyYUB0dW5kcmF3YXJlLmNvbT7CwXcEEwEIACEFAllVgYoCGyMFCwkIBwIGFQgJ CgsCBBYCAwECHgECF4AACgkQdoOXo5EJFKntcA/9F9ags9Ik5C49N39iRq+yqBdn/Lr75rqv +Yg7JkjeVlwHpnQt1S6orTC7EaJc+AqY3szCEmhfuT0+E96Bw2k+G/XRnaedZ9SHSdImlmq0 RmOFpWLr67ScvlA9YG1tyR+QYraEFqK5EB6qhOWRJoz1BYtAAntK9b9gUTXt/277sT7lAWaj oPi4CDd4DofHc4E9VRsniMQNMLCWqc/ygAK07cWbK2Rh90tS2C4nK6OHFkNkK94zDilfxod1 NBFTUPPYfEU2CSa3eLlpfhYY3/2X7zNvmmCt+chHUnAhQLhldQ3WlqmTKP+ZK9LX002/bY1O M8Zk76WyA/A3EfsIUbnXBQvFyjwX6W4QEytlZWtp/yRIe64JOa3dZ8rkhragb2N4VgVLBVe3 jtZgfQ72pHrfNk/T0uT+hjFqInvIYiXkhxB2GiD7Ga28VuXojTmeoaW3GKcvoVxONSju7WzD XgyxWRmNpd5uifJcC3YU3tNNAosnQ0/5FW4wkducSEVwwqnAiSMQEMDDa/e6oP6GyOzes5SV LTNCRYdHWVKbxjetYU4SKm5RdLx9XuJo0qL9vO97mCNwdNkTM7gO2ycQ49qUiGbCZJOh2gpP ZRFrpJDxbloosAfOEB6IYjhb38u6jvbScJKK3bWA+a8TK4SrQpdRd1cAnW9sA8jCTV8ejZq0 CHnOwU0EWVWBigEQAJYuihAOOOe/kAn045Ayn+3is3S+6eV4IAgL6lJhoChkgUJJuFoRX9BY rd35z29+q2/UCoProzd4Mk66wXeWv6n4s5R79OUzjgMLCTVlVaMy4gjPL9NRDwMt7KYRF56g mnoKZwfPDi/oJ5toPPboW94FrMwonqbdqYM2Pyi/HPMe4e396WQ4TaA1CdhyzKHoFSpkGcjX zIQ5yQ5aaGS7wonRu/pg15dbu+8QOgxRNFa0bO+ntz/30u+VmxFqFVbExjuy3Or8fSBhJgx4 cfyrrunKLclpZ/52VeK3l53yWYpR8RaTZfzpu8Ih+ijAY4XLO5F8P1T6sEviMaTY2F0sbFRx ZJXsgFpiKeWPHUn7/LX7qcoFJYoFqG6b3n5km+qy39x6lMgJDuxKpeN6lYj//LB6xVzn0JI+ 4ZHPrEkFqxu8VkL7deCPTI67ZJik18jXjTH9sha1YBvgvxIPFMA7ZwXX2AwNu7PzdcCpWarS usOAHbjQBUsQ+ZPpI1oeFnsCPZ+8/mMcTjVRZyJxOPs3KnXZv2cXNuaa7lwkWS366gHzQI7O l6WdC8TyNjiOzR654cL8BgYQ/xNSW1vTXqPWSRU8/b/5IueY2tQJh0CKIvfoP0rk8976wa1R 8SRi08mwHX7+F5oSeXLRNHicQGpS1f0DywdRcQ0MFHyq/CV4dTltABEBAAHCwV8EGAEIAAkF AllVgYoCGwwACgkQdoOXo5EJFKkDNw//c8nailIVOV72l7Lze+2AuK9MYUCFb1i4qI1WTnG0 OHQlCAltPhdwZPAozJw/eNqIcuWQh8rZspve9ipj589wLSsVyaFRsuYXTiYZ9RlRsnJYa36h 2JML3ZGrRsSxaUEAggbiOKbwmw27JuOIPmC3Gln4tJuZ+nw6cfCgMI45bIzinVanxHwPLeLp BZKpaEYzAwtBykUfAXn3jDwrI95UlMJvhHDFuRgvb6uSyJIqmp5aR/BjnlSdEwICyWpRAVSt yqZeBMeHbCr1B97PIRzk/q0eHm9T+AoiZWwz1iVGGgkYdAaCfs2PBlNHmRm93cfgoEcaGvNb RbTXOe28niMJeYMQsnjOTy5AQIrhVKeP5E+qVs/oPK/inmLiTbjZcnrO2wR+uxpPGgmR6M/3 p8qyRdaOvT87HZXO+Wr+r9A4UnwhCPsfELwPlEo+TJQ/oE71Mlkx/ddQCWELcHjXrQF9YbzA Ml7g0zTkgHysh4DNkV5iYteOcmCwsWdOwn0H0yZfz6weyr8nEdPngyOjFNKMIpcTbeg8866c GxXAJj46dub4VdVwfvMRHfmmRJkjdId7YHWMgz2Kf7S7KPCROLis7WjlOdSS0q2m/7qy9WL/ ZW50YLS8ZZLMrnari5JxCyJX+8n6ZASo2AA93iTbKmYegK2LDwW1QLU1iAF3GyGOnSE= Message-ID: <464e9832-011d-cb4a-6588-22e6a5694ddf@tundraware.com> Date: Sun, 14 Mar 2021 10:02:35 -0500 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:68.0) Gecko/20100101 Thunderbird/68.10.0 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 7bit X-Greylist: Sender succeeded SMTP AUTH, not delayed by milter-greylist-4.6.4 (oceanview.tundraware.com [45.55.60.57]); Sun, 14 Mar 2021 10:02:40 -0500 (CDT) X-TundraWare-MailScanner-Information: Please contact the ISP for more information X-TundraWare-MailScanner-ID: 12EF2eg0055515 X-TundraWare-MailScanner: Found to be clean X-TundraWare-MailScanner-SpamCheck: not spam (whitelisted), SpamAssassin (not cached, score=-2.9, required 6, autolearn=not spam, ALL_TRUSTED -1.00, BAYES_00 -1.90) X-TundraWare-MailScanner-From: tundra@tundraware.com X-Spam-Status: No X-Rspamd-Queue-Id: 4Dz2qF4sVKz3slf X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.70 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[tundraware.com:+,email-od.com:+]; DMARC_POLICY_ALLOW(-0.50)[tundraware.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[tundra@tundraware.com,93ab.82.c3720005f05003.d6d4255388d67d314d80e5dcb87b8b15@email-od.com]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.181.21:from]; SUBJECT_ENDS_QUESTION(1.00)[]; FROM_NEQ_ENVFROM(0.00)[tundra@tundraware.com,93ab.82.c3720005f05003.d6d4255388d67d314d80e5dcb87b8b15@email-od.com]; ASN(0.00)[asn:53658, ipnet:142.0.180.0/22, country:US]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[tundraware.com:s=slkey,email-od.com:s=dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[142.0.181.21:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[142.0.181.21:from]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 15:03:06 -0000 I have two 11.4-STABLE machines - one physical, on running as a cloud instance. The cloud instances upgrades ports just fine. However, now and then, the physical instance has trouble with a port upgrade because it cannot find /usr/local/bin/nm ... but the program is present where it should be in /usr/bin/nm. Any theories on why it's looking in the wrong place and why it only affects one of the instances. (Both physical and cloud are upgrade simultaneously.) From owner-freebsd-questions@freebsd.org Sun Mar 14 18:42:42 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 57C545AE66C for ; Sun, 14 Mar 2021 18:42:42 +0000 (UTC) (envelope-from cPanel@freebsd.org) Received: from bom15.balasai.com (bom15.balasai.com [103.248.80.5]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dz7hd5GxCz4b2j for ; Sun, 14 Mar 2021 18:42:41 +0000 (UTC) (envelope-from cPanel@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=rhinofast.com; s=default; h=Content-Type:MIME-Version:Message-ID:Date: Subject:To:From:Sender:Reply-To:Cc:Content-Transfer-Encoding:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:In-Reply-To:References:List-Id:List-Help:List-Unsubscribe: List-Subscribe:List-Post:List-Owner:List-Archive; bh=KT9aCaIr2SbsWFauySMXxMmMtZQhtVCC68Iomhsc85o=; b=hPGvd9VjFjGb8t2YXZ1jl2v+81 FaHstG2FJl6uETKXr5HiePnQaAUAi0RT1ZznX3gDAPQQqHIXnv0/jrIZ922dQI6sDtwHy6RKQFVAO I7Dcyl8JJ38c7oEDOOcfz1roYOIp7sF8bfgCTBcKWsbVRebyNv5X4oibOQ9DUQUbWR+8=; Received: from [122.170.118.68] (port=51373 helo=abts-mum-static-068.118.170.122.airtelbroadband.in) by bom15.balasai.com with esmtpsa (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from ) id 1lLVhB-0003gm-Lr for freebsd-questions@freebsd.org; Mon, 15 Mar 2021 00:12:34 +0530 From: cPanel on freebsd.org To: freebsd-questions@freebsd.org Subject: [ freebsd.org ] Updates to the cPanel Services Agreement. Date: 15 Mar 2021 00:12:22 +0530 Message-ID: <20210315001222.6ED46A898B8EF72B@freebsd.org> X-AntiAbuse: This header was added to track abuse, please include it with any abuse report X-AntiAbuse: Primary Hostname - bom15.balasai.com X-AntiAbuse: Original Domain - freebsd.org X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12] X-AntiAbuse: Sender Address Domain - freebsd.org X-Get-Message-Sender-Via: bom15.balasai.com: authenticated_id: mumbai@rhinofast.com X-Authenticated-Sender: bom15.balasai.com: mumbai@rhinofast.com X-Source: X-Source-Args: X-Source-Dir: X-Rspamd-Queue-Id: 4Dz7hd5GxCz4b2j X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [0.00 / 15.00]; ASN(0.00)[asn:18229, ipnet:103.248.80.0/24, country:IN]; local_wl_from(0.00)[freebsd.org] MIME-Version: 1.0 Content-Type: text/plain; charset="iso-8859-1" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 18:42:42 -0000 From owner-freebsd-questions@freebsd.org Sun Mar 14 19:18:55 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9B0B55AF69A for ; Sun, 14 Mar 2021 19:18:55 +0000 (UTC) (envelope-from rwmaillists@googlemail.com) Received: from mail-wr1-x42f.google.com (mail-wr1-x42f.google.com [IPv6:2a00:1450:4864:20::42f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dz8VQ61DPz4cKt for ; Sun, 14 Mar 2021 19:18:54 +0000 (UTC) (envelope-from rwmaillists@googlemail.com) Received: by mail-wr1-x42f.google.com with SMTP id o16so4619189wrn.0 for ; Sun, 14 Mar 2021 12:18:54 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=Zq+mDY2pvjdRta6heP6TxmfvJMGeh3VuJssJ3Ha7aN0=; b=ep5fu9UoYU6Pol5XR9mZEmPAnGUSFwkiT2o833TEanC/IjgkOe8jtCSjnzOzwp0SDN XWPnmh37gGbfLrpLjiHg2mYVwOjgThGVPTbmOQapWdkJs6ax9LStI8EoEUqFW3ZWd73q 9H0K+m3vbbW10ZawgMdyGTdQHVeAQw98/CHKItW50noV5O+FJeiNxgFEWfqIX9QZHLTD cfVXJQJdd0n+IML6maV0Rv/xzt5RCRkAAdMJb9IYcxmHGuNd/W/d3fn266GytnmUv7fG QxqyhvjuU9IqzWXmD4sDcrzzSz1Aun76UOGtoFv6zE40QZY3FISeBSskNdrAUdASACoy iiGA== X-Gm-Message-State: AOAM531KMWKZFrYPA3nt+XVmu9YiHFkfAl4sU7O5Oi27H4o4ufmTU5Ay 6z6LAqMZ/wcpCPAWebm/gpbM37mX+TKn6g== X-Google-Smtp-Source: ABdhPJz/vNgHC4Ne/d27blHp14VIujwNBSjRoo3yfFhuHlq2Ho1IBBSrpyHMJr24SEVQZqwS28nVfg== X-Received: by 2002:adf:8341:: with SMTP id 59mr23162198wrd.130.1615749533357; Sun, 14 Mar 2021 12:18:53 -0700 (PDT) Received: from gumby.homeunix.com (host-92-15-61-44.as43234.net. [92.15.61.44]) by smtp.gmail.com with ESMTPSA id e18sm3427643wru.73.2021.03.14.12.18.52 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sun, 14 Mar 2021 12:18:52 -0700 (PDT) Date: Sun, 14 Mar 2021 19:18:51 +0000 From: RW To: freebsd-questions@freebsd.org Subject: Re: Standards: IEC Giga [re: FreeBSD image size confusion] Message-ID: <20210314191851.4dfb5ed7@gumby.homeunix.com> In-Reply-To: <7D5A9BF6-290E-4DEE-92CF-DBD3A9BB0D2C@kreme.com> References: <20210314012327.2bb13206@gumby.homeunix.com> <7D5A9BF6-290E-4DEE-92CF-DBD3A9BB0D2C@kreme.com> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4Dz8VQ61DPz4cKt X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.99 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[googlemail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[googlemail.com:+]; DMARC_POLICY_ALLOW(-0.50)[googlemail.com,quarantine]; NEURAL_HAM_SHORT(-0.99)[-0.990]; RECEIVED_SPAMHAUS_PBL(0.00)[92.15.61.44:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[googlemail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::42f:from]; DWL_DNSWL_NONE(0.00)[googlemail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[googlemail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::42f:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::42f:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 19:18:55 -0000 On Sun, 14 Mar 2021 04:38:06 -0600 @lbutlr wrote: > We will see how that goes. It may be the "GiB" becomes common for > computer storage, but 2^10 2^20 2^30 are definitely "proper", > and the use of "GiB" is still well below the use of "GB", and as much > as official orgs TRY to force language usage, It's not a matter of language, it's a matter of standards. There is a standard that says G means 10^9, and there is a standard that say Gi means 2^30. No one is ever going to standardize G to mean 2^30. > they have no actual ability to change the language people use. This isn't like language where if people misuse a word for long enough they get to be right, metrology isn't a matter of opinion. Most people neither know nor care about the difference, and mostly it doesn't matter, but were it does matter, standards based definitions are preferable. The misuse was wrong, but convenient, but there is no need for it any more. I don't understand why people like you wish to perpetuate the confusion. From owner-freebsd-questions@freebsd.org Sun Mar 14 23:03:44 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3939F5B5E31 for ; Sun, 14 Mar 2021 23:03:44 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: from mail-ed1-x52b.google.com (mail-ed1-x52b.google.com [IPv6:2a00:1450:4864:20::52b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzFTq4BDsz4sTf for ; Sun, 14 Mar 2021 23:03:43 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: by mail-ed1-x52b.google.com with SMTP id bx7so15181979edb.12 for ; Sun, 14 Mar 2021 16:03:43 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=lTT+OrZcmbaUY3+k7FXxN6bxlQk6HvF1Vu+uk5H2XIg=; b=Nlu53nLdr5SZ/xv8+EN/JoQEtkpM2kTslrboVR1+EWV/RIbfkSG8cSgjeQGPR2WL+x 9UpVfKXZpPx6iS5rm9yvUdHhpcFVIDh2+qNgQMSW57jWeUDqyPdvghkVnuH8oe4i4Ejo dFxgl0eKRZtiOI0JPWKGKazWhVvO3P8O0PhFiCBYjWHEmB2d+/q0DMl3dPxtwYBYu1vD YF1bEJ6Zey/3bA3W9DwScYHBv4DEMhe7QDh8uL6kUHn383kLcC+/BchX/+74v53u+jXm MiPP0Mvkh9rufwfv3Dv4AbQPYSnh3jlXajo+klIxR8RdRkM2dqFEOsvvwUYwnQpLbYa1 FffQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=lTT+OrZcmbaUY3+k7FXxN6bxlQk6HvF1Vu+uk5H2XIg=; b=HIAj+W8MqLzKLAmbrLXUm7hqdAKkbgdcysRgtgBfRXFRwoHnznV/D639rP8FUszf0t fPyUTURaZSWRnn3oD8B4ZnNANrMr/Qr3T33oRzm0LU12QPlFxu1XrRmwlpjCaDS8ZZMZ LKFwiXH0gKytU7v8wniGiS5EmBO5EUyi8Gyq9Wp9a65PaCJLES2a1zKR/gu3gTj1JbJU EB93A2ja+sk+GfGjJ5Vs11d0D6w16GrW/XdeSnOlvhX8EHNZdFlytgbSVw2V0JWOZTq0 pQ01FcVNLzf1VRalzRKep680caUlruf2YO0DWEcnmJ1Qi256h9vJnYs6Y6jXBxReyw6h 9q9A== X-Gm-Message-State: AOAM533jZ8mjayXhIPivb2EuoVpQBsMfVyAZCR0VaAjBBCvGSlNvT9YQ RcCROV2pLzyvLjGIJ77rqT5X2xHOcv/yqWg3xoSdFCP6nDs= X-Google-Smtp-Source: ABdhPJz0LUiWTd4FNOgGya3TxE27MdktIWfN7wQa58m5FnOfUw+BvIswfjhozbN9TLm5+p/rW60VdLtMRO35E/qzXPM= X-Received: by 2002:a05:6402:5252:: with SMTP id t18mr13304236edd.258.1615763021484; Sun, 14 Mar 2021 16:03:41 -0700 (PDT) MIME-Version: 1.0 From: Waitman Gobble Date: Sun, 14 Mar 2021 19:03:30 -0400 Message-ID: Subject: Disappearing files in FreeBSD 13.0-R2 To: FreeBSD X-Rspamd-Queue-Id: 4DzFTq4BDsz4sTf X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=Nlu53nLd; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of gobblewa@gmail.com designates 2a00:1450:4864:20::52b as permitted sender) smtp.mailfrom=gobblewa@gmail.com X-Spamd-Result: default: False [-2.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::52b:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::52b:from:127.0.2.255]; NEURAL_SPAM_SHORT(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::52b:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 23:03:44 -0000 I did a fresh install using ZFS with encryption. I copied the files on a second drive (UFS) to /usr/home/backup (ZFS). I reformatted the second drive ZFS and created a new pool "home" for that drive. It decided to mount the drive as /home. AFAIK i never told the system to do that. But /home and /usr/home are different, there is no link. I can only see /usr/home/backup if i boot into single user mode. If i mount read write or boot normally then /usr/home is empty. I copied the files to a usb drive. How do i delete the backup? Its taking up 100 gb. I can see them read only and copy to usb drive, but as soon as i mount read write they disappear. I did not import the home pool, it does not show up in the status command. Waitman From owner-freebsd-questions@freebsd.org Sun Mar 14 23:59:56 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2EF8D5B7384 for ; Sun, 14 Mar 2021 23:59:56 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from holgerdanske.com (holgerdanske.com [184.105.128.27]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "www.holgerdanske.com", Issuer "www.holgerdanske.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzGkg0kvSz3CB2 for ; Sun, 14 Mar 2021 23:59:54 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from 99.100.19.101 (99-100-19-101.lightspeed.frokca.sbcglobal.net [99.100.19.101]) by holgerdanske.com with ESMTPSA (TLS_AES_128_GCM_SHA256:TLSv1.3:Kx=any:Au=any:Enc=AESGCM(128):Mac=AEAD) (SMTP-AUTH username dpchrist@holgerdanske.com, mechanism PLAIN) for ; Sun, 14 Mar 2021 16:59:48 -0700 Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: freebsd-questions@freebsd.org References: From: David Christensen Message-ID: Date: Sun, 14 Mar 2021 16:59:47 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DzGkg0kvSz3CB2 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of dpchrist@holgerdanske.com has no SPF policy when checking 184.105.128.27) smtp.mailfrom=dpchrist@holgerdanske.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[184.105.128.27:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[184.105.128.27:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[holgerdanske.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6939, ipnet:184.104.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sun, 14 Mar 2021 23:59:56 -0000 On 3/14/21 4:03 PM, Waitman Gobble wrote: > I did a fresh install using ZFS with encryption. I copied the files on a > second drive (UFS) to /usr/home/backup (ZFS). I reformatted the second > drive ZFS and created a new pool "home" for that drive. It decided to mount > the drive as /home. AFAIK i never told the system to do that. But /home and > /usr/home are different, there is no link. > > I can only see /usr/home/backup if i boot into single user mode. If i mount > read write or boot normally then /usr/home is empty. > > I copied the files to a usb drive. > > How do i delete the backup? Its taking up 100 gb. I can see them read only > and copy to usb drive, but as soon as i mount read write they disappear. I > did not import the home pool, it does not show up in the status command. Please run the following commands and post your console session: # gpart show # zpool list # zfs list -d 1 # zfs list -r -t all home David From owner-freebsd-questions@freebsd.org Mon Mar 15 01:20:30 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3E91F569709 for ; Mon, 15 Mar 2021 01:20:30 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: from mail-ej1-x630.google.com (mail-ej1-x630.google.com [IPv6:2a00:1450:4864:20::630]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzJWc692Mz3HXb for ; Mon, 15 Mar 2021 01:20:28 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: by mail-ej1-x630.google.com with SMTP id ci14so63360741ejc.7 for ; Sun, 14 Mar 2021 18:20:28 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=QOKAztRVTi4ofTR8KpZS+zudiu2h+GIwjmr2MG2shb4=; b=j2YJk5/yro+8EOpfu5WVBHs775m7Q6s7RFnL8BDhjF0pJ2JG0AYwly2l15oF0fGcg6 DcnKOvfylSEvmR1/XkzEDRRLG0mNAAEABkor87SRo5YMyCIXGb/DPhtLrJVtee9yrpiA i0PVHxUVvJW6RORa+T1fL9LnYoqmVSnNxpzh+rTzy+5En6o6XaAvCo071lbvauS/n6ih pr973ubL5QuTCmep4uXc8olGmFNH+paour14+dirG+kdSYacbmy2iRwcpKpwLnMeQbpE lJ735fBs6NgpZbl6qDMdVggpIPMXnJEPKNK1ACKxfCPf3L6N20bTtXx0VGwiDwXBBl8k NxGQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=QOKAztRVTi4ofTR8KpZS+zudiu2h+GIwjmr2MG2shb4=; b=bJwdXpSE0F7Z1R8r4LGNCTKzjd2z81nkl4zZ75AEoXIGEQcF49X1VEcpPvnKH/0UV0 qhdxMCwFMN+YQCrwmToCuU6bJEOsq+FQ6p4FUsuAVAGXZq7Yn2+aQwbN1SqAWRkHfWJ8 uGllZQchi50gCskcrrGAAuSkEGCZlfx0T5dNxvuOxDBgMXXf5DMZTj3hXTAdVj3G2a1f gouFos3Pwu7sgDnqisfK1H0Wk4VRhr9XAZoBwILeWKmX3CrmAF5OfL0nLpoRQcO9ldYZ 64nJZjHu3c/fDOOZ4YuFV0U/u2GENJQ/nePWqeT5X+UJsXMi2U/sy0FiEpfPgT1n9SYr 8MgA== X-Gm-Message-State: AOAM530KPR+xLIRUqWFQh9s/lrD4ytjf5HwAv5sxEnHr3LBi1uedXvus e4qII2vY9NFZhRuiuM6YpBYGciF7+6XixT7XZsmuYrzLKzhGPw== X-Google-Smtp-Source: ABdhPJy/k9Aj9mortiBGf/cDrFoLbx6k2x6S5Gv+B1YwDSycarD9LjmA1Zv0DdGVSfrnVJTQdYwJuJ5aK+G/4HV67Rg= X-Received: by 2002:a17:906:4410:: with SMTP id x16mr21075505ejo.446.1615771226223; Sun, 14 Mar 2021 18:20:26 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Waitman Gobble Date: Sun, 14 Mar 2021 21:20:15 -0400 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: FreeBSD Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4DzJWc692Mz3HXb X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=j2YJk5/y; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of gobblewa@gmail.com designates 2a00:1450:4864:20::630 as permitted sender) smtp.mailfrom=gobblewa@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::630:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::630:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::630:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 01:20:30 -0000 On Sun, Mar 14, 2021 at 8:00 PM David Christensen wrote: > > On 3/14/21 4:03 PM, Waitman Gobble wrote: > > I did a fresh install using ZFS with encryption. I copied the files on a > > second drive (UFS) to /usr/home/backup (ZFS). I reformatted the second > > drive ZFS and created a new pool "home" for that drive. It decided to mount > > the drive as /home. AFAIK i never told the system to do that. But /home and > > /usr/home are different, there is no link. > > > > I can only see /usr/home/backup if i boot into single user mode. If i mount > > read write or boot normally then /usr/home is empty. > > > > I copied the files to a usb drive. > > > > How do i delete the backup? Its taking up 100 gb. I can see them read only > > and copy to usb drive, but as soon as i mount read write they disappear. I > > did not import the home pool, it does not show up in the status command. > > > Please run the following commands and post your console session: > > # gpart show > > # zpool list > > # zfs list -d 1 > > # zfs list -r -t all home > > > David Thanks for the reply. Ok, Here's the info from multi-user mode. In single user mode the 'home' pool (second drive) doesn't show up in status or list or anything, which is fine. When I boot into single user mode / read only then /usr/home has 100gb of backup. If I reboot to multi-user or mount read-write in single user then the files in /usr/home disappear. (even if the second drive isn't mounted). The 80 GB avail should be like 180GB I think, it's a 250GB drive. The usage stats don't change if the files in /usr/home appear or not. The home directory for the second drive is /home which isn't a link to /usr/home or vice-versa AFAIK. in multi-user mode /home has my files, /usr/home is empty. in single-user read only , /home is empty and /usr/home has the backup files. root@ayo:/home # gpart show => 40 488397088 ada0 GPT (233G) 40 532480 1 efi (260M) 532520 1024 2 freebsd-boot (512K) 533544 984 - free - (492K) 534528 4194304 3 freebsd-swap (2.0G) 4728832 483667968 4 freebsd-zfs (231G) 488396800 328 - free - (164K) => 40 976773088 ada1 GPT (466G) 40 976773088 1 freebsd-zfs (466G) => 40 976773088 da0 GPT (466G) 40 2008 - free - (1.0M) 2048 976771072 1 freebsd-ufs (466G) 976773120 8 - free - (4.0K) => 40 976773088 da1 GPT (466G) 40 2008 - free - (1.0M) 2048 976771072 1 freebsd-ufs (466G) 976773120 8 - free - (4.0K) root@ayo:/home # zpool list NAME SIZE ALLOC FREE CKPOINT EXPANDSZ FRAG CAP DEDUP HEALTH ALTROOT home 464G 294G 170G - - 0% 63% 1.00x ONLINE - zroot 230G 142G 87.6G - - 0% 61% 1.00x ONLINE - root@ayo:/home # zfs list -d 1 NAME USED AVAIL REFER MOUNTPOINT home 294G 156G 294G /home zroot 142G 80.4G 96K /zroot zroot/ROOT 140G 80.4G 96K none zroot/tmp 184K 80.4G 184K /tmp zroot/usr 1.38G 80.4G 96K /usr zroot/var 877M 80.4G 96K /var root@ayo:/home # zfs list -r -t all home NAME USED AVAIL REFER MOUNTPOINT home 294G 156G 294G /home root@ayo:/home # ls /usr/home/ [nada] root@ayo:/home # -- Waitman Gobble From owner-freebsd-questions@freebsd.org Mon Mar 15 01:22:38 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0DC1A56966D for ; Mon, 15 Mar 2021 01:22:38 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: from mail-ej1-x62f.google.com (mail-ej1-x62f.google.com [IPv6:2a00:1450:4864:20::62f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzJZ52cqgz3HtJ for ; Mon, 15 Mar 2021 01:22:37 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: by mail-ej1-x62f.google.com with SMTP id c10so63428540ejx.9 for ; Sun, 14 Mar 2021 18:22:37 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=jJ1oYli2AJuDh57ccGpgF4sDTkQsiBOte1DQx/lO6bI=; b=XwYrtm6yAxmLHzqxPgUgKtHjK9G7KzOr9EOLhNSeRauwmPIMW2Gs2RdXw7pRjRPHm9 PDyQp6bCyeDZA6dLuBFu2x5gSSA0gReTgT1qOZ4TFbk62PIRTBoe6Hax1Z7SFM8l+Q0H a02nmFk25dEVtMr38OCfRZCf8BxnWVZa/ZS4n2w/MYheY8rMuRYq8HeIVi5u8UVH9Kbp NUr04ITvfPHc4ISCp/lP8jJnS1jBVZpjzplp0YX5y2AqiNSFbFXOXvzlkwjkQREoe5K7 yWrfMEgfBT+o1uJiO1/YRhtRWNmOUrCP2TOjRf52a3mFTmAVFIQAsiND9Nv35h8czlbQ h1kg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=jJ1oYli2AJuDh57ccGpgF4sDTkQsiBOte1DQx/lO6bI=; b=LVoym8o+z9vKVN1MG27MMHCsLrmma3Za5gpZDajAesX7SSaKvEsSiO7pdaWUfGigdP 5o3KRKtl+isoUosjVrQEBzJUAD7l0WGpWS0EpLPnmLaIOAdh3NdtPh81yHqxu6PIR+JS 1XrFcdAwO4Lto66X/Q6i8hAfi09gUJ7+SCPqNAStUMeanbAUXWwO4AZuzvVYxymFTMCn 4QS2vi9/dgz3lP8oFuLHUaZK1/Qq22rOOvuRqwx0vtYjyJil7hu2KHfYPtUpCCF8ExG1 mxt8Dg5VnGaXOGdImKAWC1BJ1n9WR/0sIsd9fUKQu0dMu8ndpzIWgytoaG2V/1HDVqGw bCog== X-Gm-Message-State: AOAM531AGVy+QVjnSKj1jLZMMBIENd+jzjRd6Q24hxPPl0p1DQfcwCVJ Ejy0kS8+THm+f9Dikgf0VKdjBksOyk/7zGiTbSoUpaSrP6Gd4Q== X-Google-Smtp-Source: ABdhPJzLFgqUYcorHyoQQuM9MEur6z2HvrRhxHdpw2tsBC+luLwPLqY6RixnmtXOylP0+ZJZjRiPK/zgGljqxLRqrdU= X-Received: by 2002:a17:906:d554:: with SMTP id cr20mr21058804ejc.61.1615771355588; Sun, 14 Mar 2021 18:22:35 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Waitman Gobble Date: Sun, 14 Mar 2021 21:22:24 -0400 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: FreeBSD Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4DzJZ52cqgz3HtJ X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=XwYrtm6y; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of gobblewa@gmail.com designates 2a00:1450:4864:20::62f as permitted sender) smtp.mailfrom=gobblewa@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::62f:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::62f:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::62f:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 01:22:38 -0000 On Sun, Mar 14, 2021 at 9:20 PM Waitman Gobble wrote: > > On Sun, Mar 14, 2021 at 8:00 PM David Christensen > wrote: > > > > On 3/14/21 4:03 PM, Waitman Gobble wrote: > > > I did a fresh install using ZFS with encryption. I copied the files on a > > > second drive (UFS) to /usr/home/backup (ZFS). I reformatted the second > > > drive ZFS and created a new pool "home" for that drive. It decided to mount > > > the drive as /home. AFAIK i never told the system to do that. But /home and > > > /usr/home are different, there is no link. > > > > > > I can only see /usr/home/backup if i boot into single user mode. If i mount > > > read write or boot normally then /usr/home is empty. > > > > > > I copied the files to a usb drive. > > > > > > How do i delete the backup? Its taking up 100 gb. I can see them read only > > > and copy to usb drive, but as soon as i mount read write they disappear. I > > > did not import the home pool, it does not show up in the status command. > > > > > > Please run the following commands and post your console session: > > > > # gpart show > > > > # zpool list > > > > # zfs list -d 1 > > > > # zfs list -r -t all home > > > > > > David > > Thanks for the reply. > > Ok, Here's the info from multi-user mode. > > In single user mode the 'home' pool (second drive) doesn't show up in > status or list or anything, which is fine. > When I boot into single user mode / read only then /usr/home has 100gb > of backup. If I reboot to multi-user or mount read-write in single > user then the files in /usr/home disappear. (even if the second drive > isn't mounted). The 80 GB avail should be like 180GB I think, it's a > 250GB drive. The usage stats don't change if the files in /usr/home > appear or not. > > The home directory for the second drive is /home which isn't a link to > /usr/home or vice-versa AFAIK. in multi-user mode /home has my files, > /usr/home is empty. in single-user read only , /home is empty and > /usr/home has the backup files. > > root@ayo:/home # gpart show > => 40 488397088 ada0 GPT (233G) > 40 532480 1 efi (260M) > 532520 1024 2 freebsd-boot (512K) > 533544 984 - free - (492K) > 534528 4194304 3 freebsd-swap (2.0G) > 4728832 483667968 4 freebsd-zfs (231G) > 488396800 328 - free - (164K) > > => 40 976773088 ada1 GPT (466G) > 40 976773088 1 freebsd-zfs (466G) > > => 40 976773088 da0 GPT (466G) > 40 2008 - free - (1.0M) > 2048 976771072 1 freebsd-ufs (466G) > 976773120 8 - free - (4.0K) > > => 40 976773088 da1 GPT (466G) > 40 2008 - free - (1.0M) > 2048 976771072 1 freebsd-ufs (466G) > 976773120 8 - free - (4.0K) > > root@ayo:/home # zpool list > NAME SIZE ALLOC FREE CKPOINT EXPANDSZ FRAG CAP DEDUP > HEALTH ALTROOT > home 464G 294G 170G - - 0% 63% 1.00x ONLINE - > zroot 230G 142G 87.6G - - 0% 61% 1.00x ONLINE - > root@ayo:/home # zfs list -d 1 > NAME USED AVAIL REFER MOUNTPOINT > home 294G 156G 294G /home > zroot 142G 80.4G 96K /zroot > zroot/ROOT 140G 80.4G 96K none > zroot/tmp 184K 80.4G 184K /tmp > zroot/usr 1.38G 80.4G 96K /usr > zroot/var 877M 80.4G 96K /var > root@ayo:/home # zfs list -r -t all home > NAME USED AVAIL REFER MOUNTPOINT > home 294G 156G 294G /home > root@ayo:/home # ls /usr/home/ > [nada] > root@ayo:/home # > > oops, missed a couple. sorry. root@ayo:/home # zfs list -r -t all home NAME USED AVAIL REFER MOUNTPOINT home 294G 156G 294G /home root@ayo:/home # zfs list -d 1 NAME USED AVAIL REFER MOUNTPOINT home 294G 156G 294G /home zroot 142G 80.4G 96K /zroot zroot/ROOT 140G 80.4G 96K none zroot/tmp 184K 80.4G 184K /tmp zroot/usr 1.38G 80.4G 96K /usr zroot/var 877M 80.4G 96K /var -- Waitman Gobble From owner-freebsd-questions@freebsd.org Mon Mar 15 05:34:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 01618570AEA for ; Mon, 15 Mar 2021 05:34:23 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: from mail-wr1-x42b.google.com (mail-wr1-x42b.google.com [IPv6:2a00:1450:4864:20::42b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzQ8Z1D63z3qvb for ; Mon, 15 Mar 2021 05:34:21 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: by mail-wr1-x42b.google.com with SMTP id t9so5034167wrn.11 for ; Sun, 14 Mar 2021 22:34:21 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=KiW6Pqi1Wlhocf5LvTtvkUxY4u7nckpEc54KQ+9nLUI=; b=nzmf3xbtg+3w3lB6jlrA22gDHMtn5OKtAGw11uqgDMbf0O96I6QgjR204iZ6UciXYR dynrBA7OC4vVz7GELJ0o9owwuN+Otfdk72q5SAagzurI9dVL7aSp+hTyOfuhSHRMR0+e 9ui4zUDXUwQnfnSpFCdGOQHc16PFrGQC+uMb5HiPTfrwS5jwjPhprC7jh4I+kueCsvLy yLUZuN6hPUvnpjS1eVzMoCVweQ3aV4Jn+zDwfxduYiaOjPZZRTWUhYvYPznzjbgWykVW yUT8BlaSpKJEF4Pri5GWB3Ol+ek+zpvczpfeQXs+x2CfAb0/kLyW0ProfsDEHRoQO3Z8 N7Ng== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=KiW6Pqi1Wlhocf5LvTtvkUxY4u7nckpEc54KQ+9nLUI=; b=k/42qX3mQbs2RNh2Op7vz2QwzGn/HXFHOh90EHllRKtjCVFScp9I3I01E3isgur5iX m6irOKpBkWbnOV8OWSWgGpIBwsQCz5K1AfCNE70mlppV8obQvP5uz7z9VQNJ8fEyfL2i hNhkXpo9j/92gI3YoV6vIlzMmgmE576rrkttxvDm2IRY63cyzzfLnvLExw6Ub/nu6Hm8 aGcookwtsbGOWlihyBLFz1/OrlYOv31xvhmmNeY5yptsyvG0rWofDlYRPDUuzs5EBbS0 XZ75rDhDhlXEKq/dl0fD/NKVVIsBhYU1/DPXJ2Yb9fVVgIwS11QPddCeU93biixlZJmT Re4A== X-Gm-Message-State: AOAM533bOU9reRd5sFXxUQClyU6TL8ZuI0viinCXX7E7ACMbQb440JlJ WLQ4sjvXivmIptrFwccmLO3vGm1DqfLrntysd9A= X-Google-Smtp-Source: ABdhPJz2KhgGgTQxZqNL08rCICveUH3xprYlIZzxop0rFmicvHr/yzq+ChztkGQZDCRZ03gNci4Vpox5WljtXDnfbJ4= X-Received: by 2002:adf:828e:: with SMTP id 14mr25743901wrc.123.1615786460735; Sun, 14 Mar 2021 22:34:20 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: "parv/freebsd" Date: Sun, 14 Mar 2021 19:32:30 -1000 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: Waitman Gobble Cc: FreeBSD X-Rspamd-Queue-Id: 4DzQ8Z1D63z3qvb X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=nzmf3xbt; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of parv0zero9@gmail.com designates 2a00:1450:4864:20::42b as permitted sender) smtp.mailfrom=parv0zero9@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-0.999]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::42b:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[freebsd]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::42b:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::42b:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 05:34:23 -0000 On Sun, Mar 14, 2021 at 3:22 PM Waitman Gobble wrote: > On Sun, Mar 14, 2021 at 9:20 PM Waitman Gobble wrote: > ... > > In single user mode the 'home' pool (second drive) doesn't show up in > > status or list or anything, which is fine. > > When I boot into single user mode / read only then /usr/home has 100gb > > of backup. If I reboot to multi-user or mount read-write in single > > user then the files in /usr/home disappear. (even if the second drive > > isn't mounted). The 80 GB avail should be like 180GB I think, it's a > > 250GB drive. The usage stats don't change if the files in /usr/home > > appear or not. > > > > The home directory for the second drive is /home which isn't a link to > > /usr/home or vice-versa AFAIK. in multi-user mode /home has my files, > > /usr/home is empty. in single-user read only , /home is empty and > > /usr/home has the backup files. > ... > > root@ayo:/home # ls /usr/home/ > > [nada] > ... ls(1) will not list ".zfs" directory of ZFS snapshots in there (without setting "snapdir" property to "visible"). What do you get for ... % cd /usr/home/.zfs && du -h . ... looks like /usr/home has only snapshots & no live file system. - parv From owner-freebsd-questions@freebsd.org Mon Mar 15 06:44:13 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2AEC15724F3 for ; Mon, 15 Mar 2021 06:44:13 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from holgerdanske.com (holgerdanske.com [184.105.128.27]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "www.holgerdanske.com", Issuer "www.holgerdanske.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzRj81xG5z3vvL for ; Mon, 15 Mar 2021 06:44:12 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from 99.100.19.101 (99-100-19-101.lightspeed.frokca.sbcglobal.net [99.100.19.101]) by holgerdanske.com with ESMTPSA (TLS_AES_128_GCM_SHA256:TLSv1.3:Kx=any:Au=any:Enc=AESGCM(128):Mac=AEAD) (SMTP-AUTH username dpchrist@holgerdanske.com, mechanism PLAIN) for ; Sun, 14 Mar 2021 23:44:09 -0700 Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: freebsd-questions@freebsd.org References: From: David Christensen Message-ID: Date: Sun, 14 Mar 2021 23:44:08 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4DzRj81xG5z3vvL X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of dpchrist@holgerdanske.com has no SPF policy when checking 184.105.128.27) smtp.mailfrom=dpchrist@holgerdanske.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[184.105.128.27:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[184.105.128.27:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[holgerdanske.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6939, ipnet:184.104.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 06:44:13 -0000 On 3/14/21 6:22 PM, Waitman Gobble wrote: > On Sun, Mar 14, 2021 at 9:20 PM Waitman Gobble wrote: >> >> On Sun, Mar 14, 2021 at 8:00 PM David Christensen >> wrote: >>> >>> On 3/14/21 4:03 PM, Waitman Gobble wrote: >>>> I did a fresh install using ZFS with encryption. I copied the files on a >>>> second drive (UFS) to /usr/home/backup (ZFS). I reformatted the second >>>> drive ZFS and created a new pool "home" for that drive. It decided to mount >>>> the drive as /home. AFAIK i never told the system to do that. But /home and >>>> /usr/home are different, there is no link. >>>> >>>> I can only see /usr/home/backup if i boot into single user mode. If i mount >>>> read write or boot normally then /usr/home is empty. >>>> >>>> I copied the files to a usb drive. >>>> >>>> How do i delete the backup? Its taking up 100 gb. I can see them read only >>>> and copy to usb drive, but as soon as i mount read write they disappear. I >>>> did not import the home pool, it does not show up in the status command. >>> >>> >>> Please run the following commands and post your console session: >>> >>> # gpart show >>> >>> # zpool list >>> >>> # zfs list -d 1 >>> >>> # zfs list -r -t all home >>> >>> >>> David >> >> Thanks for the reply. >> >> Ok, Here's the info from multi-user mode. >> >> In single user mode the 'home' pool (second drive) doesn't show up in >> status or list or anything, which is fine. >> When I boot into single user mode / read only then /usr/home has 100gb >> of backup. If I reboot to multi-user or mount read-write in single >> user then the files in /usr/home disappear. (even if the second drive >> isn't mounted). The 80 GB avail should be like 180GB I think, it's a >> 250GB drive. The usage stats don't change if the files in /usr/home >> appear or not. >> >> The home directory for the second drive is /home which isn't a link to >> /usr/home or vice-versa AFAIK. in multi-user mode /home has my files, >> /usr/home is empty. in single-user read only , /home is empty and >> /usr/home has the backup files. >> >> root@ayo:/home # gpart show >> => 40 488397088 ada0 GPT (233G) >> 40 532480 1 efi (260M) >> 532520 1024 2 freebsd-boot (512K) >> 533544 984 - free - (492K) >> 534528 4194304 3 freebsd-swap (2.0G) >> 4728832 483667968 4 freebsd-zfs (231G) >> 488396800 328 - free - (164K) >> >> => 40 976773088 ada1 GPT (466G) >> 40 976773088 1 freebsd-zfs (466G) >> >> => 40 976773088 da0 GPT (466G) >> 40 2008 - free - (1.0M) >> 2048 976771072 1 freebsd-ufs (466G) >> 976773120 8 - free - (4.0K) >> >> => 40 976773088 da1 GPT (466G) >> 40 2008 - free - (1.0M) >> 2048 976771072 1 freebsd-ufs (466G) >> 976773120 8 - free - (4.0K) >> >> root@ayo:/home # zpool list >> NAME SIZE ALLOC FREE CKPOINT EXPANDSZ FRAG CAP DEDUP >> HEALTH ALTROOT >> home 464G 294G 170G - - 0% 63% 1.00x ONLINE - >> zroot 230G 142G 87.6G - - 0% 61% 1.00x ONLINE - >> root@ayo:/home # zfs list -d 1 >> NAME USED AVAIL REFER MOUNTPOINT >> home 294G 156G 294G /home >> zroot 142G 80.4G 96K /zroot >> zroot/ROOT 140G 80.4G 96K none >> zroot/tmp 184K 80.4G 184K /tmp >> zroot/usr 1.38G 80.4G 96K /usr >> zroot/var 877M 80.4G 96K /var >> root@ayo:/home # zfs list -r -t all home >> NAME USED AVAIL REFER MOUNTPOINT >> home 294G 156G 294G /home >> root@ayo:/home # ls /usr/home/ >> [nada] >> root@ayo:/home # >> >> > > oops, missed a couple. sorry. > > root@ayo:/home # zfs list -r -t all home > NAME USED AVAIL REFER MOUNTPOINT > home 294G 156G 294G /home > > root@ayo:/home # zfs list -d 1 > NAME USED AVAIL REFER MOUNTPOINT > home 294G 156G 294G /home > zroot 142G 80.4G 96K /zroot > zroot/ROOT 140G 80.4G 96K none > zroot/tmp 184K 80.4G 184K /tmp > zroot/usr 1.38G 80.4G 96K /usr > zroot/var 877M 80.4G 96K /var It looks like 'ada0' is a 250 GB drive with GPT and your system partitions. ada0p4 should be your root partition with the ZFS pool 'zroot', containing the root filesystem. 'zroot/usr/home' should be a ZFS filesystem mounted at /usr/home. These commands will confirm: # zfs list -d 1 zroot/usr # zfs list -r -t all zroot/usr/home '/home' should be a symbolic link to '/usr/home'. These commands will confirm: # ls -l /home # ls -l /usr It looks like 'ada1' is a 500 GB drive with the ZFS pool 'home'. ZFS mounts this at '/home' by default. This mount overlays the root filesystem symbolic link '/home', but I do not understand why '/usr/home/backup' disappears. I would do the following as root in single-user mode: 1. Record your console session with script(1). Exact details will be useful later; sooner if something goes wrong. 2. Take a recursive snapshot of the 'zroot' and 'home' ZFS filesystems. Pick a meaningful SNAPNAME (I do date/ time strings): # zfs snapshot -r zroot@SNAPNAME home@SNAPNAME 3. Unmount the ZFS filesystem 'zroot/usr/home', make it read-only, change its mountpoint, and mount it:: # zfs unmount zroot/usr/home # zfs set readonly=on zroot/usr/home # zfs set mountpoint=/usr/oldhome zroot/usr/home # zfs mount zroot/usr/home /usr/oldhome and /usr/oldhome/backup should now be visible. (If you previously created a ZFS filesystem 'zroot/usr/home/backup', repeat the first, second, and fourth steps above; adjusting the filesystem name. The 'mountpoint' property should be inherited.) 4. Set the mountpoint of the ZFS pool 'home' and mount it: # zfs set mountpoint=/usr/home home # zfs mount home /usr/home should now be visible. 5. It is recommended practice not to put files and directories into the base filesystem of a ZFS pool (e.g. '/usr/home') -- it is better to create ZFS filesystems at the base level of a pool and put files, directories, and/or additional ZFS filesystems into those. Assuming '/usr/oldhome/backup' represents your old home directory, create a ZFS filesystem for your new home directory: # zfs create home/username Do the same when adding more accounts in the future. 6. Assuming '/usr/oldhome/backup' represents one user account, copy its contents to '/usr/home/username'. 7. Reboot and check everything. 8. Wait a while (hours, days, weeks). When you are certain everything is okay, destroy the old home filesystem: # zfs destroy -r zroot/usr/home This should reclaim space in the 'zroot' pool and filesystem. David From owner-freebsd-questions@freebsd.org Mon Mar 15 15:35:17 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D489457E7D9 for ; Mon, 15 Mar 2021 15:35:17 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: from mail-ed1-x535.google.com (mail-ed1-x535.google.com [IPv6:2a00:1450:4864:20::535]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzgTx0H4Kz3FXf for ; Mon, 15 Mar 2021 15:35:16 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: by mail-ed1-x535.google.com with SMTP id o19so17876997edc.3 for ; Mon, 15 Mar 2021 08:35:16 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=ODxskmiEnCxiKQCtwA5uS69qK33l6WbsyrsQ6QgPmAc=; b=R+5ldlyRiZpWXhpatUhs/kRZY1hq4KWqLR9QNF0yrIPVdc1hJhgshCb9rwd9tbvQ6y Get+MNk+VS216k7Bhv8QNCP1VvBBJvbZ8Mb7JCafvk3dZZ/ZKfsQKarlTQXlDDMpQj5B MLAz++Yk+BAWPPA01yKG4Xuq4UQ91k0SlwyRIn+WiUvG1zlE00G7aRxGH0C1hzLEBE5p p8PxGwpyuD9D1/49r3kCHPOBoUEv5N/2jyKedvgMdQJyRAnz2YpsT7wTAKnpwu3xGWNh VlDhIWHgbWQBLr03gbAxy5q1N/lu2NOfhlI9+v0jSOouLMAZpPv84HLKLctAOwXklsxA edBg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=ODxskmiEnCxiKQCtwA5uS69qK33l6WbsyrsQ6QgPmAc=; b=to0VFHMIxt+OkiA7IRpQGd0r2xCT0AhI1+243A1Fi77iZb53F8ynEHgspyFHDniKlJ RPH5BgTLfxZx6GG8MfjGvq4NzFuuTU5U/zRVukyRwnp2KIlS3DrZSi5oOoXi/IUGNpCF YHnj8lEAxLbOnV9grGBHiN6IZOG353rmEaUVaDRqmRXQ8ws311Ti3AVw1fQe02VpONJT 93YIGgDrLiBQtpvDEtVq5qhYDikef8ejCTovt6q0mjm73Bb+1BdV0YwojOlvPxvd+6Cn gUffP4X/l3Pz5CVyrAg6eV++6Pll47c/E+BGWU9C6huldKlXJj904w4qzT9AOpu49LKZ qf+w== X-Gm-Message-State: AOAM533lrU5U7iX0eRJuz8OvaBpDHqsphcT/3N0vpeAsFv2B5Jo2km+Y Ce4eBU07TIESOpcArMJRBlqJCXHaBrO6AwZ47I3SInP87P4= X-Google-Smtp-Source: ABdhPJx9+Mb4Hq0E8xpTJ7PrqWFzenS+FSFw9WjJrzomieLc0AUGOnc1788PQrsY7dqpFbHb68Delc6MfImqsisxuE4= X-Received: by 2002:aa7:dd97:: with SMTP id g23mr30317066edv.154.1615822515256; Mon, 15 Mar 2021 08:35:15 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Waitman Gobble Date: Mon, 15 Mar 2021 11:35:03 -0400 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: FreeBSD Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4DzgTx0H4Kz3FXf X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=R+5ldlyR; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of gobblewa@gmail.com designates 2a00:1450:4864:20::535 as permitted sender) smtp.mailfrom=gobblewa@gmail.com X-Spamd-Result: default: False [-2.30 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::535:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::535:from:127.0.2.255]; NEURAL_SPAM_SHORT(0.70)[0.704]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::535:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 15:35:17 -0000 On Mon, Mar 15, 2021 at 2:44 AM David Christensen wrote: > > On 3/14/21 6:22 PM, Waitman Gobble wrote: > > On Sun, Mar 14, 2021 at 9:20 PM Waitman Gobble wrote: > >> > >> On Sun, Mar 14, 2021 at 8:00 PM David Christensen > >> wrote: > >>> > >>> On 3/14/21 4:03 PM, Waitman Gobble wrote: > >>>> I did a fresh install using ZFS with encryption. I copied the files on a > >>>> second drive (UFS) to /usr/home/backup (ZFS). I reformatted the second > >>>> drive ZFS and created a new pool "home" for that drive. It decided to mount > >>>> the drive as /home. AFAIK i never told the system to do that. But /home and > >>>> /usr/home are different, there is no link. > >>>> > >>>> I can only see /usr/home/backup if i boot into single user mode. If i mount > >>>> read write or boot normally then /usr/home is empty. > >>>> > >>>> I copied the files to a usb drive. > >>>> > >>>> How do i delete the backup? Its taking up 100 gb. I can see them read only > >>>> and copy to usb drive, but as soon as i mount read write they disappear. I > >>>> did not import the home pool, it does not show up in the status command. > >>> > >>> > >>> Please run the following commands and post your console session: > >>> > >>> # gpart show > >>> > >>> # zpool list > >>> > >>> # zfs list -d 1 > >>> > >>> # zfs list -r -t all home > >>> > >>> > >>> David > >> > >> Thanks for the reply. > >> > >> Ok, Here's the info from multi-user mode. > >> > >> In single user mode the 'home' pool (second drive) doesn't show up in > >> status or list or anything, which is fine. > >> When I boot into single user mode / read only then /usr/home has 100gb > >> of backup. If I reboot to multi-user or mount read-write in single > >> user then the files in /usr/home disappear. (even if the second drive > >> isn't mounted). The 80 GB avail should be like 180GB I think, it's a > >> 250GB drive. The usage stats don't change if the files in /usr/home > >> appear or not. > >> > >> The home directory for the second drive is /home which isn't a link to > >> /usr/home or vice-versa AFAIK. in multi-user mode /home has my files, > >> /usr/home is empty. in single-user read only , /home is empty and > >> /usr/home has the backup files. > >> > >> root@ayo:/home # gpart show > >> => 40 488397088 ada0 GPT (233G) > >> 40 532480 1 efi (260M) > >> 532520 1024 2 freebsd-boot (512K) > >> 533544 984 - free - (492K) > >> 534528 4194304 3 freebsd-swap (2.0G) > >> 4728832 483667968 4 freebsd-zfs (231G) > >> 488396800 328 - free - (164K) > >> > >> => 40 976773088 ada1 GPT (466G) > >> 40 976773088 1 freebsd-zfs (466G) > >> > >> => 40 976773088 da0 GPT (466G) > >> 40 2008 - free - (1.0M) > >> 2048 976771072 1 freebsd-ufs (466G) > >> 976773120 8 - free - (4.0K) > >> > >> => 40 976773088 da1 GPT (466G) > >> 40 2008 - free - (1.0M) > >> 2048 976771072 1 freebsd-ufs (466G) > >> 976773120 8 - free - (4.0K) > >> > >> root@ayo:/home # zpool list > >> NAME SIZE ALLOC FREE CKPOINT EXPANDSZ FRAG CAP DEDUP > >> HEALTH ALTROOT > >> home 464G 294G 170G - - 0% 63% 1.00x ONLINE - > >> zroot 230G 142G 87.6G - - 0% 61% 1.00x ONLINE - > >> root@ayo:/home # zfs list -d 1 > >> NAME USED AVAIL REFER MOUNTPOINT > >> home 294G 156G 294G /home > >> zroot 142G 80.4G 96K /zroot > >> zroot/ROOT 140G 80.4G 96K none > >> zroot/tmp 184K 80.4G 184K /tmp > >> zroot/usr 1.38G 80.4G 96K /usr > >> zroot/var 877M 80.4G 96K /var > >> root@ayo:/home # zfs list -r -t all home > >> NAME USED AVAIL REFER MOUNTPOINT > >> home 294G 156G 294G /home > >> root@ayo:/home # ls /usr/home/ > >> [nada] > >> root@ayo:/home # > >> > >> > > > > oops, missed a couple. sorry. > > > > root@ayo:/home # zfs list -r -t all home > > NAME USED AVAIL REFER MOUNTPOINT > > home 294G 156G 294G /home > > > > root@ayo:/home # zfs list -d 1 > > NAME USED AVAIL REFER MOUNTPOINT > > home 294G 156G 294G /home > > zroot 142G 80.4G 96K /zroot > > zroot/ROOT 140G 80.4G 96K none > > zroot/tmp 184K 80.4G 184K /tmp > > zroot/usr 1.38G 80.4G 96K /usr > > zroot/var 877M 80.4G 96K /var > > > It looks like 'ada0' is a 250 GB drive with GPT and your system > partitions. ada0p4 should be your root partition with the ZFS pool > 'zroot', containing the root filesystem. 'zroot/usr/home' should be a > ZFS filesystem mounted at /usr/home. These commands will confirm: > > # zfs list -d 1 zroot/usr > > # zfs list -r -t all zroot/usr/home > > > '/home' should be a symbolic link to '/usr/home'. These commands will > confirm: > > # ls -l /home > > # ls -l /usr > > > It looks like 'ada1' is a 500 GB drive with the ZFS pool 'home'. ZFS > mounts this at '/home' by default. This mount overlays the root > filesystem symbolic link '/home', but I do not understand why > '/usr/home/backup' disappears. > > > I would do the following as root in single-user mode: > > 1. Record your console session with script(1). Exact details will be > useful later; sooner if something goes wrong. > > 2. Take a recursive snapshot of the 'zroot' and 'home' ZFS filesystems. > Pick a meaningful SNAPNAME (I do date/ time strings): > > # zfs snapshot -r zroot@SNAPNAME home@SNAPNAME > > 3. Unmount the ZFS filesystem 'zroot/usr/home', make it read-only, > change its mountpoint, and mount it:: > > # zfs unmount zroot/usr/home > > # zfs set readonly=on zroot/usr/home > > # zfs set mountpoint=/usr/oldhome zroot/usr/home > > # zfs mount zroot/usr/home > > /usr/oldhome and /usr/oldhome/backup should now be visible. > > (If you previously created a ZFS filesystem > 'zroot/usr/home/backup', repeat the first, second, and fourth steps > above; adjusting the filesystem name. The 'mountpoint' property should > be inherited.) > > 4. Set the mountpoint of the ZFS pool 'home' and mount it: > > # zfs set mountpoint=/usr/home home > > # zfs mount home > > /usr/home should now be visible. > > 5. It is recommended practice not to put files and directories into the > base filesystem of a ZFS pool (e.g. '/usr/home') -- it is better to > create ZFS filesystems at the base level of a pool and put files, > directories, and/or additional ZFS filesystems into those. Assuming > '/usr/oldhome/backup' represents your old home directory, create a ZFS > filesystem for your new home directory: > > # zfs create home/username > > Do the same when adding more accounts in the future. > > 6. Assuming '/usr/oldhome/backup' represents one user account, copy its > contents to '/usr/home/username'. > > 7. Reboot and check everything. > > 8. Wait a while (hours, days, weeks). When you are certain everything > is okay, destroy the old home filesystem: > > # zfs destroy -r zroot/usr/home > > This should reclaim space in the 'zroot' pool and filesystem. > > > David > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.org" Thanks for everyone's help. It seems my problem was that /home was an actual directory. I don't recall creating that, normally I would not do that. This was a fresh install but I rsynched some files from the old drive to the new one, like most of /etc, /root, /usr/local, /var. Anyhow, when I deleted /home and created a symlink, the backup directory magically appeared in /usr/home. So I deleted that and reclaimed 100G of drive space. Then I mounted the home pool and it mounted to /usr/home instead of /home. Everything seems to work. So in summary, for some reason there was a /home directory. and if you create a pool named "home" it does magic stuff like it knows it's supposed to be home i guess. If /home is a directory then it acts crazy. Deleting /home makes it sane again. -- Waitman Gobble From owner-freebsd-questions@freebsd.org Mon Mar 15 18:12:02 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 172AD5AB29B for ; Mon, 15 Mar 2021 18:12:02 +0000 (UTC) (envelope-from shamim.shahriar@gmail.com) Received: from mail-qk1-x72b.google.com (mail-qk1-x72b.google.com [IPv6:2607:f8b0:4864:20::72b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dzkyn0jnqz3jg0 for ; Mon, 15 Mar 2021 18:12:01 +0000 (UTC) (envelope-from shamim.shahriar@gmail.com) Received: by mail-qk1-x72b.google.com with SMTP id 130so32583721qkh.11 for ; Mon, 15 Mar 2021 11:12:00 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=dT0Jb3fGjKQXot785U8g3MR+GXCqpYGzy2b2QFNbkac=; b=izTLq4XwpuIUQ0WZrBufRazO69l76JLChlGIFZt8QX5czD3BAv5VCiC8oTpYNjjuCa Jq5VEqslStZIITt1uxLv9eePHRla8BgxWt8x9ni5/h2cP0bHEywsi8O4QjY0fkYIG2TS Xvu3U+Mal4UzjmyE9vLw9rjY9P5voUrO+cw9MHI6uoMBUezJpfkzOh7wmXFTzmYCVZtA SvaeyCjkK5ZZj12AlxojDr14cBLP+1q8QjWdIle8E/Ggl+fm7ZE18xBrjZBQzo3E2sdH T0TgPE1mtSUtKZQPNq3uzQmKayXCoUHtx12/URxXjA80sUbCJoaTMRBA+WOa0QQYHUMF EETQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=dT0Jb3fGjKQXot785U8g3MR+GXCqpYGzy2b2QFNbkac=; b=krZajCQ8guANP0biXmYrA4N+YPor4+XHCnNQMg18KrdIpSLAhJDJTIccGKy9qZMs9D Xhz754bG2AnLXQaDDWwCbOTwijGRRClYA5Qw8mRcQ8BNwaN/5M1koTdbyfDVHe3m0ILx mpPPAouWv1GdoeZfoQS2SCaj1E4u/vW3PZjhlfKqlH0ueXSI/M6Ba9/LBImhfqfK8BeE glZdYGPb70l9UmStHu+emqgRGccuyY4LDvwSgdAnnfPxI54ClJqX/zKTi0/P0g22jWdI Fq0ZKkfLOqEo7/iqkYpKbSotPUaSjpg4MX+BsZtK5upI5OAcfXTkdUQsWsLqQ0gP9zp5 I03Q== X-Gm-Message-State: AOAM531+Rxl7PuObHU7AeWhFCL5aTuJNlaWuNgOSITq6pjIR7uqlg9AV XzQ+l7DRYN70ddKgj+RCHr4a2MKWntkGZgZZjQ== X-Google-Smtp-Source: ABdhPJyvdar5OXnf7basPCKot+8ahigqVli9yE4+sVbbq+wiagU64oWbXnQSSv8VYGE1Nae+P+TqisR1aOoNxoxShwI= X-Received: by 2002:a05:620a:e:: with SMTP id j14mr1730744qki.117.1615831920240; Mon, 15 Mar 2021 11:12:00 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Shamim Shahriar Date: Mon, 15 Mar 2021 18:11:48 +0000 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: Waitman Gobble Cc: FreeBSD X-Rspamd-Queue-Id: 4Dzkyn0jnqz3jg0 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=izTLq4Xw; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of shamimshahriar@gmail.com designates 2607:f8b0:4864:20::72b as permitted sender) smtp.mailfrom=shamimshahriar@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::72b:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::72b:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::72b:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 18:12:02 -0000 On Mon, 15 Mar 2021, 15:35 Waitman Gobble, wrote > > So in summary, for some reason there was a /home directory. and if you > create a pool named "home" it does magic stuff like it knows it's > supposed to be home i guess. If /home is a directory then it acts > crazy. Deleting /home makes it sane again. > > It is not magic. Any newly created pool, unless otherwise instructed, mounts the initial dataset to / So, zpool create xyz creates /xyz and mounts the initial dataset there. Hope that helps. > From owner-freebsd-questions@freebsd.org Mon Mar 15 20:29:11 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 209545AE8B3 for ; Mon, 15 Mar 2021 20:29:11 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: from mail-ej1-x62e.google.com (mail-ej1-x62e.google.com [IPv6:2a00:1450:4864:20::62e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dzp1221XYz3tX4 for ; Mon, 15 Mar 2021 20:29:10 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: by mail-ej1-x62e.google.com with SMTP id mm21so68433599ejb.12 for ; Mon, 15 Mar 2021 13:29:09 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=4DY+96q7PJZ0TH/9EtMDZ+2wfhZ5q8RepWi7yapxK7Q=; b=dj8q3+b/90KolnE6sVlLrD3ljvLxrzp7oZCmAX7c/YPnD16RDJ+l6tw2A6sqlyYnWk tI0W9eHL54q1g5KHVmcx9rtODCdfOQz9RUL3FDViZHFgSYk0lZmXt+ZwltUNIgdRmOrH K03k8fkWgR4npqjq5MAsjDeRwJybUc1KZGk+bheaPnyGUxkkz+n+s1wmRA7uzgd+NHyy K51eLPmEAynuCP4azChktk5KZzEAOmaZzEKgTiRiEcpTwqGRcfNmlfViM9UGzHOuPfD7 HbjFI/0MbzcjeJL5k33yRT1IWaNwmcMrHUZ+MMLa/wZ94K63eOUzWTsrRq9rPMINlcy/ pcaw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=4DY+96q7PJZ0TH/9EtMDZ+2wfhZ5q8RepWi7yapxK7Q=; b=WOHXaZhFahOxGCrCorM8PAAc0ZE4BUVfltjRQyLk1D0nEP1d/wYItBpT+cKOlVkFrJ JrRSA5M5tu1WrK5Tt4s0LzyLoPMT9OyOjFJuwiIWCr8kZwWJyYflG1E2PxLNSrGWXHyf BVQ0t7PHAavXzr3YD7SoeQlDs7XJEXsiebtOreZ2BhOUbrOU87lag9EsHZ/GmvfJWN5a LEw57QFCC7GCKV6Kc8v9Ih3TUkcoSrez9LEV7aXLTmQA6sNuwVipSgyIb01W51naTwUn YYPsRj1jiPzlGimEVwuwd9mLmTgT22ZXvLszqNck24YHRjADoppYvXJLG5m+ymqN1ngT SErw== X-Gm-Message-State: AOAM533tTfx5NxhCF5j2HOJlm1F5SJgR+LnLTSZG+WHI51ga0VOyBbA6 mX05eQWi+DcS0912lHN7zDUq7cLF2qm40YySuMm14zZUldg= X-Google-Smtp-Source: ABdhPJx2WnGoCNnqWZc8AOwidtPi4ZU1U5AA8QGCUrDTO0bLoBtlAfu2ZRr4QEIWS9aQWJYz6l+q/LeBqgSG7sxyjLw= X-Received: by 2002:a17:906:4410:: with SMTP id x16mr25881970ejo.446.1615840148635; Mon, 15 Mar 2021 13:29:08 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Waitman Gobble Date: Mon, 15 Mar 2021 16:28:57 -0400 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: FreeBSD Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4Dzp1221XYz3tX4 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=dj8q3+b/; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of gobblewa@gmail.com designates 2a00:1450:4864:20::62e as permitted sender) smtp.mailfrom=gobblewa@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::62e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::62e:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::62e:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 20:29:11 -0000 On Mon, Mar 15, 2021 at 2:12 PM Shamim Shahriar wrote: > > > > On Mon, 15 Mar 2021, 15:35 Waitman Gobble, wrote >> >> >> So in summary, for some reason there was a /home directory. and if you >> create a pool named "home" it does magic stuff like it knows it's >> supposed to be home i guess. If /home is a directory then it acts >> crazy. Deleting /home makes it sane again. >> > > It is not magic. Any newly created pool, unless otherwise instructed, mounts the initial dataset to / > > So, zpool create xyz creates /xyz and mounts the initial dataset there. > > Hope that helps. I agree, it's not magic. Somehow I messed something up and it is fixed. It seemed to be behaving strangely. -- Waitman Gobble From owner-freebsd-questions@freebsd.org Mon Mar 15 20:38:49 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B95865AEECD for ; Mon, 15 Mar 2021 20:38:49 +0000 (UTC) (envelope-from bthcom@higonnet.net) Received: from ams101.greengeeks.net (ams101.greengeeks.net [107.6.161.162]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzpD839nZz3vVZ for ; Mon, 15 Mar 2021 20:38:48 +0000 (UTC) (envelope-from bthcom@higonnet.net) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=higonnet.net; s=default; h=Content-Transfer-Encoding:Content-Type: In-Reply-To:MIME-Version:Date:Message-ID:From:References:To:Subject:Sender: Reply-To:Cc:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Id:List-Help: List-Unsubscribe:List-Subscribe:List-Post:List-Owner:List-Archive; bh=LRYHNkJY6+dzoujBeZyvwD+Ft4imzUEdc9LjMVt9Udk=; b=Zjw73ZlQfQ5ISKDTRaFjd3OvV0 LudQZRRY6GLj9VzI2h9QKyorYVnBJz9M4WBBtd0cXtdGUtNCX7N7Rz6WUpuAM0tbavZCG3QjmoAa9 CeIPYXtIxYAfLeELG6o50Dz2hcf7fXKvhuxRU3K4iQgI7/CylD4bUpVSXLK5ggb7EJQwAohdaNlZ1 auhSSrnXjLo0pKj09WM1whB8ItMX6ejoRAck8bk746GVgeO0ZhkxEsV3u2g4FoASKwkUNjEM2DjTv AWl2UVrIfCFFS5kazfk+Yb1FAGKNq1Oy8kwxNB1BXsr+WkFgvpxlYZ9b2Zk0w22mTz+WbZsR7xbjb gun+wKQw==; Received: from [82.142.8.1] (port=29420 helo=bthejmhd.hd.free.fr) by ams101.greengeeks.net with esmtpsa (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 (Exim 4.94) (envelope-from ) id 1lLtz6-0006sx-O9 for freebsd-questions@freebsd.org; Mon, 15 Mar 2021 21:38:40 +0100 Subject: Re: Where can I get libjpeg? - problem with mozjpeg To: "freebsd-questions@freebsd.org" References: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> From: "Bernard T. Higonnet" Message-ID: <8847e238-dbc2-436f-25b6-630c204f69cc@higonnet.net> Date: Mon, 15 Mar 2021 21:38:43 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-AntiAbuse: This header was added to track abuse, please include it with any abuse report X-AntiAbuse: Primary Hostname - ams101.greengeeks.net X-AntiAbuse: Original Domain - freebsd.org X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12] X-AntiAbuse: Sender Address Domain - higonnet.net X-Get-Message-Sender-Via: ams101.greengeeks.net: authenticated_id: bthcom@higonnet.net X-Authenticated-Sender: ams101.greengeeks.net: bthcom@higonnet.net X-Rspamd-Queue-Id: 4DzpD839nZz3vVZ X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=higonnet.net header.s=default header.b=Zjw73ZlQ; dmarc=none; spf=pass (mx1.freebsd.org: domain of bthcom@higonnet.net designates 107.6.161.162 as permitted sender) smtp.mailfrom=bthcom@higonnet.net X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+a]; DKIM_TRACE(0.00)[higonnet.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; HAS_X_ANTIABUSE(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:32475, ipnet:107.6.160.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; SUBJECT_HAS_QUESTION(0.00)[]; HAS_X_AS(0.00)[bthcom@higonnet.net]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[higonnet.net:s=default]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[higonnet.net]; RCPT_COUNT_ONE(0.00)[1]; HAS_X_GMSV(0.00)[bthcom@higonnet.net]; TO_DN_EQ_ADDR_ALL(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[107.6.161.162:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 20:38:49 -0000 No, I'm afraid that graphics/libjpeg-turbo is the same as libjpeg-turbo and pkg upgrade jpeg-turbo had no effect. As expected pkg check -B tells me all the packages missing libjpeg. I am a bit puzzled that pkg says all my packages are up to date, and yet they're missing libjpeg...? I naïvely thought that installing a package installs any dependencies? Bernard Higonnet On 3/14/21 8:32 AM, Kevin Oberman wrote: > On Sat, Mar 13, 2021 at 11:17 PM Bernard T. Higonnet > > wrote: > > I am running 12.2-RELEASE-p3 GENERIC  amd64, my applications are all > installed using pkg. > > Many applications will not start because I am missing libjpeg.so.8. > I am > able to find libjpeg.turbo but installing either (or both) of > jpeg-turbo-2 and libjpeg-turbo-2 do not help. > > One bizarre particularity of my system is that if I do > > pkg install mozjpeg > > it comes back and tells me it will delete just about every package I > have installed and will not attempt to re-install them: > > Number of packages to be removed: 207 > Number of packages to be installed: 1 > Number of packages to be reinstalled: 1 > > Any help appreciated. > > Bernard Higonnet > > I believe you want "pkg install graphics/jpeg-turbo". Do not put the > "-2" onto it. If you already have a version of jpeg-turbo installed, > "pkg upgrade jpeg-turbo". I am baffled as to why mozturbo wants to > delete 207 ports, but deleting a port that you want to replace is done > with the -f switch. It's best to make sure all libraries are available > with "pkg check -B" and "pkg check -d" to confirm that all required > libraries and dependencies are present. > -- > Kevin Oberman, Part time kid herder and retired Network Engineer > E-mail: rkoberman@gmail.com > PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683d From owner-freebsd-questions@freebsd.org Mon Mar 15 21:12:28 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EBA775AF9ED for ; Mon, 15 Mar 2021 21:12:28 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from holgerdanske.com (holgerdanske.com [184.105.128.27]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "www.holgerdanske.com", Issuer "www.holgerdanske.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dzpyz6MPwz4SPy for ; Mon, 15 Mar 2021 21:12:27 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from 99.100.19.101 (99-100-19-101.lightspeed.frokca.sbcglobal.net [99.100.19.101]) by holgerdanske.com with ESMTPSA (TLS_AES_128_GCM_SHA256:TLSv1.3:Kx=any:Au=any:Enc=AESGCM(128):Mac=AEAD) (SMTP-AUTH username dpchrist@holgerdanske.com, mechanism PLAIN) for ; Mon, 15 Mar 2021 14:12:21 -0700 Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: freebsd-questions@freebsd.org References: From: David Christensen Message-ID: <2aa28118-d7ef-c601-6154-6d5cc237993f@holgerdanske.com> Date: Mon, 15 Mar 2021 14:12:21 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4Dzpyz6MPwz4SPy X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of dpchrist@holgerdanske.com has no SPF policy when checking 184.105.128.27) smtp.mailfrom=dpchrist@holgerdanske.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[184.105.128.27:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[184.105.128.27:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[holgerdanske.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6939, ipnet:184.104.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 21:12:29 -0000 On 3/15/21 1:28 PM, Waitman Gobble wrote: > On Mon, Mar 15, 2021 at 2:12 PM Shamim Shahriar > wrote: >> >> >> >> On Mon, 15 Mar 2021, 15:35 Waitman Gobble, wrote >>> >>> >>> So in summary, for some reason there was a /home directory. and if you >>> create a pool named "home" it does magic stuff like it knows it's >>> supposed to be home i guess. If /home is a directory then it acts >>> crazy. Deleting /home makes it sane again. >>> >> >> It is not magic. Any newly created pool, unless otherwise instructed, mounts the initial dataset to / >> >> So, zpool create xyz creates /xyz and mounts the initial dataset there. >> >> Hope that helps. > > > I agree, it's not magic. Somehow I messed something up and it is > fixed. It seemed to be behaving strangely. I'm glad it worked out. :-) The Oracle online ZFS documents are good, but you have to bear in mind that Solaris and ZFS are not FreeBSD and OpenZFS: https://docs.oracle.com/cd/E26505_01/pdf/E37384.pdf https://docs.oracle.com/cd/E26502_01/html/E29007/docinfo.html#scrolltoc Michael W. Lucas writes really good books. I have many of his titles, including: https://mwl.io/nonfiction/os#af3e https://mwl.io/nonfiction/os#fmzfs https://mwl.io/nonfiction/os#fmaz David From owner-freebsd-questions@freebsd.org Mon Mar 15 21:39:15 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1C585568DCC for ; Mon, 15 Mar 2021 21:39:15 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: from mail-ej1-x632.google.com (mail-ej1-x632.google.com [IPv6:2a00:1450:4864:20::632]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzqYt2rYrz4V31 for ; Mon, 15 Mar 2021 21:39:14 +0000 (UTC) (envelope-from gobble.wa@gmail.com) Received: by mail-ej1-x632.google.com with SMTP id mm21so68709737ejb.12 for ; Mon, 15 Mar 2021 14:39:14 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=oMZh40LRNNfChkw3klgCGY53EpP8lo3ClHCVshOAISI=; b=DS3FNRlmf0Q8UOHR1hWq4vy10FnW/A8dvh8GzJu+4GcdO22xmU9VZvFcVoMOGGDJsA jssG4xuZgx4KjV+beU5v31ODrOfCfq7cc6R5cAHtQgJMCiX9sVyZdMFmeCkXK+nrmERv WzbhgQDALoubxBiQT8/A4kTGlauJ/O8ssKLEuC48U9bhyEG6+Cyxlsit97wvweigKMPn mjVHM3UAtw1lpRmtTdxoHRXK2nVTkP8o4KrUMXKvK7o/NSx+sfVEwEo6BZuZcm0BA53b TJJ8vaYhg9/hK3IndpK4CaIre6txQVI4SfacaouaMEAaJkv4aP/lzaj/4IboFTlcqBK9 i2vQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=oMZh40LRNNfChkw3klgCGY53EpP8lo3ClHCVshOAISI=; b=WSZAs63bn1SzT06yI5JX7QioPuHAq9n8MpLMMdbL9JdM7Ngmu/pPFxBQ8Q2jneXyH/ 5wB+MzaPYWSWgguDLLEpTRBWAkYfxX20KjFJOBIB582yhI0c7ccnIjJ2n6tpjL6bAJos j3K7IF6OffE4FsSM32GyFlohC5jgIGOYPg5KzGMVdRqVlQYoENRvsAQ3XzrpQbwuZcJ8 iq8RMvQliQyEUD85bRyjS4Gg/lOM/MlF3JgGin+i9QLa5n+DhhqSdiAM03NMj1eYqLZ9 NqmNGfAqYKKccMupq0X+ek0MUFE9xviVZ2e6pKm8DBno67rCItqxMSu93c4lUV4Z8fBn DO9w== X-Gm-Message-State: AOAM532inigHmbq3oS0thHqIEU3vDC02rlckN7NXb3CK7jy6N1mLXboB 2lXpsCUUv/Az9e+/u/btyf6Tc4Hd4NH4uvIB046I5Tjikno= X-Google-Smtp-Source: ABdhPJwITxypbjCLqtZfi2hzfvJ8qY6Q8uHQswvpxsWJnPTCbtUDujZSaaIzmVXWl4Buy6Kgxm2EjN7LyR2jt+/N5qk= X-Received: by 2002:a17:906:ad96:: with SMTP id la22mr26930752ejb.237.1615844352651; Mon, 15 Mar 2021 14:39:12 -0700 (PDT) MIME-Version: 1.0 References: <2aa28118-d7ef-c601-6154-6d5cc237993f@holgerdanske.com> In-Reply-To: <2aa28118-d7ef-c601-6154-6d5cc237993f@holgerdanske.com> From: Waitman Gobble Date: Mon, 15 Mar 2021 17:39:01 -0400 Message-ID: Subject: Re: Disappearing files in FreeBSD 13.0-R2 To: FreeBSD Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4DzqYt2rYrz4V31 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=DS3FNRlm; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of gobblewa@gmail.com designates 2a00:1450:4864:20::632 as permitted sender) smtp.mailfrom=gobblewa@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::632:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::632:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::632:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Mon, 15 Mar 2021 21:39:15 -0000 On Mon, Mar 15, 2021 at 5:12 PM David Christensen wrote: > > On 3/15/21 1:28 PM, Waitman Gobble wrote: > > On Mon, Mar 15, 2021 at 2:12 PM Shamim Shahriar > > wrote: > >> > >> > >> > >> On Mon, 15 Mar 2021, 15:35 Waitman Gobble, wrote > >>> > >>> > >>> So in summary, for some reason there was a /home directory. and if you > >>> create a pool named "home" it does magic stuff like it knows it's > >>> supposed to be home i guess. If /home is a directory then it acts > >>> crazy. Deleting /home makes it sane again. > >>> > >> > >> It is not magic. Any newly created pool, unless otherwise instructed, mounts the initial dataset to / > >> > >> So, zpool create xyz creates /xyz and mounts the initial dataset there. > >> > >> Hope that helps. > > > > > > I agree, it's not magic. Somehow I messed something up and it is > > fixed. It seemed to be behaving strangely. > > > I'm glad it worked out. :-) > > > The Oracle online ZFS documents are good, but you have to bear in mind > that Solaris and ZFS are not FreeBSD and OpenZFS: > > https://docs.oracle.com/cd/E26505_01/pdf/E37384.pdf > > https://docs.oracle.com/cd/E26502_01/html/E29007/docinfo.html#scrolltoc > > > Michael W. Lucas writes really good books. I have many of his titles, > including: > > https://mwl.io/nonfiction/os#af3e > > https://mwl.io/nonfiction/os#fmzfs > > https://mwl.io/nonfiction/os#fmaz > > > David > _______________________________________________ Thanks. I know I bought the Absolute FreeBSD but maybe a previous edition, it's been some years. Looks like there is a ZFS specific book I should get. -- Waitman Gobble From owner-freebsd-questions@freebsd.org Tue Mar 16 00:18:41 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8360156D32E for ; Tue, 16 Mar 2021 00:18:41 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: from mail-wm1-x335.google.com (mail-wm1-x335.google.com [IPv6:2a00:1450:4864:20::335]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dzv5r5yZ8z4gNk for ; Tue, 16 Mar 2021 00:18:40 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: by mail-wm1-x335.google.com with SMTP id f22-20020a7bc8d60000b029010c024a1407so431658wml.2 for ; Mon, 15 Mar 2021 17:18:40 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=S4Rq5y2FoyTJm6Xy9vNi1PLuw9xD9XNgs8rC6HMWFac=; b=oUsb2fDp/gwQDoGO4fJw7OZt+BHvPjINbljqOeHq+NwqxayheelgCLVaYh3ipOhoQU zW7ZBAKaH+OnKoy+uyX0OBC92P1MvxoGd+Asdg8y/8XWi0tKcjf0nYCUxeXntYiSyWjh 5e7LNEgxKDp5n1mX+jtH0ztXb7IrZ8fXh/hqSpSfyqTlPf9xQ6j59h3YUC4NBCwfk4wo 7M5Sdr5NEaHChGbXtDhueswxmGXz/HeK6mkY/S5j29DyEcK4fyFugOmwPXcCO5p3Oovc nfLbQHN+sXG3PrCplzyobRGxc6khz/3JAWhyPf3MQmojNTWzJ3E6UvFV97ZLFW5wrQkc TDqw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=S4Rq5y2FoyTJm6Xy9vNi1PLuw9xD9XNgs8rC6HMWFac=; b=EGvvGBXic1p0ZckKPKj6arxHHFMx0020I2dcqfNz9U4n24OhyXbq8cn5lsdmPR0YLZ UqEo2I5p7ISHOZqWBKU8guaoOxqjjlh7ksr4oUK5bg8svCVEKdoU6bJYItJY/3nRBdRE JYeIwYFHvpDouAeWrkyAIb9VEUQGTUBatRlTDms6qAFQfHXhrPRYutfJlIPPdkYRPVbI MWqDVUt6ZhP5zgCy2cvS6OX7HeKM8Mm9N5HKESu34g8JP+j8wi145P/jpVS8DqZNfvka VZdFD2oBcyrjIPbq94OpAZmN/6cWVNl0DYXTyCSnCE9z1i7UpLoebb3cp4IsBqQJMwjy f4jw== X-Gm-Message-State: AOAM5315wnVYPRREKcm2+g7+NpbPZPvuZWMNi4aqHh5SQ68AkhoZmtvS RjvDiFAgAkBWG/YtxZ32iU/LN4I/XGL1Cn1M+/lzqI/H X-Google-Smtp-Source: ABdhPJzNyD/dP5uh1JaoMhbbqQMHYeMS1OXgwvOwvh1YC7aBAA7+X6UFvRWJX/bxlxp02SfX9ql5vrqH3PbBtH4/EEY= X-Received: by 2002:a1c:e244:: with SMTP id z65mr1971406wmg.130.1615853919429; Mon, 15 Mar 2021 17:18:39 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: "parv/freebsd" Date: Mon, 15 Mar 2021 14:16:42 -1000 Message-ID: Subject: Re: emulators/virtualbox-ose-additions 6.1.18 fails to build while compiling mount_vboxfs.c To: FreeBSD X-Rspamd-Queue-Id: 4Dzv5r5yZ8z4gNk X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=oUsb2fDp; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of parv0zero9@gmail.com designates 2a00:1450:4864:20::335 as permitted sender) smtp.mailfrom=parv0zero9@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::335:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[freebsd]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::335:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::335:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 00:18:41 -0000 On Fri, Mar 12, 2021 at 10:42 AM parv/freebsd wrote: > On Fri, Mar 12, 2021 at 9:59 AM parv/freebsd wrote: > >> On Fri, Mar 12, 2021 at 9:49 AM parv/freebsd wrote: >> ... >> > No need to build anymore as a package is now available. Anyway ... On FreeBSD stable/12-n232694-f2a88e74470 ... >>> >>> - have in /etc/make.conf to avoid use of DBUS, HAL, & WAYLAND via >>> OPTIONS_UNSET; >>> - using MINIMAL kernel with COMPAT_FREEBSD10 & COMPAT_FREEBSD11 only for >>> Firefox; >>> - packages & ports tree (r568143) are uptodate >>> >> >> I should have also mentioned that FreeBSD 12-STABLE tree is at commit >> 623fe87b21, Mar 11, 2021. >> >> ... build of emulators/virtualbox-ose-additions version 6.1.18 fails to >>> build >>> due to "use of undeclared identifier" while compiling mount_vboxfs.c ... >>> >>> >>> kBuild: Compiling mount_vboxvfs - /usr/src/sys/../sbin/mount/getmntopts.c >>> kBuild: Compiling mount_vboxvfs - >>> /src-build/ports-build/src-build/ports/emulators/virtualbox-ose-additions/work/VirtualBox-6.1.18/src/VBox/Additions/freebsd/mount_vboxvfs/mount_vboxvfs.c >>> /src-build/ports-build/src-build/ports/emulators/virtualbox-ose-additions/work/VirtualBox-6.1.18/src/VBox/Additions/freebsd/mount_vboxvfs/mount_vboxvfs.c:54:2: >>> error: use of undeclared identifier 'MNT_NOCOVER' >>> MOPT_STDOPTS, >>> ^ >>> /usr/src/sys/../sbin/mount/mntopts.h:100:2: note: expanded from macro >>> 'MOPT_STDOPTS' >>> MOPT_NOCOVER, \ >>> ^ >>> /usr/src/sys/../sbin/mount/mntopts.h:68:37: note: expanded from macro >>> 'MOPT_NOCOVER' >>> #define MOPT_NOCOVER { "cover", 1, MNT_NOCOVER, 0 } >>> ^ >>> /src-build/ports-build/src-build/ports/emulators/virtualbox-ose-additions/work/VirtualBox-6.1.18/src/VBox/Additions/freebsd/mount_vboxvfs/mount_vboxvfs.c:54:2: >>> error: use of undeclared identifier 'MNT_EMPTYDIR' >>> /usr/src/sys/../sbin/mount/mntopts.h:101:2: note: expanded from macro >>> 'MOPT_STDOPTS' >>> MOPT_EMPTYDIR >>> ^ >>> /usr/src/sys/../sbin/mount/mntopts.h:69:41: note: expanded from macro >>> 'MOPT_EMPTYDIR' >>> #define MOPT_EMPTYDIR { "emptydir", 0, MNT_EMPTYDIR, 0 } >>> >> > Both of the options were added to in Sep 2019 ... > > https://reviews.freebsd.org/rS352614 > ... but do not seem to exist in FreeBSD 12 ... > > # Shows nothing, unlike or '(MOPT|MNT)_RDONLY' for example. > % egrep -r '(MOPT|MNT)_(NOCOVER|EMPTYDIR)' sbin/mount \ > sys/{kern,sys} lib/libc/sys > > > ... so why is the port is looking for the macros/identifiers? > ... I suspect when the build of virtualbox-ose-additions was running, the source tree might have not have been at "stable/12" branch. After making sure that the tree is indeed at "stable/12", build, and thus install, had succeeded. A "make package" had failed due to missing "$WRKSRC/../.metadir", which it is. Why? - parv From owner-freebsd-questions@freebsd.org Tue Mar 16 00:38:35 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D55A056DCBB for ; Tue, 16 Mar 2021 00:38:35 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: from mail-wr1-x429.google.com (mail-wr1-x429.google.com [IPv6:2a00:1450:4864:20::429]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4DzvXq0p7fz4hmS for ; Tue, 16 Mar 2021 00:38:34 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: by mail-wr1-x429.google.com with SMTP id x13so6581166wrs.9 for ; Mon, 15 Mar 2021 17:38:34 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=7fNDVNo1kapQRaed5ZKaRyRh5qRtODpotkU+Y1YRfSg=; b=W38UzG+8rs83ozYxzyCodWbfU4QYRaDliMqiWj1Dfyn8voUFB6UTP2X+zCDqCQ0zBt oLsIBhKAaiCotYaRQdpfBg7cGwEQZQa9quoKQdXfni5wxhDEs1CcveIyr7iiRWLnSgD6 h64rcjFLGzgWs9Vq8hkh2nmsOm76Ee9d53i9w3KdRgwlze2rJ+KseJ3EyASNOc0X4c9l Zx/qkZ5px63AzL4uc2B7UBSE4BtrOdC07aE/NzIrxetAnInr44Dfbrgx7QkZoYSJdwKg joF4DDdY1rDxQYFGR/XNn0C0x0nAwqVpuxSoGesQhiIhr7Zd6hIsIjKSpa9cNZheg0uM x1IA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=7fNDVNo1kapQRaed5ZKaRyRh5qRtODpotkU+Y1YRfSg=; b=ifr/Xqs1z4+YQp+SY4t3DCAabgbVYF27VUWshm5J+MPiyk87XXTMP/W/A77m2JcscU FtSqe1F7Pt9ebil/nWvrAUy+yReofZelbnv/ojK913BYBM4uXtXoZcMwTUWi/0zwFrBA t0XCGLdAVRhHY9qLwF2exhNOI9U/5WkmhaPAv27QLycNyloPd26H0F3Exye2GUvCWd6D j3xCQoiQBzGSVGw8aM2wbagJWBKhkV5R/jfIjW+1DGx1QEf7UWpzHAIeVB0nL7u5+oqj M19mAqjqlc9jD/NunRWIrFKdHm80jtPlUKNv3WESu8EjqMp5uYSaplJchRfrIXbABbHJ IhPQ== X-Gm-Message-State: AOAM530w7NER0NlJTvePYNXy8rmBlE1y1JS1SfyC0uPFOlOOyeK13D1p KlzwQgokcBWb+6TscOadaf4BeFVQFSvi+caRBnhgJnS2 X-Google-Smtp-Source: ABdhPJyidtOgIIdlrGgxTUE9eDmVqsL0S2aA2uk/JNtFu5iP+W32jdmx8lNa/SKf+K5jtOiqvdZLnQ8yA9yorCmN/sk= X-Received: by 2002:adf:f1c4:: with SMTP id z4mr2105114wro.404.1615855113471; Mon, 15 Mar 2021 17:38:33 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: "parv/freebsd" Date: Mon, 15 Mar 2021 14:36:36 -1000 Message-ID: Subject: Re: emulators/virtualbox-ose-additions 6.1.18 fails to build while compiling mount_vboxfs.c To: FreeBSD X-Rspamd-Queue-Id: 4DzvXq0p7fz4hmS X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=W38UzG+8; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of parv0zero9@gmail.com designates 2a00:1450:4864:20::429 as permitted sender) smtp.mailfrom=parv0zero9@gmail.com X-Spamd-Result: default: False [-3.99 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.99)[-0.994]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::429:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[freebsd]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::429:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::429:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 00:38:35 -0000 On Mon, Mar 15, 2021 at 2:16 PM parv/freebsd wrote: ... > I suspect when the build of virtualbox-ose-additions was running, the > source > tree might have not have been at "stable/12" branch. After making sure that > the tree is indeed at "stable/12", build, and thus install, had succeeded. > > A "make package" had failed due to missing "$WRKSRC/../.metadir", which it > is. > Why? > Sorry, what failed was "make install package" due to above missing directory. A separate "make package" command after the previous command resulted in the package being built. But stored in $WRKSRC/pkg, not anywhere in $PACKAGES. - parv From owner-freebsd-questions@freebsd.org Tue Mar 16 01:30:52 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 35E3B5702AC for ; Tue, 16 Mar 2021 01:30:52 +0000 (UTC) (envelope-from matthew.t.rivard@intel.com) Received: from mga18.intel.com (mga18.intel.com [134.134.136.126]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "orsmga106.jf.intel.com", Issuer "Sectigo RSA Organization Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Dzwj63Fvlz4m2Q for ; Tue, 16 Mar 2021 01:30:50 +0000 (UTC) (envelope-from matthew.t.rivard@intel.com) IronPort-SDR: Ljk5aRjUpYeki6MLxKaHMpnvr0hEKFCgp9JQo2F3ZHjHPFCgcu+DNEGI5tynfjIOZlFvRcpmyl MWr3pN2pMuIA== X-IronPort-AV: E=McAfee;i="6000,8403,9924"; a="176777093" X-IronPort-AV: E=Sophos;i="5.81,251,1610438400"; d="scan'208,217";a="176777093" Received: from fmsmga004.fm.intel.com ([10.253.24.48]) by orsmga106.jf.intel.com with ESMTP/TLS/ECDHE-RSA-AES256-GCM-SHA384; 15 Mar 2021 18:30:47 -0700 IronPort-SDR: afTv4INSnPIu1NsTue1ynWEnKXqeEbDj98Aku+2yUTh/+quCcGPehNlNdGC3p18EBviMgdMdDQ ABl6ak6dBxzw== X-ExtLoop1: 1 X-IronPort-AV: E=Sophos;i="5.81,251,1610438400"; d="scan'208,217";a="432846081" Received: from fmsmsx601.amr.corp.intel.com ([10.18.126.81]) by fmsmga004.fm.intel.com with ESMTP; 15 Mar 2021 18:30:47 -0700 Received: from fmsmsx612.amr.corp.intel.com (10.18.126.92) by fmsmsx601.amr.corp.intel.com (10.18.126.81) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.2106.2; Mon, 15 Mar 2021 18:30:47 -0700 Received: from fmsmsx609.amr.corp.intel.com (10.18.126.89) by fmsmsx612.amr.corp.intel.com (10.18.126.92) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.2106.2; Mon, 15 Mar 2021 18:30:46 -0700 Received: from FMSEDG603.ED.cps.intel.com (10.1.192.133) by fmsmsx609.amr.corp.intel.com (10.18.126.89) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.2106.2 via Frontend Transport; Mon, 15 Mar 2021 18:30:46 -0700 Received: from NAM11-DM6-obe.outbound.protection.outlook.com (104.47.57.168) by edgegateway.intel.com (192.55.55.68) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.1.2106.2; Mon, 15 Mar 2021 18:30:46 -0700 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=aeYcLulUpssnxv4Jw+JgR6oletHrlnisUvfd6FYArB67+7jxx0q0DV9sM9ke7eP4D4xt9rhJqUcsJ8Pf4idcgxLEj0Zn7vyzMwJmmmiT/SDGhSqZ7jPnWx1qrL5tC4qA7ErDRb9iXT5R0+ga/gchVZnxeca+15QOI+YjPDWrwh/qeLCPGdESoZXwIcvL4IJyNLc4Yk0jMc20ZHRnNsxXTF2hvqrv/PAHkqFKuVG9yF4+X/v6Je7kh3WT42f+1MtmagrWQVkYPdT5Asr7F6uS3MkpJncH9ffVrNgLLezz5NlnQpfQEe5IZ2a9VyMTfxOrLhDeEtG3Vfwur8Gr19KKeA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=lR6FJgcDjxG3aGqwRYAltHCiPLVHekzWVp9IPkJ92OE=; b=Mq0TC2M3CVJIugyfZKv0m0W5uYYSOVFEWbEsZU8oaaUzwnEpAqNB+xvJVNyjErLzGKr0HHjb700u/nJNQrec+8qqqDph24BW+pv3WIk33aQi66RFQk+lXZEugUFQha1JkjULjvctpvsg22A3f4J+m0DtXG29ZRIx01IJgVijVO3ntqIna1wsvGnyBcMR4LnNwyKOAmAm/bbK40Ew8qjr76Z5Cn2zMNdo2Xzni0OUR7gu4W+6sOudgojh76pL7i3twII0GRx7VR8meK7bLguIwBwjKqk5f6i7yS4kxBR9N2/lm0iNB6hcIqTVNa/FJVzVL3gl+6bkgqcVuoR4WVJEEg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=intel.com; dmarc=pass action=none header.from=intel.com; dkim=pass header.d=intel.com; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=intel.onmicrosoft.com; s=selector2-intel-onmicrosoft-com; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=lR6FJgcDjxG3aGqwRYAltHCiPLVHekzWVp9IPkJ92OE=; b=jPBQlyJBNcqupVVoHA/DdjegG4JqaMmcabtoHFJVhoWFU5ciYEPjOZN7F1xfRFtCNIeS59XdQxJe09DMJ5TUULR1KfXAukJosQaNAmG8IhkM/ri1JpuSt+AM/eks5uESyoahZBoz2vYb9KkfnXLjlpmU81Q5tJXHGcucqnZLyJA= Received: from DM6PR11MB3564.namprd11.prod.outlook.com (2603:10b6:5:137::14) by DM6PR11MB3788.namprd11.prod.outlook.com (2603:10b6:5:13a::12) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.3933.32; Tue, 16 Mar 2021 01:30:44 +0000 Received: from DM6PR11MB3564.namprd11.prod.outlook.com ([fe80::7c37:2416:dde0:8e46]) by DM6PR11MB3564.namprd11.prod.outlook.com ([fe80::7c37:2416:dde0:8e46%6]) with mapi id 15.20.3933.032; Tue, 16 Mar 2021 01:30:44 +0000 From: "Rivard, Matthew T" To: "freebsd-questions@freebsd.org" Subject: Diskless Booting FreeBSD Hangs after "Setting currdev" Thread-Topic: Diskless Booting FreeBSD Hangs after "Setting currdev" Thread-Index: AdcaA7N5p6gATA3cRkidnVmlg9aAZQ== Date: Tue, 16 Mar 2021 01:30:43 +0000 Message-ID: Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: x-titus-metadata-40: eyJDYXRlZ29yeUxhYmVscyI6IiIsIk1ldGFkYXRhIjp7Im5zIjoiaHR0cDpcL1wvd3d3LnRpdHVzLmNvbVwvbnNcL0ludGVsMyIsImlkIjoiYmJmNGU0NjgtZWM1NS00YWJjLTllY2ItZWMxMjIzYmZhMzMzIiwicHJvcHMiOlt7Im4iOiJDVFBDbGFzc2lmaWNhdGlvbiIsInZhbHMiOlt7InZhbHVlIjoiQ1RQX05UIn1dfV19LCJTdWJqZWN0TGFiZWxzIjpbXSwiVE1DVmVyc2lvbiI6IjE3LjEwLjE4MDQuNDkiLCJUcnVzdGVkTGFiZWxIYXNoIjoibldkQUduOTRtS2l5ako1RkRBRStBeVArV1REUEFld1FnT3BcLzFZSEpMVjg0OTk2V0grN01hbWNXeUhMWlMwM1EifQ== x-ctpclassification: CTP_NT x-originating-ip: [134.134.136.201] x-ms-publictraffictype: Email x-ms-office365-filtering-correlation-id: 7f10cf95-035f-456d-5744-08d8e81b1e2a x-ms-traffictypediagnostic: DM6PR11MB3788: x-microsoft-antispam-prvs: x-ms-oob-tlc-oobclassifiers: OLM:6790; x-ms-exchange-senderadcheck: 1 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: nW9lg0APtPyCkzf0pzhXqdrToGWn8GaucQkXahYG8edaPXqaYdcmrGZKYCc7AtH79HtmT+miiQiSUO1jSNFyBaJyelK29g+1YFM3ka5hGncTpWlQ3KrXEOgDeLNpdnNGtpj68sdVcgkWIBEPoQMm5uR8QLmsZe8aEQDfdAxH+OmCs/d/P67u94953+RyBgiZOJU+HaIDKxj1rrdYIaYlv9vJ4DA9S/Ysjl7B98HBPXgHe1AkVs/2OMtWaae5rGYAr8JTVJ6FwFNyv2qCsvuOmvAV4nky+DAEa8zHQ1924TpXMDDepzGvEy1Phsv0lbGHJ999GUtyPFlz4aScITMhR26EIMx4D4u5EtYQSoq3fK9+sOQRBo5KzIgJqTIOf12pv0VJnjbxHJc+o71G5VjV8FQygDUGD9MKXDXEQ3Igq14tbcnOJSD4Kn/zc4gh7NVyDdEwbBKqmvWMy8Jjukr3j+sDhOgdB+mo292O19tdl47vp00HfJirx7ZnKPdmKYzTF+NuGhlCTfkTYwJc7ja1Al6lh3ITnVieYdE7YglCbFZVTwCu42mBAbbDZHBqbWz+ x-forefront-antispam-report: CIP:255.255.255.255; CTRY:; LANG:en; SCL:1; SRV:; IPV:NLI; SFV:NSPM; H:DM6PR11MB3564.namprd11.prod.outlook.com; PTR:; CAT:NONE; SFS:(136003)(39860400002)(366004)(396003)(346002)(376002)(8936002)(558084003)(6506007)(64756008)(7696005)(66556008)(33656002)(52536014)(66446008)(86362001)(9686003)(26005)(186003)(316002)(66946007)(66476007)(478600001)(2906002)(76116006)(5660300002)(8676002)(6916009)(71200400001)(55016002); DIR:OUT; SFP:1102; x-ms-exchange-antispam-messagedata: =?us-ascii?Q?Z1YMKtXGHABXTYUcXNhe1gxmFNlBqr2cOYejY3UuakdeY+KcsgaTbJptbHTm?= =?us-ascii?Q?/VH38Duz2p2b0fBZzqwVXzxceUv8nhiT4IfeGyUOYZH1Bu63QkWDDp5jEBN3?= =?us-ascii?Q?MhEMLY5O1ZwEDdC4lbySa1Q6QX/uVI8g/IYeWi6w5pmhcR+g4COqP233eNGB?= =?us-ascii?Q?qzDo9hIvVO1z/+ceXr5bJrHj98EaaFqUZ5rtKvYfMuLE2wb6Quf2QSNdH6fg?= =?us-ascii?Q?3zKeVeB8o2hLRKbBeR/VwLpxKw888BNXFG/1MimuOsqehYELX1LPGIWyC4zK?= =?us-ascii?Q?4R6IxrLIHS1omE8hi/yHCWeIATJsthOjMBT3+qNDeW30wVm2a8NeZIOHZ5L5?= =?us-ascii?Q?yOfH8eDBEClX8Cq5aF5bDzx4KMiTf1zy5wM7Wj2yQq7RxiYR3SdV+/TjlMgf?= =?us-ascii?Q?hvylR+x6vhyZjwHXxfd4PZjtaAPEmzUPqMM/12JcE+26QiVUtHeiD6cN+Om7?= =?us-ascii?Q?XNeymD4KuIXWXCLFzuBexJdV2vJRGiODfLJZADk1pZCIAIJRSJgMmZ4grkX4?= =?us-ascii?Q?cpFfX7rN8fpofFAAgwQqB+0hKdjKrtbnKd7EBxxoBsJ+RfLxqoXMW/ymuflt?= =?us-ascii?Q?Mjr24xA6tHzApmk3KnH3oeKUOdqSS/5bhJq+sCU9uo3L/uswEqBZF9du+naJ?= =?us-ascii?Q?xjwOX3NXYWGyHxbBJjUC+iPCOF5fFDawqa1C7gsuq7OiVG6MXqEKb3rg98qG?= =?us-ascii?Q?EB/d9N6sAK8/WpapyoCk8IHBY7ustbtXwCtYZ5p2utCvtR/vy5/nXb8T6ESm?= =?us-ascii?Q?loqB4NONyBCEbhZBimW5+FNwIdULh3doduSGiVG3vuRKgivnT4suZsUYQlzl?= =?us-ascii?Q?WBQtsaWmcXllg+/VoF4y2kCdUPijRB0YeCAd31AJDkALjl+wRcuN7X7afRSn?= =?us-ascii?Q?OPq1yoEDLkkj26lqaJB/dn33pnlRaGXNiljJBkPX9kBhDJh0ZpmniERP3Dz1?= =?us-ascii?Q?F16uF4AkLLyAPdi9LHyI4UfY8r/Sq2ditYSDHrdP/jDlftNSG66Q23XdwHhG?= =?us-ascii?Q?xDXMCBv2nd/D7ttAPNGPfiIkeZiL8KSqEBsp+LzpehcNHFrclnE10lbD4QDn?= =?us-ascii?Q?t6EK5OP/wL6bLOYdLKz1JhTOlICl53wTmGOlrahvyukKlV7dxXXssW+AzM3E?= =?us-ascii?Q?yPZRRXkhJ5cMW+aSFShwJbGriqLl49c85p+9ukgTJ8NLpjBCmGDz3ZI5lMKB?= =?us-ascii?Q?CPytJLM7gdY38lpqKDmAKnn0+DDZTDASlVMIhgP9JV8DQqnlQ0QTymLZU15Y?= =?us-ascii?Q?ITrZYuEFucfBI1/MUq+XzQAMJsDNwbV5BXT3sHI0jjjxqcYMwDBQHoHv+HRy?= =?us-ascii?Q?kBKuRGn1Vwab7VnOg4jiSO5/?= x-ms-exchange-transport-forked: True MIME-Version: 1.0 X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: DM6PR11MB3564.namprd11.prod.outlook.com X-MS-Exchange-CrossTenant-Network-Message-Id: 7f10cf95-035f-456d-5744-08d8e81b1e2a X-MS-Exchange-CrossTenant-originalarrivaltime: 16 Mar 2021 01:30:43.9398 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 46c98d88-e344-4ed4-8496-4ed7712e255d X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: zo9u6gZZUsFvGJrcTV56RW5R5xybj9+Cq4sB4ikQ+WgFktwaFQ0gXykCrsnfkNS9oGgAXk8mLaQSntCyq6cE69T44jSSettyRTFJwtbcuwc= X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM6PR11MB3788 X-OriginatorOrg: intel.com X-Rspamd-Queue-Id: 4Dzwj63Fvlz4m2Q X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=intel.onmicrosoft.com header.s=selector2-intel-onmicrosoft-com header.b=jPBQlyJB; arc=pass (microsoft.com:s=arcselector9901:i=1); dmarc=pass (policy=none) header.from=intel.com; spf=pass (mx1.freebsd.org: domain of matthew.t.rivard@intel.com designates 134.134.136.126 as permitted sender) smtp.mailfrom=matthew.t.rivard@intel.com X-Spamd-Result: default: False [-5.70 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[intel.onmicrosoft.com:s=selector2-intel-onmicrosoft-com]; HAS_XOIP(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:134.134.136.126/32]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCVD_IN_DNSWL_MED(-0.20)[134.134.136.126:from]; DKIM_TRACE(0.00)[intel.onmicrosoft.com:+]; DMARC_POLICY_ALLOW(-0.50)[intel.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; TO_DN_EQ_ADDR_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:4983, ipnet:134.134.136.0/24, country:US]; RCVD_COUNT_SEVEN(0.00)[9]; MAILMAN_DEST(0.00)[freebsd-questions]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1] Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 01:30:52 -0000 I'm running into an issue with freebsd diskless boot images. After launching loader.efi, the system hangs at "Setting currdev" and goes = no further. Is there a means of enabling verbose output to screen of what is happening = during the boot process? From owner-freebsd-questions@freebsd.org Tue Mar 16 04:01:15 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id ED69B576235 for ; Tue, 16 Mar 2021 04:01:15 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-ot1-x32a.google.com (mail-ot1-x32a.google.com [IPv6:2607:f8b0:4864:20::32a]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F002f6d7Bz3CYd for ; Tue, 16 Mar 2021 04:01:14 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: by mail-ot1-x32a.google.com with SMTP id o19-20020a9d22130000b02901bfa5b79e18so6200606ota.0 for ; Mon, 15 Mar 2021 21:01:14 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=AmVhvRsYcWcKBg+XPnjwBJHHbSdd+cf8OeC7oHod8Rg=; b=PUdfq6WkzLbO0H2SSL3GcXKcWRV8UupVyJ5j6s/2mVHIo0P7knzq0elzDZ8YE/UIru XqpkrC+6gYts9r8kqVgiqmPNBUcHdXuTuYdRHekN+UlLNdMLLahfQA80YWCKKCLAbscm OFd+PzlAUK/sQgBZUvb/8R6gb6a/n2BNGvxNBo67yxx6VkXuDv7gVVyS5oLHSacHFY7c Jk/6tp97+7QhvBFAa6RVVnbBFKjI2nId4JlRHD7RmrDO+MlZYvHLLrK9WMenJpJmQg7u Og5iJKWzF5/TZG5VNA5uvQF9Kvb0eELm2SZLnIN0qt9yuvZzoS7VGy4QzsAusRaDgAYK HkDw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=AmVhvRsYcWcKBg+XPnjwBJHHbSdd+cf8OeC7oHod8Rg=; b=lDYS3tl5/5FpxTf+DzsqDGwSRLUZa+lsDD+tk9hwgZQI7jBJvmAy1mxyZRHIEoCmIY dyL86/b8H3BayQbyzP5dV7a6IrSqwBRd9ABwKHOHs+QCPM7aD+dQjgRYWuylnVWWjsnQ r5NfSikJ0V/y3I4RYTKV4TwWUBN7FjYYuSQsmBhfno2auYHD85QRseDO+Urv0eKBdmko A+ZUlMYXhYE8vHiaqC9FXeB2sw5MRuyslF3VS+rBUsV8MbvflTH3hrNHbyORB170PLR8 SDhT71I4Ui3smyDTXHLK1eRKFKsZIoAGyD5qnFlvLkqn5HymLK00s7uceM8fargFO8fj qMxg== X-Gm-Message-State: AOAM53298m5nVmnLIJLJOk/uG5lqg4EUu+8Q9P1RySOXeFohXi2JDQrk n9HSRH+5SxOyPSWFL7Oz+m4X6kenHp5wrHiE94VHeaHyXUg= X-Google-Smtp-Source: ABdhPJy7me/LL2Grigo4470FtX25hjd11e8skKoUVrEVpZvYre+zNRQrxIbRvT0ZD81kkjBm3JkiOv6axRRvpQKAFlA= X-Received: by 2002:a9d:8b5:: with SMTP id 50mr1872059otf.93.1615867273646; Mon, 15 Mar 2021 21:01:13 -0700 (PDT) MIME-Version: 1.0 References: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> <8847e238-dbc2-436f-25b6-630c204f69cc@higonnet.net> In-Reply-To: <8847e238-dbc2-436f-25b6-630c204f69cc@higonnet.net> From: Kevin Oberman Date: Mon, 15 Mar 2021 21:00:57 -0700 Message-ID: Subject: Re: Where can I get libjpeg? - problem with mozjpeg To: "Bernard T. Higonnet" Cc: "freebsd-questions@freebsd.org" X-Rspamd-Queue-Id: 4F002f6d7Bz3CYd X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=PUdfq6Wk; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kob6558@gmail.com designates 2607:f8b0:4864:20::32a as permitted sender) smtp.mailfrom=kob6558@gmail.com X-Spamd-Result: default: False [-3.70 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[rkoberman@gmail.com,kob6558@gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::32a:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[rkoberman@gmail.com,kob6558@gmail.com]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; SUBJECT_HAS_QUESTION(0.00)[]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::32a:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::32a:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 04:01:16 -0000 I can absolutely assure you that jpeg-turbo will install /usr/local/lib/libjpeg.so.8. I can only guess that it was somehow deleted. You can confirm that it should be there with "pkg info -l jpeg-turbo". That lists all files installed by the package. If a different version shows, you have an old package installed. If libjpeg.so.8 shows up, something happened to it. I'd suggest re-installing it (pkg delete -f jpeg-turbo; pkg install graphics/jpeg-turbo). You also might try "locate libjpeg.so" to see if it somehow was moved somewhere else. -- Kevin Oberman, Part time kid herder and retired Network Engineer E-mail: rkoberman@gmail.com PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 On Mon, Mar 15, 2021 at 1:39 PM Bernard T. Higonnet wrote: > No, I'm afraid that graphics/libjpeg-turbo is the same as libjpeg-turbo > and pkg upgrade jpeg-turbo had no effect. As expected pkg check -B tells > me all the packages missing libjpeg. > > I am a bit puzzled that pkg says all my packages are up to date, and yet > they're missing libjpeg...? I na=C3=AFvely thought that installing a pack= age > installs any dependencies? > > Bernard Higonnet > > On 3/14/21 8:32 AM, Kevin Oberman wrote: > > On Sat, Mar 13, 2021 at 11:17 PM Bernard T. Higonnet > > > wrote: > > > > I am running 12.2-RELEASE-p3 GENERIC amd64, my applications are al= l > > installed using pkg. > > > > Many applications will not start because I am missing libjpeg.so.8. > > I am > > able to find libjpeg.turbo but installing either (or both) of > > jpeg-turbo-2 and libjpeg-turbo-2 do not help. > > > > One bizarre particularity of my system is that if I do > > > > pkg install mozjpeg > > > > it comes back and tells me it will delete just about every package = I > > have installed and will not attempt to re-install them: > > > > Number of packages to be removed: 207 > > Number of packages to be installed: 1 > > Number of packages to be reinstalled: 1 > > > > Any help appreciated. > > > > Bernard Higonnet > > > > I believe you want "pkg install graphics/jpeg-turbo". Do not put the > > "-2" onto it. If you already have a version of jpeg-turbo installed, > > "pkg upgrade jpeg-turbo". I am baffled as to why mozturbo wants to > > delete 207 ports, but deleting a port that you want to replace is done > > with the -f switch. It's best to make sure all libraries are available > > with "pkg check -B" and "pkg check -d" to confirm that all required > > libraries and dependencies are present. > > -- > > Kevin Oberman, Part time kid herder and retired Network Engineer > > E-mail: rkoberman@gmail.com > > PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683d > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Tue Mar 16 08:15:45 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A2EB657B76F for ; Tue, 16 Mar 2021 08:15:45 +0000 (UTC) (envelope-from bthcom@higonnet.net) Received: from ams101.greengeeks.net (ams101.greengeeks.net [107.6.161.162]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F05hJ5YXVz3hmV for ; Tue, 16 Mar 2021 08:15:44 +0000 (UTC) (envelope-from bthcom@higonnet.net) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=higonnet.net; s=default; h=Content-Transfer-Encoding:Content-Type: In-Reply-To:MIME-Version:Date:Message-ID:From:References:To:Subject:Sender: Reply-To:Cc:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:List-Id:List-Help: List-Unsubscribe:List-Subscribe:List-Post:List-Owner:List-Archive; bh=hlG8nWH2e3R6qy+SEgrCeRZ2MVxLknUVfFUcggs+no4=; b=YCfDEJ4AvvjMFo3ctP0nL1GXjw ZpdOhps8uq6MTN//m7r559RHp6x2uCLhDYqrpMdj1H6zjQKdECjGjIfQF7NcVDx8UMNjXlWa9FJV0 Q7EiumkOJkTStklV5aKzK2C0Or1KQs0D4FeqHImZ0c23U+JvTU3RhTS82MIitexWTEMB1Q9PIqET/ 6OawxLsJh9qxQitqMcIPrD9UYmmYOnakPCSFsNEuGkia1P5ci+eEzHkyN18lo3D3vEa1t4LR41UsA 2xWKxWsn73uzoRMyTwTYH4LES2xYsrx4NALf7+h1fQ2QZaEaBCIw625KHZn0URQRVn9nX0iPzht6k U/FzDkFQ==; Received: from [82.142.8.1] (port=30417 helo=bthejmhd.hd.free.fr) by ams101.greengeeks.net with esmtpsa (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 (Exim 4.94) (envelope-from ) id 1lM4re-0004sZ-1M for freebsd-questions@freebsd.org; Tue, 16 Mar 2021 09:15:42 +0100 Subject: Re: Where can I get libjpeg? - problem with mozjpeg - Circumvented ? To: "freebsd-questions@freebsd.org" References: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> <8847e238-dbc2-436f-25b6-630c204f69cc@higonnet.net> From: "Bernard T. Higonnet" Message-ID: <56f74ff3-7d97-95c0-8584-1f72fc96d442@higonnet.net> Date: Tue, 16 Mar 2021 09:15:45 +0100 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-AntiAbuse: This header was added to track abuse, please include it with any abuse report X-AntiAbuse: Primary Hostname - ams101.greengeeks.net X-AntiAbuse: Original Domain - freebsd.org X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12] X-AntiAbuse: Sender Address Domain - higonnet.net X-Get-Message-Sender-Via: ams101.greengeeks.net: authenticated_id: bthcom@higonnet.net X-Authenticated-Sender: ams101.greengeeks.net: bthcom@higonnet.net X-Rspamd-Queue-Id: 4F05hJ5YXVz3hmV X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=higonnet.net header.s=default header.b=YCfDEJ4A; dmarc=none; spf=pass (mx1.freebsd.org: domain of bthcom@higonnet.net designates 107.6.161.162 as permitted sender) smtp.mailfrom=bthcom@higonnet.net X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+a]; DKIM_TRACE(0.00)[higonnet.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; HAS_X_ANTIABUSE(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; SUBJECT_ENDS_QUESTION(1.00)[]; ASN(0.00)[asn:32475, ipnet:107.6.160.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; HAS_X_AS(0.00)[bthcom@higonnet.net]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[higonnet.net:s=default]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[higonnet.net]; RCPT_COUNT_ONE(0.00)[1]; HAS_X_GMSV(0.00)[bthcom@higonnet.net]; TO_DN_EQ_ADDR_ALL(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[107.6.161.162:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 08:15:45 -0000 Hello, Yes, you're certainly right that jpeg-turbo will install /usr/local/lib/libjpeg.so.8, mine disappeared and for some reason is not replaced when jpeg-turbo is installed. I searched throughout my system for libjpeg and found a libjpeg.so.11, and trusting to the gods of backwards compatibility, I copied that and renamed it to libjpeg.so.8 and so far (sic) it seems to work. Unfortunately, as I doubt very much that I will find the true explanation and thus solution to my problem, as long as things seem to work I will let it go at that, hoping that the problem will fix itself some day when I upgrade FreeBSD or ports or something... Thanks for your help Bernard Higonnet On 3/16/21 5:00 AM, Kevin Oberman wrote: > I can absolutely assure you that jpeg-turbo will install > /usr/local/lib/libjpeg.so.8. I can only guess that it was somehow > deleted. You can confirm that it should be there with "pkg info -l > jpeg-turbo". That lists all files installed by the package. If a > different version shows, you have an old package installed. If > libjpeg.so.8 shows up, something happened to it. > > I'd suggest re-installing it (pkg delete -f jpeg-turbo; pkg install > graphics/jpeg-turbo). You also might try "locate libjpeg.so" to see if > it somehow was moved somewhere else. > -- > Kevin Oberman, Part time kid herder and retired Network Engineer > E-mail: rkoberman@gmail.com > PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 > > > On Mon, Mar 15, 2021 at 1:39 PM Bernard T. Higonnet > wrote: > > No, I'm afraid that graphics/libjpeg-turbo is the same as libjpeg-turbo > and pkg upgrade jpeg-turbo had no effect. As expected pkg check -B > tells > me all the packages missing libjpeg. > > I am a bit puzzled that pkg says all my packages are up to date, and > yet > they're missing libjpeg...? I naïvely thought that installing a package > installs any dependencies? > > Bernard Higonnet > > On 3/14/21 8:32 AM, Kevin Oberman wrote: > > On Sat, Mar 13, 2021 at 11:17 PM Bernard T. Higonnet > > > >> wrote: > > > >     I am running 12.2-RELEASE-p3 GENERIC  amd64, my applications > are all > >     installed using pkg. > > > >     Many applications will not start because I am missing > libjpeg.so.8. > >     I am > >     able to find libjpeg.turbo but installing either (or both) of > >     jpeg-turbo-2 and libjpeg-turbo-2 do not help. > > > >     One bizarre particularity of my system is that if I do > > > >     pkg install mozjpeg > > > >     it comes back and tells me it will delete just about every > package I > >     have installed and will not attempt to re-install them: > > > >     Number of packages to be removed: 207 > >     Number of packages to be installed: 1 > >     Number of packages to be reinstalled: 1 > > > >     Any help appreciated. > > > >     Bernard Higonnet > > > > I believe you want "pkg install graphics/jpeg-turbo". Do not put the > > "-2" onto it. If you already have a version of jpeg-turbo installed, > > "pkg upgrade jpeg-turbo". I am baffled as to why mozturbo wants to > > delete 207 ports, but deleting a port that you want to replace is > done > > with the -f switch. It's best to make sure all libraries are > available > > with "pkg check -B" and "pkg check -d" to confirm that all required > > libraries and dependencies are present. > > -- > > Kevin Oberman, Part time kid herder and retired Network Engineer > > E-mail: rkoberman@gmail.com > > > > PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683d > _______________________________________________ > freebsd-questions@freebsd.org > mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > > To unsubscribe, send any mail to > "freebsd-questions-unsubscribe@freebsd.org > " > From owner-freebsd-questions@freebsd.org Tue Mar 16 12:47:26 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 30B4E5AC3F5 for ; Tue, 16 Mar 2021 12:47:26 +0000 (UTC) (envelope-from kowalczt.fbsd@gmail.com) Received: from mail-lj1-x230.google.com (mail-lj1-x230.google.com [IPv6:2a00:1450:4864:20::230]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0Cjn0qrHz4WWH for ; Tue, 16 Mar 2021 12:47:24 +0000 (UTC) (envelope-from kowalczt.fbsd@gmail.com) Received: by mail-lj1-x230.google.com with SMTP id u10so8822896lju.7 for ; Tue, 16 Mar 2021 05:47:24 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=from:to:subject:date:message-id:in-reply-to:references:mime-version :content-transfer-encoding; bh=dyTW1gHtcVvpiRpL+FdkVq6192y833mrF5k1FlR8bUc=; b=MVFiD/XiEPv7DbWowShVGn7iHD2wW4JwDCoBdd1ToJ/D1JvqBYImfGfc4MFbVf1emY do2Vqrp9KRv2Nq06uBBBOMlJLj3xmhGMu8z/DyIuHGzHXnasYxSr5Yxka8Z6kFcghVdX b4FYUFlwKh8cQXq9BOxKsH0s78mKv2fDYMvTYUcbo4P+H4Hg7SVBdFmvK7VzpA8XJhVE hruPMIyu3Fbpiyx1+ZBcmJWcBGjbo6GqOU4rK2TMOANfBFxcAvnWGW2c4wN7sncKc8Wl 93Mz5OlNmGMRxiiO011aeUQals0Xj+sVWKTbFnAdpLDwauNtmg6UvYuSvYb/V1CPXZT2 OunQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:to:subject:date:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=dyTW1gHtcVvpiRpL+FdkVq6192y833mrF5k1FlR8bUc=; b=rNIcI5xK9A/EAZN/tJXdTMOCbr0sfV57mfe7t5JA2JujtzU+VVoeJX0uuvBG4c0FHk aFGMjkvfXFPENwzuNm7HnnZzWbKTvkrx19+xbjPQFpTuOkvqbrtskeLrzZiICAr1bUNQ retym4Ve86eO4Vf/7U6Xuf/HX1uRfnKYZgQ3Rf4V+7kWcMX5qY6gdQWAPOkWOUU+tdEQ jCmlx0xO9Xf/hTXHjnvfsuPUhICSw9zzQjjAfuvDLPq5FR3RbPWt7HplCfixDzZ9vcMf QW+nX3ZB+dTM4tH+mY2zktXVAg1PULMoyXsbIhLM02b3MeZRCI656Ljdhs12GlUEh7/G +bFw== X-Gm-Message-State: AOAM533W7fbL9hSFxn0Qs6UpgbwC+i5yK/Y1PXWuVc7yBf7efRVcN2b4 KOoOY8iHqS3u6ZrwbAwtf28rqmxySfs= X-Google-Smtp-Source: ABdhPJzrbEhX+mdS47dtmmIQ3AwlDony1tSm/SMws50b4qWJVgWI4ziK9vUprnz1T2rNMeEaQusEog== X-Received: by 2002:a2e:854a:: with SMTP id u10mr2627555ljj.309.1615898842744; Tue, 16 Mar 2021 05:47:22 -0700 (PDT) Received: from kowalczt.ddns.net (94-172-76-61.dynamic.chello.pl. [94.172.76.61]) by smtp.gmail.com with ESMTPSA id y22sm3043481lfg.133.2021.03.16.05.47.22 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 16 Mar 2021 05:47:22 -0700 (PDT) From: Tomasz Kowalczyk To: freebsd-questions@freebsd.org Subject: Re: Where can I get libjpeg? - problem with mozjpeg - Circumvented ? Date: Tue, 16 Mar 2021 13:47:21 +0100 Message-ID: <2837351.slGk94SIus@kowalczt.ddns.net> In-Reply-To: <56f74ff3-7d97-95c0-8584-1f72fc96d442@higonnet.net> References: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> <56f74ff3-7d97-95c0-8584-1f72fc96d442@higonnet.net> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="us-ascii" X-Rspamd-Queue-Id: 4F0Cjn0qrHz4WWH X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=MVFiD/Xi; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kowalcztfbsd@gmail.com designates 2a00:1450:4864:20::230 as permitted sender) smtp.mailfrom=kowalcztfbsd@gmail.com X-Spamd-Result: default: False [-2.37 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.87)[-0.872]; FROM_EQ_ENVFROM(0.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; CTE_CASE(0.50)[]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::230:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; RECEIVED_SPAMHAUS_PBL(0.00)[94.172.76.61:received]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::230:from:127.0.2.255]; MIME_TRACE(0.00)[0:+]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::230:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 12:47:26 -0000 On Tuesday, 16 March 2021 09:15:45 CET Bernard T. Higonnet wrote: > Hello, > > Yes, you're certainly right that jpeg-turbo will install > /usr/local/lib/libjpeg.so.8, mine disappeared and for some reason is not > replaced when jpeg-turbo is installed. > > I searched throughout my system for libjpeg and found a libjpeg.so.11, > and trusting to the gods of backwards compatibility, I copied that and > renamed it to libjpeg.so.8 and so far (sic) it seems to work. > > Unfortunately, as I doubt very much that I will find the true > explanation and thus solution to my problem, as long as things seem to > work I will let it go at that, hoping that the problem will fix itself > some day when I upgrade FreeBSD or ports or something... > > Thanks for your help > Bernard Higonnet I have no idea where did u found that libjpeg.so.11, but running grep -R libjpeg.so.11 /usr/ports give no output, so no package is providing it. You could try doing : pkg check -sa to find any missing files. If that wont do much, Id check pkg config files for any modifications and do reinstall of all packages with: pkg upgrade -af, and than see if it help. From owner-freebsd-questions@freebsd.org Tue Mar 16 19:40:19 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 15EA356AB6D for ; Tue, 16 Mar 2021 19:40:19 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-ot1-x335.google.com (mail-ot1-x335.google.com [IPv6:2607:f8b0:4864:20::335]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0NtB333jz3Jw3 for ; Tue, 16 Mar 2021 19:40:18 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: by mail-ot1-x335.google.com with SMTP id w21-20020a9d63950000b02901ce7b8c45b4so7488837otk.5 for ; Tue, 16 Mar 2021 12:40:18 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=kemj51UwdhIzaUoZIzkrRlIxlfaB9uHw5OV6oQprIa4=; b=L8qWropE20eBLGkoItC4t+oTnqHBFbw8s1kH5d+Y9H6flo7ZIsqiLPMAWi6LbnYVAp v3D5hj5nqgxwhPB80qsgsOIIs7YX8TtlUEuxIyeE53XnhriEIBvQYFhQ7CAeKgPzCPq0 ZIXZLirYFZ8daYjdWaTRj5ctXpNp5ccwORBdisPR7dOHLQ6qZ0y1ToOhl2V0TcAjLzIJ LKIG8Escfuyc/AQlAFKt5kV4lSOv59i1P9FFnCXmKimzL70o37QKbMgRMrF226AdZriD VXOU6UD1GqSTUAerafuGx03mgkydJD5QS30tjXVm4IDdhBrJB4Te3cx1fQ3Fv5FeMSUq 3dbA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=kemj51UwdhIzaUoZIzkrRlIxlfaB9uHw5OV6oQprIa4=; b=XZOswCYIBmOM6n3RhxKUhjv2Oi9qWxSIRxtRwiTwCBo0d2jeS+yOOdl5LC+kLNCpHd GdDeu8FO1Rw0CW/wBPwaZzUh1UzrDl8iRzL3PC8IBSfbEvw86NgwbxQUpcDfmmpLQSpx sIyaorQP5t7FDIVJPcosgJOnBQHY4prMUtAxO9F1k4o6sClT8nXTLlZvZPVJlyNakFUx P6NvOU1SyTkfR2YhxziuLyDkn0X/SEOkdMLyrJ6tHdEXGtBZu897C614pzD8bEXxNjMP 122owAeIvBIhXEehbSovFY5vUayrKnQgzg0PDtO48qYEYXik20BK8q0XYWIFNKtJ19Ff GQxg== X-Gm-Message-State: AOAM531/WXkV/PqMpGIsYiVvugxRPZAlfxtn3fZ9eoBJtMdfSpXEUA/T 4WJrR8dtppd41zDmDwqFCR6a1svBJ70ZgtYu2fQYDzHH X-Google-Smtp-Source: ABdhPJx34pkAVNbwD7mrU9E1sMJ+eDbvGsTJwfcRSPpm6gYZsAq69DuRvVU1Jt9XwXB+bC7DNK1vUe6tC/XI3+b7/wE= X-Received: by 2002:a9d:8b5:: with SMTP id 50mr314350otf.93.1615923617266; Tue, 16 Mar 2021 12:40:17 -0700 (PDT) MIME-Version: 1.0 References: <0d10d4a6-ba21-9082-6b0f-11f99c8c66bc@higonnet.net> <8847e238-dbc2-436f-25b6-630c204f69cc@higonnet.net> In-Reply-To: From: Kevin Oberman Date: Tue, 16 Mar 2021 12:40:07 -0700 Message-ID: Subject: Re: Where can I get libjpeg? - problem with mozjpeg To: "Bernard T. Higonnet" Cc: Mailinglists FreeBSD X-Rspamd-Queue-Id: 4F0NtB333jz3Jw3 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=L8qWropE; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kob6558@gmail.com designates 2607:f8b0:4864:20::335 as permitted sender) smtp.mailfrom=kob6558@gmail.com X-Spamd-Result: default: False [-3.70 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[rkoberman@gmail.com,kob6558@gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::335:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[rkoberman@gmail.com,kob6558@gmail.com]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; SUBJECT_HAS_QUESTION(0.00)[]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::335:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::335:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 19:40:19 -0000 Did you try the commands to reinstall jpeg-turbo? The '-f' is key to doing what you want to do. On Mon, Mar 15, 2021, 21:00 Kevin Oberman wrote: > I can absolutely assure you that jpeg-turbo will install > /usr/local/lib/libjpeg.so.8. I can only guess that it was somehow deleted= . > You can confirm that it should be there with "pkg info -l jpeg-turbo". > That lists all files installed by the package. If a different version > shows, you have an old package installed. If libjpeg.so.8 shows up, > something happened to it. > > I'd suggest re-installing it (pkg delete -f jpeg-turbo; pkg install > graphics/jpeg-turbo). You also might try "locate libjpeg.so" to see if it > somehow was moved somewhere else. > -- > Kevin Oberman, Part time kid herder and retired Network Engineer > E-mail: rkoberman@gmail.com > PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 > > > On Mon, Mar 15, 2021 at 1:39 PM Bernard T. Higonnet > wrote: > >> No, I'm afraid that graphics/libjpeg-turbo is the same as libjpeg-turbo >> and pkg upgrade jpeg-turbo had no effect. As expected pkg check -B tells >> me all the packages missing libjpeg. >> >> I am a bit puzzled that pkg says all my packages are up to date, and yet >> they're missing libjpeg...? I na=C3=AFvely thought that installing a pac= kage >> installs any dependencies? >> >> Bernard Higonnet >> >> On 3/14/21 8:32 AM, Kevin Oberman wrote: >> > On Sat, Mar 13, 2021 at 11:17 PM Bernard T. Higonnet >> > > wrote: >> > >> > I am running 12.2-RELEASE-p3 GENERIC amd64, my applications are a= ll >> > installed using pkg. >> > >> > Many applications will not start because I am missing libjpeg.so.8= . >> > I am >> > able to find libjpeg.turbo but installing either (or both) of >> > jpeg-turbo-2 and libjpeg-turbo-2 do not help. >> > >> > One bizarre particularity of my system is that if I do >> > >> > pkg install mozjpeg >> > >> > it comes back and tells me it will delete just about every package= I >> > have installed and will not attempt to re-install them: >> > >> > Number of packages to be removed: 207 >> > Number of packages to be installed: 1 >> > Number of packages to be reinstalled: 1 >> > >> > Any help appreciated. >> > >> > Bernard Higonnet >> > >> > I believe you want "pkg install graphics/jpeg-turbo". Do not put the >> > "-2" onto it. If you already have a version of jpeg-turbo installed, >> > "pkg upgrade jpeg-turbo". I am baffled as to why mozturbo wants to >> > delete 207 ports, but deleting a port that you want to replace is done >> > with the -f switch. It's best to make sure all libraries are available >> > with "pkg check -B" and "pkg check -d" to confirm that all required >> > libraries and dependencies are present. >> > -- >> > Kevin Oberman, Part time kid herder and retired Network Engineer >> > E-mail: rkoberman@gmail.com >> > PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683d >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to " >> freebsd-questions-unsubscribe@freebsd.org" >> > From owner-freebsd-questions@freebsd.org Tue Mar 16 21:22:30 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4693656E22D for ; Tue, 16 Mar 2021 21:22:30 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt22.smtp-out.videotron.ca (alt22.smtp-out.videotron.ca [70.80.0.73]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0R854C3Yz3j8w for ; Tue, 16 Mar 2021 21:22:29 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([169.57.185.69]) by Videotron with SMTP id MH8ylEpTEsO2gMH90lrCQc; Tue, 16 Mar 2021 17:22:28 -0400 X-Authority-Analysis: v=2.3 cv=BMfNU2YG c=1 sm=1 tr=0 a=VuWP7ngXSxyjRYdIVNbaQw==:117 a=VuWP7ngXSxyjRYdIVNbaQw==:17 a=IkcTkHD0fZMA:10 a=Sn-J852ElKwcW7tL9BEA:9 a=QEXdDO2ut3YA:10 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Date: Tue, 16 Mar 2021 17:22:23 -0400 Subject: Interprocess networking is sluggish Message-Id: To: freebsd-questions@freebsd.org X-Mailer: iPad Mail (18D52) X-CMAE-Envelope: MS4wfOb71WXOvC/6pgO6c8M2LbvCvDyLzQ6Sjyg0VDCCCmClILvqIkcnLu5flBHAdxdeX288a4JvopBo14YH174au2E1qsROObEK66dJNVEqdeCOv4V/FYjM mi7YkAflh3PlqXB+CU07g+nbCCcygNNE6gP7CLsvIbFACN+Stdp6KRZSV0JJm7QdOx2yYfCwmCgA/Q== X-Rspamd-Queue-Id: 4F0R854C3Yz3j8w X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 70.80.0.73 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[70.80.0.73:from]; FREEMAIL_FROM(0.00)[videotron.ca]; MV_CASE(0.50)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[videotron.ca]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[70.80.0.73:from:127.0.2.255]; RCVD_IN_DNSWL_LOW(-0.10)[70.80.0.73:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_ALLOW(-0.20)[+ip4:70.80.0.72/30]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:70.80.0.0/18, country:CA]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Tue, 16 Mar 2021 21:22:30 -0000 Just a simple command like pkg install git could take a few hours. I installed wireguard, I am not a networking expert But there is a network issue now ... Envoy=C3=A9 de mon iPad= From owner-freebsd-questions@freebsd.org Wed Mar 17 10:22:54 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 995025A8BCA for ; Wed, 17 Mar 2021 10:22:54 +0000 (UTC) (envelope-from gpiero@rm-rf.it) Received: from serafino.rm-rf.it (serafino.rm-rf.it [192.165.67.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0mSY2TPSz3DsV for ; Wed, 17 Mar 2021 10:22:52 +0000 (UTC) (envelope-from gpiero@rm-rf.it) Received: from valentina.fdc.rm-rf.it (valentina.fdc.rm-rf.it [192.168.192.1]) by serafino.fdc.rm-rf.it (OpenSMTPD) with ESMTP id 33edbaec for ; Wed, 17 Mar 2021 11:22:44 +0100 (CET) Received: from robinhood.fdc.rm-rf.it (robinhood.fdc.rm-rf.it [192.168.192.50]) by valentina.fdc.rm-rf.it (Postfix) with ESMTP id 75CDB1F6CE for ; Wed, 17 Mar 2021 11:22:43 +0100 (CET) Received: by robinhood.fdc.rm-rf.it (Postfix, from userid 1000) id 41B99601F2F; Wed, 17 Mar 2021 11:22:43 +0100 (CET) Date: Wed, 17 Mar 2021 11:22:43 +0100 From: Gian Piero Carrubba To: freebsd-questions@freebsd.org Subject: How to override pkgng's proxy configuration settings Message-ID: <20210317102243.2a2vb5hftkebqj54@robinhood.fdc.rm-rf.it> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Disposition: inline X-Rspamd-Queue-Id: 4F0mSY2TPSz3DsV X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of gpiero@rm-rf.it designates 192.165.67.94 as permitted sender) smtp.mailfrom=gpiero@rm-rf.it X-Spamd-Result: default: False [-1.30 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[192.165.67.94:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:192.165.67.94]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[192.165.67.94:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; DMARC_NA(0.00)[rm-rf.it]; NEURAL_SPAM_SHORT(1.00)[1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:34971, ipnet:192.165.67.0/24, country:IT]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 10:22:54 -0000 Hi all, I'm on 12.2-RELEASE-p4 and pkg-1.16.3. As long as I use a stock /usr/local/etc/pkg.conf I can set an http proxy on the command line using '-o': # pkg -o http_proxy=myproxy:9999 update As soon as I modify pkg.conf for including the lines pkg_env: { http_proxy: "http://myproxy:9999" } I cannot override the setting anymore. # pkg -o http_proxy=myotherproxy:8008 update # pkg -o http_proxy= update #this is the case I'm mostly interested on and any other variations I've tried always result in fetch using the http_proxy setting from my pkg.conf. Any suggestion? thanks, Gian Piero. From owner-freebsd-questions@freebsd.org Wed Mar 17 11:26:48 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AA0285AADB3 for ; Wed, 17 Mar 2021 11:26:48 +0000 (UTC) (envelope-from guynoirnotadetective@gmail.com) Received: from mail-ej1-x62c.google.com (mail-ej1-x62c.google.com [IPv6:2a00:1450:4864:20::62c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0ntH6XcMz3NMb for ; Wed, 17 Mar 2021 11:26:47 +0000 (UTC) (envelope-from guynoirnotadetective@gmail.com) Received: by mail-ej1-x62c.google.com with SMTP id p8so1959623ejb.10 for ; Wed, 17 Mar 2021 04:26:47 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=AdrxcgtvqSsP3wSLEppcFcZTymBVdZufuI0uH16GpY8=; b=E/RW2JTE3TqeTO8g4UpoG78sM2InCEd46TLPyQxnHdt5ATDvr+xFmMbnfmd0jqaySm uW86qbjFMzsjJbbEgczRweIGFqQKnsUwWxumFtWoVYrUZHssLdRnKjkK8Myb4ybc8QGf CvQJM1sfujAiD/Vny8rfBEsTJ0XHA3rzEB4eu9uhOAjLYD+O1FcN1AdCQZWV5iBdmRvD oec64YnO7CoFX/mKc7uYV9ouGDi/inUeIM4banuW2hUh9i+gTKU0g/rzARpfd9x7bU4q llYks/xK60pGg/olPj83UgPkSYuXl7DQgxyJKcONpV6Tt+Ug+8bdPZxLML0J29/j2PSy jzOw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=AdrxcgtvqSsP3wSLEppcFcZTymBVdZufuI0uH16GpY8=; b=Ol2a5ef3oxDS5bD1nwN81+odP8C2/zcxLhtwv0W/2rhe0HV5xUtPZq0D9FwJUpmAHP 17FDp0a4Z7Y4dg9nFuEZrLKAb3HNj1KRFE4Xiali0CJYnN58kWxndINIUxTEjoPObyc0 m0cPIyJ4OwbsPYoWWx/6aBVrWKNSNJT96i60uRJsu+GGHKFCozfHtOKq0FKYAIDNGu68 iqK78Fe9TL6MLLlYR9bJD0EXDKs22eriSP4WindtioDK0dBJiiTQHjAFEvVCrSyRUGeM FhmO2s+cKonVCo68YMT+bI8qdczOjJ2B/PqPHBIuwQxLmJZ2v7HVwtVLBorO+b3YP+Ny XxwQ== X-Gm-Message-State: AOAM532/2awSnj+7SlKYmeQwjPhvhd+t6r515e8WfWRwXebTciabOnKo lkyTGWopYLZx85c6PWS0m2ppburC5roUOK6mZrz/23BRM42LXQ== X-Google-Smtp-Source: ABdhPJxBRw1+Lrxtl+v9cW+DnLPfIApgthauH5xvZ7LPMUrgjCuYvMWC+ZvQ0xSlsOil67rdh2puzPiIrV73r3bD6/Q= X-Received: by 2002:a17:906:fcb2:: with SMTP id qw18mr33813714ejb.434.1615980406629; Wed, 17 Mar 2021 04:26:46 -0700 (PDT) MIME-Version: 1.0 From: Guy Noir Date: Wed, 17 Mar 2021 07:26:36 -0400 Message-ID: Subject: Repository availability and security updates for version 11 To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F0ntH6XcMz3NMb X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=E/RW2JTE; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of guynoirnotadetective@gmail.com designates 2a00:1450:4864:20::62c as permitted sender) smtp.mailfrom=guynoirnotadetective@gmail.com X-Spamd-Result: default: False [-3.17 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.17)[-0.166]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::62c:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::62c:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::62c:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-Mailman-Approved-At: Wed, 17 Mar 2021 15:29:05 +0000 Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 11:26:48 -0000 Hello, I am working with a team to upgrade our infrastructure to version 12, however I have a few questions about the EoL event in September for version 11: 1. How long after September 2020 will the version 11 repository remain available? 2. Does the FreeBSD team continue to provide security updates for version 11 after the EoL in September? I attempted to obtain this information from the Security Information page on FreeBSD website, however I was not able to find it. Thank you From owner-freebsd-questions@freebsd.org Wed Mar 17 15:53:02 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 65DAF56DDEE for ; Wed, 17 Mar 2021 15:53:02 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0vnV2L6Xz4Zy4 for ; Wed, 17 Mar 2021 15:53:02 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from smtp.infracaninophile.co.uk (smtp.infracaninophile.co.uk [81.2.117.100]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client CN "smtp.infracaninophile.co.uk", Issuer "R3" (verified OK)) (Authenticated sender: matthew/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 2B3E4224ED for ; Wed, 17 Mar 2021 15:53:02 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from PD0786.local (130.31-255-62.static.virginmediabusiness.co.uk [62.255.31.130]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: m.seaman@infracaninophile.co.uk) by smtp.infracaninophile.co.uk (Postfix) with ESMTPSA id 18E6E10FC7 for ; Wed, 17 Mar 2021 15:52:58 +0000 (UTC) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=none (p=none dis=none) header.from=FreeBSD.org Authentication-Results: smtp.infracaninophile.co.uk/18E6E10FC7; dkim=none; dkim-atps=neutral Subject: Re: Repository availability and security updates for version 11 To: freebsd-questions@freebsd.org References: From: Matthew Seaman Message-ID: Date: Wed, 17 Mar 2021 15:52:56 +0000 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-GB Content-Transfer-Encoding: 7bit X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 15:53:02 -0000 On 17/03/2021 11:26, Guy Noir wrote: > Hello, > > I am working with a team to upgrade our infrastructure to version 12, > however I have a few questions about the EoL event in September for version > 11: > 1. How long after September 2020 will the version 11 repository remain > available? It will probably be removed from the main download servers fairly soon after 11.x EoL. However you will still be able to use ftp-archive.freebsd.org which will have copies of 11.x available indefinitely. > 2. Does the FreeBSD team continue to provide security updates for > version 11 after the EoL in September? No. If it isn't obvious, 'EoL' means no more support for that version. Remember the ports will cease to support 11.x at the same time. That often means a small flood of changes will be implemented that had been held back because of incompatibility with 11.x. So don't count on being able to update any applications with known security problems after the EoL either. It might work, or it might not: no guarrantees. Cheers, Matthew From owner-freebsd-questions@freebsd.org Wed Mar 17 16:51:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7EE9E570B5C for ; Wed, 17 Mar 2021 16:51:23 +0000 (UTC) (envelope-from guynoirnotadetective@gmail.com) Received: from mail-ej1-x629.google.com (mail-ej1-x629.google.com [IPv6:2a00:1450:4864:20::629]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F0x4q0Xg4z4j5T for ; Wed, 17 Mar 2021 16:51:22 +0000 (UTC) (envelope-from guynoirnotadetective@gmail.com) Received: by mail-ej1-x629.google.com with SMTP id r17so3678905ejy.13 for ; Wed, 17 Mar 2021 09:51:22 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=t6R4YMFP56/HrRzqP508kqmsjUvBW72FjtjAGRHVtVo=; b=so55LyQlNZj4wC6ZYFSccPDidt+HdXk58Bm2WK+xmgR9g7baCVLlkbQOygcvjXGr+y YToF/iUJV3HdMtKrwHOCpDkaKIFc4fwiJVdbQb60iReyj7/VFHqsfiK4VWgFxt60YXXB dVh51K9tnLrDDHiS91elJv9Lpwz50oJaLhjmrQBGiGwBEBfcEDQeO7Pb63tVPfDuv3Jy kISrxfiCvS3LrrubXNjo0ZyPKNH46zlF68QDd2Jf+1wL06DLayCqP/eb7c5X7Cg8ATUa KEyDu/xv+1Ok+X4e9pASJZWrsqmZPEVGGXNiopUxJ1jFNihqrc7hMOatvSutZPT2VV41 E0Uw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=t6R4YMFP56/HrRzqP508kqmsjUvBW72FjtjAGRHVtVo=; b=KIKq8kxJT7TIYBTlEo7raLoYji9j9dhD6Rq0cS9OczPc34n9TdSfYgba8UWg6exugD uuUqCqVJ/W+NHIb6G6OKh1PUU+5lXUQsGbbZBKktvU27EhQaxVdQx5nMwtxZDyyj06xy WQa2XQn9Q6yDfEK8dwz6sjIXCCBEbHeh90N5tb4ffNy2LzCd6GiFdWDkujomUuFLMhQc mbs1n0eilyKwpNk4Ip7pu6jjPCjWMUPpXx5+zPmtIC7gCV4kl6f3iRe51jBilsuEeezb qZHrvGp9PVG+xeZ0J2+tOmI8x/bNabJDQvLQXiaSFQkT8yqOPT/oTDKdCC+g3s89/hiH +krQ== X-Gm-Message-State: AOAM530WGZHPCYidOXuP7l/mu4u665Hi4KqWufJfppJj/DLT0FCdalP5 ei/2i38TStPY31toFPrNQBa2qY7JP+qC8/+BnHKjQbPk1m9GjA== X-Google-Smtp-Source: ABdhPJz92BGjLAsPKwb/BfDNaPj3aoMNhMJdiZLTLyiHZcjPh9FWLxyhjQEmeEd9s6MBhfMBDEQRNCgzUOTrZkyKP+A= X-Received: by 2002:a17:907:77d4:: with SMTP id kz20mr36542204ejc.93.1615999881968; Wed, 17 Mar 2021 09:51:21 -0700 (PDT) MIME-Version: 1.0 From: Guy Noir Date: Wed, 17 Mar 2021 12:51:11 -0400 Message-ID: Subject: Repository availability and security updates for version 11 To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F0x4q0Xg4z4j5T X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=so55LyQl; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of guynoirnotadetective@gmail.com designates 2a00:1450:4864:20::629 as permitted sender) smtp.mailfrom=guynoirnotadetective@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::629:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::629:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::629:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 16:51:23 -0000 Hello, I am working with a team to upgrade our infrastructure to version 12, however I have a few questions about the EoL event in September for version 11: 1. How long after September 2020 will the version 11 repository remain available? 2. Does the FreeBSD team continue to provide security updates for version 11 after the EoL in September? I attempted to obtain this information from the Security Information page on FreeBSD website, however I was not able to find it. Thank you From owner-freebsd-questions@freebsd.org Wed Mar 17 19:45:07 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 776A4576D11 for ; Wed, 17 Mar 2021 19:45:07 +0000 (UTC) (envelope-from melson.r@att.net) Received: from sonic303-28.consmr.mail.gq1.yahoo.com (sonic303-28.consmr.mail.gq1.yahoo.com [98.137.64.209]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F10xG3fgVz3F6g for ; Wed, 17 Mar 2021 19:45:05 +0000 (UTC) (envelope-from melson.r@att.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=att.net; s=s1024; t=1616010304; bh=yOpvQNKXMijvx38XPiFqal6en8Z0y6IFbeWjVTi/uX4=; h=To:From:Subject:Date:References:From:Subject:Reply-To; b=zSA+qezN+bbSs3BOjaq/tppMuxwo+Je7WX24mRRn6wnFK5ZKpOW6fozVcan2drWzxYHNVi421xq1pnytieoz2N7NZP70z4Z3aIOqDqO489BoH7AgOseMj6BLQ6NOV0Cjh8bUbgziUPJfP+ytn2U7LV+iKF7MhG9Lyv0thjM+G1s= X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1616010304; bh=mAAK3FRFm3B383yjqAJ0+8nULstdSyfSJt5gypByNEH=; h=X-Sonic-MF:To:From:Subject:Date:From:Subject; b=sr6WOEAOmUT6t58bZS3eBfpIYqcAgIWp0dfaP1kNn+gxoGrPwq42U/3FEA9z8dVmwrKGCJoQEOBGbgaUMG/f4pSflV168nBn/FJgZSzsIoivvoeK5LV4jdI1mk5WLRes80Q/v6NbqJ4GFvECYH+WUgsg7ZNHu4O5ydSowndlvJt7QDDeTgULdqMAcM1fgGqlW54L19SDMWtAuvXwvlu0rwrRKilgBSfQJpRd6tiVr9CQIkVqFIN/mm9SSXn7E91X9ySZDrpOPVLBd7VoTnd5cOkBVBCKfNl42BYIyYXRI5OzCbJCA+Dayx+13dJeLYnb0A6ncI8cQtzbpTge3qXADw== X-YMail-OSG: 50g7YYMVM1nMgCNjKpuS1PECSzcJxqDYtXVyqRyhJU5tCk3VYNeO2mCtBde4MzF VUds51xi4.gY5NR7EzxFoNONlKnkyAfekGN73s6kxZjYpb.2e3qa8oin7h69YqBsGCrhZyja9Axj CuLtEQfQ622NjWywv0FP4e14M91xGDKfbGy28k.axl4vtaMC_xQbH6FpzWcqnVPcC38SKhZ4lPn. Pt7LViR7ww80MjDKlH_EhJBv2X6Qf.F5i012796GIN7CFWaWaBCYPHcSftvRscv0YHdy0NfUV60S H9hYTHCvhGXPeZfHjvkHepF.GVabsnPgjJAud.CnyPlKAqY5Vo2tVFBgfWvY3U57JpWu.NgEm8Rt u0qsW9mmlCCKcsuVgSutde_0c8MijV86QSqqcwzUS9KONXrM2yuz05Sfi0LAzQCNAldxYFcnvhF9 ezpILS9cmvr6llL3wcwbkbewlWTCLR9p3VUFPwzs9urJUXPVuyQ1lD7O_YLcs8b_zdAzcykinfGL qSH_uNLse7L9jVrpllEeAxZjm6xUf5D84z2K2i.KEfFJjqpzY6lTYLclWvFaToxQV8qWaST9e7Ej 2.6EOmMqQ9dkceRN2VMdmlbCG0_HPP.KZetBt2LEfW_mVnmDNJIEOXY5akpvvlm14sGZZ45KbyvK luW9zULsDGpMSIoYlYMeximcV2Y7_3sZOAUHZq3az9dbw7lIGZ3_2BiMHElNWDTihe8eyueRhKlU 2TbwoCbTmnUQV0W4JM51VgRe9w5chUtqbC1894jSWpxB4wM1X.ytcDrS8twzlyz.UDJb5Hp8UxEZ 5jb9U6a0EkORxeogY5b7GlhZf7K0nvrr96Un9ESrY82lBgqhytdV6B8Tp1Eb9_k9Nm8Vm51phpwR TgRMq9OF6muo4cvfIlLhPMz5YM_lBGXHLL0ONiCs2yRVHI61gtG43v_YIYNueoyoIF_l1bDvxoVH Tmkvx3O4XmS2tUtW8A2r.wvK8S_ymGiBWSkZud5QpMZGhfb9ipondd6xg.Xon2NJPxkdOq8dpx_3 pRCdXuiS8UZ1jJTxuU2pSGUtSwo73bU4aDNAXLznORsjgRuyvTdR4I_Kh3nDivdCwbXgnYfLU4CG w_EwQPYptHIJFb_PdabYOvotN05QkeDiLf5PeYHnqAcF8bONNVADQoBk68BE40olzVOBjMi2GwI. Pwmd7mT1VxkLdFNbICNapFxlcKk23lx_Q.IyPwSDoIX9_oFm5jQXKkuDVooFhrE1x5D_iSzVFUho snkpUsJLiC44Jr6ebhH6vXrOPJkw8PM0ETeYYWgU2KaIRLUsYyeF_4uSLCUoWTIDa1kpA92wP6lY vzVNhAsBPJAGfF.A6xlD.2xEpF3xpl96RboVanTV11_v.Pha0YEPPn662GA5QCGIF8A0f1rEnYlW 40TQRv88C_1B6dgAZjUssPCLegTCxpeprlbavfbCWw2Hor9.rzd.Sn7n.A6BOoQose2BmW5JoAVP G3QkzVFJri5YrBawZGU.udG_K4O_C.g_ALqVdLDptzdGrY12AhwpuRRDAUXZYvtVofGtgm0ahLg3 OPDf.GznmOqR4IP9F8snyGDiAuQoOiFBSwtl.TVyiL9qF7CQhwZAMR1_8iqzwH4nLjq2uvqGWTVL ATK9rG1oQwzsoJ9l4vHoAdzbOEGAq46L00dTSYAac9gJNVmsx54ZNrv1Kh1OWQ1gYQGOyhkIXlrq iO1Oq_CqCMYlUe8gU2Q8T18ZdKnqSvMYJ7rkaZTdTuN2gdhx6qJj20qTtcUUmrsPcto8alyBjxHJ RDJKCsfZG.FYGOEO_UCo0skJXfy0azovnD6s79VW_qEEypjtz9siiXM2KtlkvaoWBYFt2gEvepGH bcDhW_jI.IDf6jrAt8COCPiNWFL6lmIalMCDE7a13bW5QbiqlOXuand5edUleW8I_bHwjMc0DmEe 490gkYFwdBjc1V4s1QgAyac1IVjuB5HJU5jRRjA0ggoaaZ2HdNEBfdmMWVIr5vpWVx1QCrf7PTwV aCStUHe0P3fgnO2ANZ.3g8Ng0ZbGd_JyiYuEM1r9PMbVRChpCUSMtcaILMbC8U5v9trL1gFX5dBv 6S2kq7ZA6MPg1OKoDZfEwW_3bYiBUiyBjmuuig_JvP4rNaMgbfqITMn6d8v7SVQWOizmiiqfqVAQ bQ7HI8RV93YP0v5J_m.eRNlgPeQYV7ae2yGilV8dULijsUkTG8SHzJKAcOK8kxsVdXfEL4RZHVlW ZS0frgt2T8JB6TdX40A7cNj3YC_H3LtG3eej3I62NH70xTWj6vKdj7Dr6ioOFL97eZIqHRkyyG6S EExzjpDQPqJB04xREUrbFZ_0whob7YxRTELnsUEhdzKGBytnpqOBBiie22QLj6PbzH.AWjGPXIfF CTNQH.uDHcjN.jYOzcJ5XsbMiLPWrwCPaIOHfuUsPOjjKaA_vSPPhuseut2BZBuI14DvIekt2iK_ bU03huEVzQBRMmSo- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic303.consmr.mail.gq1.yahoo.com with HTTP; Wed, 17 Mar 2021 19:45:04 +0000 Received: by smtp404.mail.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID ae5e0569b10037b863f6f005aa8cfe2c; Wed, 17 Mar 2021 19:45:03 +0000 (UTC) To: freebsd-questions@freebsd.org From: Bob Melson Subject: Webcam - Logitech C922 - question Organization: Department of Paleocomputing, Whatsamatta U. Message-ID: <08db2f9a-4c85-0c82-455c-a1c64512ccc7@att.net> Date: Wed, 17 Mar 2021 13:45:01 -0600 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit References: <08db2f9a-4c85-0c82-455c-a1c64512ccc7.ref@att.net> X-Mailer: WebService/1.1.17936 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo Apache-HttpAsyncClient/4.1.4 (Java/11.0.9.1) X-Rspamd-Queue-Id: 4F10xG3fgVz3F6g X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=att.net header.s=s1024 header.b=zSA+qezN; dmarc=none; spf=none (mx1.freebsd.org: domain of melson.r@att.net has no SPF policy when checking 98.137.64.209) smtp.mailfrom=melson.r@att.net X-Spamd-Result: default: False [-3.30 / 15.00]; FREEMAIL_FROM(0.00)[att.net]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; DKIM_TRACE(0.00)[att.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[att.net]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[att.net:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.209:from]; R_DKIM_ALLOW(-0.20)[att.net:s=s1024]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[att.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[98.137.64.209:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.209:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.209:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 19:45:07 -0000 Has anybody out there successfully installed a Logitech C922 webcam? I've managed to install to the point where the device is recognized by pwview, and have, I think, gotten the mic (/dev/dsp3) and speaker (/dev/dsp2) correctly installed/activated/recognized. Problem is that I see no video with jitsi or zoom or with the VA's telemed system - all 3 just work on my clever phone, but not from my freebsd desktop. At this point, I'm also not sure of mic and speaker, but they could be failing because of the video failure. If anybody out there has successfully installed either a C920 or C922 and has video, mic and sound working, I'd appreciate it if you could post a how-to of just how you managed the trick. I don't do frustration well and need a wise head's guidance. Thanks in advance, Bob Melson ---------------------- Output of uname -a: FreeBSD strider.rgmhome.net 12.2-RELEASE-p4 FreeBSD 12.2-RELEASE-p4 r369447 GENERIC amd64 -- Robert G. Melson | Rio Grande Microsolutions | El Paso, TX -- Minds are like parachutes. They only function when they are open. Sir James Dewar From owner-freebsd-questions@freebsd.org Wed Mar 17 20:21:44 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7326C577D3F for ; Wed, 17 Mar 2021 20:21:44 +0000 (UTC) (envelope-from kudzu@tenebras.com) Received: from mail-lj1-x231.google.com (mail-lj1-x231.google.com [IPv6:2a00:1450:4864:20::231]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F11lW3rBxz3HW5 for ; Wed, 17 Mar 2021 20:21:43 +0000 (UTC) (envelope-from kudzu@tenebras.com) Received: by mail-lj1-x231.google.com with SMTP id z8so4750127ljm.12 for ; Wed, 17 Mar 2021 13:21:43 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=tenebras-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=xZd2dBShLJ909uYleOeYLojxqyhgrdyNmHcME294wjM=; b=0sT93O6neUB9lKeOyr9Yni/8/QNI8wcF41Ej/+4+94a/saenUMDKH841jy5uSKw1Js h/G+5lb0Z7MMshsZpThszaX9SmzPelhpUuop85IbafWJpXgYA3Yja6lP1dtdY/YclJoH efo7ofoqYP7oWMQHLskE3FTvuOiPuChL7hpUNqaEsLsM8ru64Jq6ty8LlF6bIawREIKD KG2AP93qBHhMsj+8NxqrKnboZX0HCkszshLBN3H7cXFUWYNZFHNTkfsLASV/h5ttRxdp pirOu3ZqJ9gH3kIj8rORzLaGsGSjrltx85uinrRIgRhTDmYubomhRWhTo4h7gUCWwzEJ UCfw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=xZd2dBShLJ909uYleOeYLojxqyhgrdyNmHcME294wjM=; b=Pqf+QY707oN0GMjqda9Wk9WOJkkM5Cs8ZsrfNZnxECi9E7GC6L8mKrT0Fu7g8muOjB ipZE9lG3vDDvy+HDCc7FkF7hI9jk+3uCUNnrnN9tXIZbuOkaNrxlMsxKS4OBrhrPoY4u J730SzqTtHIqq+enMR8s27IdQvqaw4G0UzMW+nk+d2ficCJ7R0pjm/mhUjkm49jRfjmW Z5gtfkiK1WqNEHpmCoNrtVJ1vNnt38WLo7s3xCluRu9zfVa27RGKhRpLA49bJgQY/Oqs 5b2MlqH7AKY8c4rq/fWY52oNT4AF4y1uJ8/O5YWeP1JiikjbO9ZhpEH909lNW0YbJeX0 m2jg== X-Gm-Message-State: AOAM531B5Wqtzy0zBX0sRBC87Us4T7rXXb43M4nETH4k1OCOU4PPtSh6 qs9ac2oVAxdJUUF23OYJC0A6YSDrCQVoFCf61tGydXvzDGW7WiZ4 X-Google-Smtp-Source: ABdhPJwmPcrr9jIpxuWYLdygwPzr2SxWU6lYTxoqaayumxnIfbeH5GrlHyDKkScQhLgCQ/qitevIf8TsoyMfktE0uL8= X-Received: by 2002:a2e:5341:: with SMTP id t1mr3340488ljd.282.1616012501396; Wed, 17 Mar 2021 13:21:41 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Michael Sierchio Date: Wed, 17 Mar 2021 13:21:05 -0700 Message-ID: Subject: Re: Repository availability and security updates for version 11 To: FreeBSD Questions X-Rspamd-Queue-Id: 4F11lW3rBxz3HW5 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=tenebras-com.20150623.gappssmtp.com header.s=20150623 header.b=0sT93O6n; dmarc=none; spf=none (mx1.freebsd.org: domain of kudzu@tenebras.com has no SPF policy when checking 2a00:1450:4864:20::231) smtp.mailfrom=kudzu@tenebras.com X-Spamd-Result: default: False [-3.30 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[tenebras-com.20150623.gappssmtp.com:s=20150623]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[tenebras.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::231:from:127.0.2.255]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[tenebras-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-0.999]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::231:from]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::231:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 20:21:44 -0000 On Wed, Mar 17, 2021 at 9:51 AM Guy Noir wrote: 1. How long after September 2020 will the version 11 repository remain > available? > You can find old releases, back to 1.0, here http://ftp-archive.freebsd.org/pub/FreeBSD-Archive/old-releases/ > 2. Does the FreeBSD team continue to provide security updates for > version 11 after the EoL in September? > No =E2=80=93 unless Julian lobbies for it. ;-) --=20 "Well," Brahm=C4=81 said, "even after ten thousand explanations, a fool is = no wiser, but an intelligent person requires only two thousand five hundred." - The Mah=C4=81bh=C4=81rata From owner-freebsd-questions@freebsd.org Wed Mar 17 23:01:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5D7C657C3C9 for ; Wed, 17 Mar 2021 23:01:06 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-io1-xd31.google.com (mail-io1-xd31.google.com [IPv6:2607:f8b0:4864:20::d31]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F15HP4jFSz3l8v for ; Wed, 17 Mar 2021 23:01:05 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-io1-xd31.google.com with SMTP id v17so307791iot.6 for ; Wed, 17 Mar 2021 16:01:05 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=Td82Ae4ZppaHYbOb1yTVc6kCzMcFH1YJf53bBgHw0ek=; b=e63t4mFgrfLqab6xDshtW760S+n7DASFILhqhdm/KgR0j7sQxbbtkZVP2iOqnNfej3 dQlu4D7WaTdJ1OsWTTlf1xoATCv3mOj2wT52MZx30MpxkwWEEoqFqcfWB5DquuoH32Td wyaF9tMm0NUvNobMMPqlyVgOTpbWNOYy5m/lM= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=Td82Ae4ZppaHYbOb1yTVc6kCzMcFH1YJf53bBgHw0ek=; b=SVTXjsF41bXg0Vhwd5jcFlh9wf6Rc+H3SJQL2wSV2LbwdCyB3/nIAuLc7d8JFXIHto lGWzq32r5AMOKb8dYgI8cchJKTFpWXOQYrm3JVhXz+M6icRn0QGuhZshp+93RfUHy6OB 5nNcKOyjSwDIZzd9PMIq+JAbwtfZZYVU0ocF/T+bAYIPRiY13mf3S48s+llhCrpbEg9v mjJI6niv5MtAZBwnDpnL4zyy+IMx7IhHmAKRl5KMj/Kc6vM3ki5rR9DOUG7CfAhwcv/7 2Ux4FzXMisSuR9R5gtruBf4gHltly8Z+J/QRkbTEFkYqoZiUbiXw1lLf5vijBrYcMUZJ IzZA== X-Gm-Message-State: AOAM530STYCPKLJo18jZPToUVncc1ZrD4wJy+WFjof/M2WRm1vEcoJk9 L0L+dwb1CByMzNqoALzauoWvNvIakGzhAg== X-Google-Smtp-Source: ABdhPJwSRgIjIOYDZhGHMy00LArBEv+746GxZ+UdjI91M+iCyNNKomNFZGtF/BvJTML9X9lFGBxqTg== X-Received: by 2002:a37:bd7:: with SMTP id 206mr1733780qkl.284.1616021715846; Wed, 17 Mar 2021 15:55:15 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id x187sm350486qkd.83.2021.03.17.15.55.14 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Wed, 17 Mar 2021 15:55:14 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F158d6Jdwz21mX for ; Wed, 17 Mar 2021 18:55:13 -0400 (EDT) Date: Wed, 17 Mar 2021 18:54:55 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: Repository availability and security updates for version 11 Message-ID: <20210317185455.000015dd@seibercom.net> In-Reply-To: References: Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/MN3XS76=1l5eL47V9ZkxQCP"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F15HP4jFSz3l8v X-Spamd-Bar: +++++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=e63t4mFg; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::d31 as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [5.88 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,body]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-0.52)[-0.521]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d31:from]; REPLYTO_EQ_TO_ADDR(5.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d31:from:127.0.2.255]; NEURAL_SPAM_LONG(1.00)[0.999]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d31:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 23:01:06 -0000 --Sig_/MN3XS76=1l5eL47V9ZkxQCP Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Wed, 17 Mar 2021 15:52:56 +0000, Matthew Seaman stated: >On 17/03/2021 11:26, Guy Noir wrote: >> Hello, >>=20 >> I am working with a team to upgrade our infrastructure to version 12, >> however I have a few questions about the EoL event in September for >> version 11: =20 > >> 1. How long after September 2020 will the version 11 repository >> remain available? =20 > >It will probably be removed from the main download servers fairly soon=20 >after 11.x EoL. However you will still be able to use=20 >ftp-archive.freebsd.org which will have copies of 11.x available=20 >indefinitely. > >> 2. Does the FreeBSD team continue to provide security updates for >> version 11 after the EoL in September? =20 > >No. If it isn't obvious, 'EoL' means no more support for that version. > >Remember the ports will cease to support 11.x at the same time. That=20 >often means a small flood of changes will be implemented that had been=20 >held back because of incompatibility with 11.x. So don't count on >being able to update any applications with known security problems >after the EoL either. It might work, or it might not: no guarrantees. Well Matthew, since the inception of version 12, bug https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666 has existed unsquashed and with the end of support for 11.x in the ports system, I guess I and others in the same boat had better start investigation other OSs. Thanks for the heads-up. --=20 Jerry --Sig_/MN3XS76=1l5eL47V9ZkxQCP Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBSiMUACgkQgHBP8gv9 FXedTwv/SE2/YyEVd137kT5Nf+lg8j8rpt9jjZuaA/xjcb59uZoeUpxXbWtTBPJ+ v/mzuNi9cNUTBqG7nkE7MQShsrLASo5l9ftOc+m6c5mzVLRP2ND+XbGFfHwohnAT NPH2pmYUU4QoEBF+UacgXEaiPGYehuMqR7LLn+pHtg+fMMLerwPVjRBBGwyzUrA4 nT+0a9I9X33DSzMrLAGBe88zHMU1Q2gBIo8e+PMcS+jRwNrqoWAirUj7zplKsSiT fJDTT29klkdBvcGfYFOpHAbvCKlWIW9YVUAKpHc+Zfkrervns3RqJkBmqtkPHPKZ ndCptlwVJvE3LosdsPBMg84fasyYZSjzayML9Pvro0CpZmsMFbAr6gLwOwoKEpd/ CevxUwDa+zuOPLL7vRO4IAjkw431i94TzHP4M/erEoiUClduvckzjtOHCiAah+dQ kLjW3ZrXMVDUJHvhk88oZLdFJL2z9/dKbCsr0xO4JybKPJ3LS6RKAHAvoGd4TMua dj9VY4Bh =2WYt -----END PGP SIGNATURE----- --Sig_/MN3XS76=1l5eL47V9ZkxQCP-- From owner-freebsd-questions@freebsd.org Wed Mar 17 23:57:53 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A845457D256 for ; Wed, 17 Mar 2021 23:57:53 +0000 (UTC) (envelope-from dch@skunkwerks.at) Received: from wout3-smtp.messagingengine.com (wout3-smtp.messagingengine.com [64.147.123.19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F16Xw3Dn8z3nn2 for ; Wed, 17 Mar 2021 23:57:51 +0000 (UTC) (envelope-from dch@skunkwerks.at) Received: from compute2.internal (compute2.nyi.internal [10.202.2.42]) by mailout.west.internal (Postfix) with ESMTP id 7BC2D1F77 for ; Wed, 17 Mar 2021 19:57:49 -0400 (EDT) Received: from imap6 ([10.202.2.56]) by compute2.internal (MEProxy); Wed, 17 Mar 2021 19:57:49 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=skunkwerks.at; h=mime-version:message-id:in-reply-to:references:date:from:to :subject:content-type; s=fm1; bh=b8tYSkvMaxFE8jAn6wzmMNElYvjFSzN Dai8B/5yfO6Q=; b=chiDikEa8QnCOxiyOBiFyEMloVJ+5w7fiQciD2lwf9T7R67 T9BcwrF9pXmyHxvvkAwpWPmLcyXxeozAY67u/D12Zhol1jZDy9HXSwItUxUq1vlx Ame4wN2UqAc9q+LbL+h6OMn1eDMOAga1k9zNTxlaq3wb1QsP8cc6Xn3hx93YolNp Dnjzs8MxErm7g3KlTWoL0XVBmBu7G4jA7/qIvG+hLVGafFQccQryfOZ+XZYFK12r zOlKTk6wnKSIVOjpCXuw2jm53lmIqhvmg2BRL8ZH6qQtnFOgbvTjt2slv6j3i7mX 5XrYYmBAF6HcXJsrKqyC7YtrRroal2m916nmhDA== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=b8tYSk vMaxFE8jAn6wzmMNElYvjFSzNDai8B/5yfO6Q=; b=WUInLIkqcx2Svba6dj1avU vWUqvis7fAmbrobICZ01U/BXwY3Cgjcg5ipub7f2jX8SPm652Nu9obp1cOkLmL57 2lX3O14LIkbXIRDyzlH1+6Arevf9LoklemQPY0P6fPPXIeXiUR9Xn9lFcvIyx6YE v1QXAe2dxQzMENCDv8TkxXTUqqQvdaho7HFPAoXXIqtumqrXhSbWnWaJyYW8Q82U irzSgrG//XymKuDyZV1EjKdxFRm/Nmb4hdeHZRoLhDBhiJzaXLyZg+Le1zhjDxl3 719NfYlO2BU5Yyh/aaErn6naxLDWm7c2Bv0Ol7rmazczo6w4640ZFtBRu2VfHBSg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduledrudefhedgudehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucgoufhushhpvggtthffohhmrghinhculdegledmne cujfgurhepofgfggfkjghffffhvffutgesthdtredtreertdenucfhrhhomhepfdffrghv vgcuvehothhtlhgvhhhusggvrhdfuceouggthhesshhkuhhnkhifvghrkhhsrdgrtheqne cuggftrfgrthhtvghrnhepkeetffeukefgjedvhfetjefhledthedvgeehhfdvtdeuuefh veeihfettdektefhnecuffhomhgrihhnpehfrhgvvggsshgurdhorhhgpdhgihhthhhusg drihhopdhmvggvthgvtghhohdrtghomhdpfigvsghrthgtrdhorhhgnecuvehluhhsthgv rhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepuggthhesshhkuhhnkhifvg hrkhhsrdgrth X-ME-Proxy: Received: by mailuser.nyi.internal (Postfix, from userid 501) id B69512405EE; Wed, 17 Mar 2021 19:57:48 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.5.0-alpha0-206-g078a48fda5-fm-20210226.001-g078a48fd Mime-Version: 1.0 Message-Id: <9f90f7f8-565a-47f1-ab5d-d4d78fd791d4@www.fastmail.com> In-Reply-To: <08db2f9a-4c85-0c82-455c-a1c64512ccc7@att.net> References: <08db2f9a-4c85-0c82-455c-a1c64512ccc7.ref@att.net> <08db2f9a-4c85-0c82-455c-a1c64512ccc7@att.net> Date: Wed, 17 Mar 2021 23:57:14 +0000 From: "Dave Cottlehuber" To: freebsd-questions Subject: Re: Webcam - Logitech C922 - question Content-Type: text/plain X-Rspamd-Queue-Id: 4F16Xw3Dn8z3nn2 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=skunkwerks.at header.s=fm1 header.b=chiDikEa; dkim=pass header.d=messagingengine.com header.s=fm2 header.b=WUInLIkq; dmarc=none; spf=pass (mx1.freebsd.org: domain of dch@skunkwerks.at designates 64.147.123.19 as permitted sender) smtp.mailfrom=dch@skunkwerks.at X-Spamd-Result: default: False [-2.59 / 15.00]; XM_UA_NO_VERSION(0.01)[]; RWL_MAILSPIKE_GOOD(0.00)[64.147.123.19:from]; R_SPF_ALLOW(-0.20)[+ip4:64.147.123.19]; MV_CASE(0.50)[]; RCVD_COUNT_THREE(0.00)[4]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[skunkwerks.at:+,messagingengine.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_LOW(-0.10)[64.147.123.19:from]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[64.147.123.19:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:11403, ipnet:64.147.123.0/24, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[skunkwerks.at:s=fm1,messagingengine.com:s=fm2]; FREEFALL_USER(0.00)[dch]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[skunkwerks.at]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[64.147.123.19:from:127.0.2.255]; MAILMAN_DEST(0.00)[freebsd-questions]; MID_RHS_WWW(0.50)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 17 Mar 2021 23:57:53 -0000 On Wed, 17 Mar 2021, at 19:45, Bob Melson wrote: > Has anybody out there successfully installed a Logitech C922 webcam? > > I've managed to install to the point where the device is recognized by > pwview, and have, I think, gotten the mic (/dev/dsp3) and speaker > (/dev/dsp2) correctly installed/activated/recognized. Problem is that I > see no video with jitsi or zoom or with the VA's telemed system - all 3 > just work on my clever phone, but not from my freebsd desktop. At this > point, I'm also not sure of mic and speaker, but they could be failing > because of the video failure. > > If anybody out there has successfully installed either a C920 or C922 > and has video, mic and sound working, I'd appreciate it if you could > post a how-to of just how you managed the trick. I don't do frustration > well and need a wise head's guidance. > > Thanks in advance, > Bob Melson hi Bob dmesg will help (see mine below). I've got a c920 here. if you want to go through this together (maybe over irc or something) reply back privately to organise. I don't see yours here https://wiki.freebsd.org/WebcamCompat what does dmesg report? I have the the following, on 13.0 & 14.0-CURRENT but I'm pretty sure this will be fine on 12.2 as well without changes. # packages multimedia/webcamd multimedia/pwcview multimedia/v4l-utils multimedia/v4l_compat (mine works without this, but its in my notes) ** no pulseaudio, sndio daemons running** # rc.conf kld_list="${kld_list} cuse" webcamd_enable=YES webcamd_user=dch webcamd_group=webcamd webcamd_0_flags="-N vendor-0x046d-HD-Pro-Webcam-C920 -S 7A9C9A7F" I probably added myself to groups video operator & webcamd as well. also, consider using firefox, the audio & mic detection works better; chrome doesn't handle this as neatly when you have multiple audio devices. in about:config for firefox, I have: media.cubeb.backend=oss dmesg will help. # dmesg | grep -i webcam [150339] ugen0.7: at usbus0 [150339] uaudio1: on usbus0 # sysctl hw.snd.verbose=2 # cat /dev/sndstat FreeBSD Audio Driver (64bit 2009061500/amd64) Installed devices: ####### USB speakers ###### pcm0: at ? kld snd_uaudio (1p:4v/0r:0v) default snddev flags=0x2e3 [pcm0:play:dsp0.p0]: spd 48000, fmt 0x00200010/0x00201000, flags 0x00002100, 0x00000006 interrupts 417074, underruns 0, feed 417073, ready 0 [b:6144/3072/2|bs:4096/2048/2] channel flags=0x2100 {userland} -> feeder_mixer(0x00200010) -> feeder_format(0x00200010 -> 0x00201000) -> {hardware} pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp0]: spd 48000, fmt 0x00201000/0x00200010, flags 0x10000000, 0x00000023 interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:16384/2048/8] channel flags=0x10000000 {userland} -> feeder_root(0x00201000) -> feeder_format(0x00201000 -> 0x00200010) -> feeder_volume(0x00200010) -> {hardware} pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp1]: spd 8000/48000, fmt 0x00100008/0x00200010, flags 0x10000000, 0x0000006b interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:512/64/8] channel flags=0x10000000 {userland} -> feeder_root(0x00100008) -> feeder_format(0x00100008 -> 0x00100010) -> feeder_rate(0x00100010 q:1 8000 -> 48000) -> feeder_matrix(1.0 -> 2.0) -> feeder_volume(0x00200010) -> {hardware} pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp2]: spd 48000, fmt 0x00201000/0x00200010, flags 0x10000000, 0x00000023 interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:16384/2048/8] channel flags=0x10000000 {userland} -> feeder_root(0x00201000) -> feeder_format(0x00201000 -> 0x00200010) -> feeder_volume(0x00200010) -> {hardware} pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp3]: spd 48000, fmt 0x00100010/0x00200010, flags 0x10000000, 0x00000061 interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:4096/512/8] channel flags=0x10000000 {userland} -> feeder_root(0x00100010) -> feeder_matrix(1.0 -> 2.0) -> feeder_volume(0x00200010) -> {hardware} ####### webcam record ####### pcm1: at ? kld snd_uaudio (0p:0v/1r:2v) snddev flags=0x2e3 [pcm1:record:dsp1.r0]: spd 32000, fmt 0x00200010, flags 0x00002100, 0x00000005 interrupts 417065, overruns 0, feed 834130, hfree 2048, sfree 2048 [b:2048/1024/2|bs:2048/1024/2] channel flags=0x2100 {hardware} -> feeder_root(0x00200010) -> feeder_mixer(0x00200010) -> {userland} pcm1:record:dsp1.r0[pcm1:virtual:dsp1.vr0]: spd 48000/32000, fmt 0x00201000/0x00200010, flags 0x10000000, 0x0000002b interrupts 0, overruns 0, feed 0, hfree 0, sfree 65536 [b:0/0/0|bs:65536/512/128] channel flags=0x10000000 {hardware} -> feeder_root(0x00200010) -> feeder_format(0x00200010 -> 0x00201000) -> feeder_volume(0x00201000) -> feeder_rate(0x00201000 q:1 32000 -> 48000) -> {userland} pcm1:record:dsp1.r0[pcm1:virtual:dsp1.vr1]: spd 8000/32000, fmt 0x00100008/0x00200010, flags 0x10000000, 0x0000006b interrupts 0, overruns 0, feed 0, hfree 0, sfree 2048 [b:0/0/0|bs:2048/16/128] channel flags=0x10000000 {hardware} -> feeder_root(0x00200010) -> feeder_matrix(2.0 -> 1.0) -> feeder_volume(0x00100010) -> feeder_rate(0x00100010 q:1 32000 -> 8000) -> feeder_format(0x00100010 -> 0x00100008) -> {userland} https://lists.freebsd.org/pipermail/freebsd-multimedia/2020-March/020164.html has some excellent resources & tips as well. for testing, https://mozilla.github.io/webrtc-landing/gum_test.html https://janus.conf.meetecho.com/echotest.html https://test.webrtc.org/ A+ Dave From owner-freebsd-questions@freebsd.org Thu Mar 18 00:46:10 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9674957E3CD for ; Thu, 18 Mar 2021 00:46:10 +0000 (UTC) (envelope-from melson.r@att.net) Received: from sonic305-24.consmr.mail.gq1.yahoo.com (sonic305-24.consmr.mail.gq1.yahoo.com [98.137.64.87]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F17cd3SkDz3rXK for ; Thu, 18 Mar 2021 00:46:08 +0000 (UTC) (envelope-from melson.r@att.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=att.net; s=s1024; t=1616028367; bh=a0EKK9zaPlad7dTpllol6velvSSje4bypVOYb/ww+oc=; h=Subject:To:References:From:Date:In-Reply-To:From:Subject:Reply-To; b=pcZa4D8PAQ1vG/DTwDImH36ccHCyd4dDj5vFY6xF2vb/vmBKKlaNaB3Nw5joUN35ET/MTNve32IS63EjBu/JppUObg2K2WS+l9cKpFxmSrK9yyb/yMGbRczmi1bZkW/7pz5/FrhqHCfuVES9CkjnZKrC6tD825TsryoKa6w5DNE= X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1616028367; bh=WTZ0LVoFuDH5nK+jEaZ8JWqJVZn7bRaolJf1dIpO4Q4=; h=X-Sonic-MF:Subject:To:From:Date:From:Subject; b=a3Gy0sJw1f/2g/iemzezBgex365fPOvPiz+kkslIYHywpJT9aqNUBDsCCQYkvp5m2WJCDBn0t3cLB+NAw2MlYaJE+sHgQMTyjYtZqDKVQoIjx7ek7UCCKUso9DaAQuU6wSYnBOIwv+J4nffGumn4zI04W/HuMmHj/VZy15SCsqW2Vi4aTs3k+GRqwLmnEL2vvw85dhK3xQaUj6TR8Y7ycMeHkFY1SgiY5GHNzaeh+tedJsKJlW1QLiKaMJ0jno9tSWlIUamaojQHkOCKZaOZQ68BlQ+ErKm84kZgZnnJScKYtOYEDMX/D7NntMWqN+Yshe3dnwh9g+OjMMrUeKocFg== X-YMail-OSG: 6hurCr8VM1nKWyp7Ikyi_AaasY8FwvKx5c_p22srZS77Wiw4UobER4NLoKav848 wndJFpf_1Lbg7S2Z81LfSlNERdPlw.AZObTwA84BsiHyZFdqdVC1wc33TALLWWfm8AzRTd9rXONy p57G3Gmp8pxKluHVMIdnzpj3XWLr91vJ_5xu3dPyp5YzQSCeyQSSw64tUnuDRIH4C6W7uajvCFoO J4bPbWgwRqcumrcwBW4ZJiEyXv_lAgvLlahYtCg9piG8Z9KvpLb4nAfcepDOkfYKKJcOrpaRb5Xw 6UwiWHkU3w9zxSh1l.kgs2qFVgeXFz.Ra66CEoc6zMsAQxT2tMOFliiSddeXKHcBEUywDv9VhxMD xxUGDOZ801Ft2Bzzm2y8LOk8A8vvVis2n8UA.68AI6_nnxKVx41D_QfzM0KpAx5QT0x3vOzQkQWe gUbpj.22jcrp8XpbGGXTR0hlS2f7KvBqSg86QSXIp9zTyDRzSwZOSwQVn5S7L7uVKrJBr4_0kNO9 TExDokcHT6IDj_wzMduI2TJpDGfFcE3NYrY_36_cilBAM8WGb1q6cAwZuZSuhPOOLOrpnyhgAooP MtpU7JUa0ZniW5fimBFNYWb4dmm3C8ug14yjACsCPM9kCz0SVKFCZdZ43uUmxg_v_.igsioJNMgB tSAOly3l5Vrh3DFuHGQzEG2KXMRdnvAhmg.o1KfLAnMfv8fgBiqojPuafiXNQEgfE0XusnOinAcT LCinJRNCP8e_o4CUnt5vXk1pLo2B3_wc16OiHR3Wgl1a1nIxxMsBdV0jSli58OtmkxQ6JD5SPuqy DELjQVDATvyzeBMsxmgDlcBXlXkgvjB9LBqdqaxeKUsEIEXm6wJQ3Zxg8.sL9XAsjoLVCmFcxwYK V87sRAjfQcyApGMVrhoT6IPSHsTY_cDJV_6NeVfytWkZaWL8j.D1ttmrlbNEkKxlwj3RiK9MIX8E ijNmfwXVXVQhr2t1j.oPTvebs1B4kFFrLzva4HARpQPXWwljpoCLT5fmoxdQZU14QGJrC9hBi6DA 1PRrK5XY5QexhHzNTRyO3u0lv91TKbRD4dBgrTmBae3IS6KuruoHjsc_55Yd.BVh4d.ITrJBg2EN mcKQ3vlwtkeRJXnhh5i0pdl9XYn9_W7LEw5du_nkbXN8YYZ5Folk2MpvJVpjMfd2SoEm3uQXW569 ace1GGIyUGfKjMVfPLM1A4JpoAVJ_i4t_H9RQ.C5E._9FHdlaH9O4tyoWJPmtYIIuo_jOYbeUEz1 nmHc6jfdvgNN85xtuE_aNFrDNWDkS_i4SOEo50bfLx.k78nuPGO6RuyQlbSRSdG38_nOpR72gugv .Rh_ojm1XoWCt8LJ3.6N8ysCfGDVaO3rRn_dLP6QJqiqpH2wB07mYgHkAOaHkMiOcnx9JXKxksQ7 t8UPyaUijloCHmo94cOcZAvQ0Ct306DBdUNf0BNSykftsQhT3DqC0dGT1AKni6dlfig.79ptJLkJ Qj0EiR8yufs6ISPwOlz4pTOC0BwfMYumRzCaIbA55fU.1GSPWoYWUmw1rRR15b9gQ2957UhpC5wV JgRt6gC5x6M2U45HB6XTv5ZzYToOryNxqQJvMCI5h5NWfFdN1Nbwa8xw1U.qTJJPnl032e2U.Ua9 IkyMBqB7NPEw7TMBABiU3SBxHMR4eJ7PZMdsK4yY0X8hvnAEW1lbhfBjcbg6G2TbuovLG2hu4G9A fACXQT4FT6kTvqUKUOj39vEpVarV6Le83bgMCeSJ46WTn.KL_PVDXPx8bD126b63._2glnU7nPlF 0VfSoz_bKpmtGa9C_eGP.17YdVqpslMmAvmrpxP0RLpao61frHQXzaMf.PmDJp6VHmnc61DtbPih yH_nfzh9jOXLdnZ9VERgNnRCeiJ30TJbRupzNE2aPW3pJODUO.egIkLvgAuzjxvTRzQcru5IPFXD UTeyr0oBPlZOcFHhuH0X9WGks2_yQLwLvuANssOXV1TbNwc5YPyF.0FCj9CZIfnflpkkZMJlKwZ5 W2gWpEFzKJ58dGKT8_f08mgpiMSsK.DyK5lJW6n7eLlXaNsoo.ltquj4hXUQjrRSN.fJ4iE9W82d h.oTcrUEKwFCiEw3ItnJxj9Hc6hdCFLIjh5e2WJWXnDvkzDEVlD9ncQaedW.NO_uRKameUNk2Ik1 oEnHQ4iM2nqcqA9QueWsaAPfMNdsYpsxrY3_OSSnji7yonZWIJ.yjDbnjdnkD0STGL0Lg1X1Sr6. Mo3eajmWPMRpgqi8SkgBCmBpci0tNLzl_ZLXHntMpnXiLELKmYn16nOzxjyroCONgXDRT.BT2ghN wUQe6aClXRC45u_77j5wET.I7bFelaptLzTiKU739RdTWVHD0bpx5L8F3x4.ZKxEhi9cFOoVea50 eBhea_rpQ3BI4e0DNq6fbs8SfXDrobTLON6LTKQy9hAH_9QT6pcQ3Qd50Orq3lYBUEqz05vcQp.D GxtGKtmzgX..JQFY6LsiD X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic305.consmr.mail.gq1.yahoo.com with HTTP; Thu, 18 Mar 2021 00:46:07 +0000 Received: by smtp418.mail.ne1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 46b1b5e9d80da9cfa36b606d76bc9aa5; Thu, 18 Mar 2021 00:46:00 +0000 (UTC) Subject: Re: Webcam - Logitech C922 - question To: freebsd-questions@freebsd.org References: <08db2f9a-4c85-0c82-455c-a1c64512ccc7.ref@att.net> <08db2f9a-4c85-0c82-455c-a1c64512ccc7@att.net> <9f90f7f8-565a-47f1-ab5d-d4d78fd791d4@www.fastmail.com> From: Bob Melson Organization: Department of Paleocomputing, Whatsamatta U. Message-ID: <38064678-58cf-1c73-72bc-4d7fda7b3d5b@att.net> Date: Wed, 17 Mar 2021 18:45:58 -0600 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: <9f90f7f8-565a-47f1-ab5d-d4d78fd791d4@www.fastmail.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.17936 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo Apache-HttpAsyncClient/4.1.4 (Java/11.0.9.1) X-Rspamd-Queue-Id: 4F17cd3SkDz3rXK X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=att.net header.s=s1024 header.b=pcZa4D8P; dmarc=none; spf=none (mx1.freebsd.org: domain of melson.r@att.net has no SPF policy when checking 98.137.64.87) smtp.mailfrom=melson.r@att.net X-Spamd-Result: default: False [-3.30 / 15.00]; FREEMAIL_FROM(0.00)[att.net]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; DKIM_TRACE(0.00)[att.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[att.net]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[att.net:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.87:from]; R_DKIM_ALLOW(-0.20)[att.net:s=s1024]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[att.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[98.137.64.87:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.87:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.87:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 00:46:10 -0000 dmesg | grep -i webcam: ugen0.2: at usbus0 uaudio0: on usbus0 ----- packages/ports are identical to yours, so won't list ----- rc.conf: webcamd_enable="YES" webcamd_0_flags="-N vendor-0x046d-C922-Pro-Stream-Webcam -S 49525BBF" virtual_oss_enable="YES" note: cuse is loaded via /boot/loader.conf entry: cuse_load="YES" ----- just set media.cubeb.backend for firefox - it wasn't present or set previously ----- cat /dev/sndstat: FreeBSD Audio Driver (64bit 2009061500/amd64) Installed devices: pcm0: on hdaa0 (1p:1v/0r:0v) snddev flags=0x2e7 [pcm0:play:dsp0.p0]: spd 48000, fmt 0x00200010, flags 0x00006100, 0x00000004 interrupts 980, underruns 0, feed 980, ready 0 [b:2048/1024/2|bs:2048/1024/2] channel flags=0x6100 {userland} -> feeder_mixer(0x00200010) -> {hardware} pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp0]: spd 44100/48000, fmt 0x00200010, flags 0x10000000, 0x00000029 interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:8192/1024/8] channel flags=0x10000000 {userland} -> feeder_root(0x00200010) -> feeder_volume(0x00200010) -> feeder_rate(0x00200010 q:1 44100 -> 48000) -> {hardware} pcm1: on hdaa1 (1p:1v/0r:0v) snddev flags=0x2e7 [pcm1:play:dsp1.p0]: spd 48000, fmt 0x00200010, flags 0x00006100, 0x00000004 interrupts 960, underruns 0, feed 960, ready 0 [b:2048/1024/2|bs:2048/1024/2] channel flags=0x6100 {userland} -> feeder_mixer(0x00200010) -> {hardware} pcm1:play:dsp1.p0[pcm1:virtual:dsp1.vp0]: spd 44100/48000, fmt 0x00200010, flags 0x10000000, 0x00000029 interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:8192/1024/8] channel flags=0x10000000 {userland} -> feeder_root(0x00200010) -> feeder_volume(0x00200010) -> feeder_rate(0x00200010 q:1 44100 -> 48000) -> {hardware} pcm2: on hdaa2 (1p:2v/1r:1v) default snddev flags=0x200002e2 [pcm2:play:dsp2.p0]: spd 48000, fmt 0x00200010, flags 0x00002108, 0x00000004 interrupts 12603261, underruns 0, feed 12603261, ready 0 [b:2048/1024/2|bs:2048/1024/2] channel flags=0x2108 {userland} -> feeder_mixer(0x00200010) -> {hardware} pcm2:play:dsp2.p0[pcm2:virtual:dsp2.vp0]: spd 48000, fmt 0x00210000/0x00200010, flags 0x1000110c, 0x00000023, pid 56557 (virtual_oss) interrupts 0, underruns 2437, feed 88222354, ready 2496 [b:0/0/0|bs:4092/2046/2] channel flags=0x1000110c {userland} -> feeder_root(0x00210000) -> feeder_format(0x00210000 -> 0x00200010) -> feeder_volume(0x00200010) -> {hardware} pcm2:play:dsp2.p0[pcm2:virtual:dsp2.vp1]: spd 44100/48000, fmt 0x00200010, flags 0x100011c8, 0x00000029, pid 92433 (pulseaudio) interrupts 0, underruns 0, feed 2972534, ready 15444 [b:0/0/0|bs:16384/4096/4] channel flags=0x100011c8 {userland} -> feeder_root(0x00200010) -> feeder_volume(0x00200010) -> feeder_rate(0x00200010 q:1 44100 -> 48000) -> {hardware} [pcm2:record:dsp2.r0]: spd 48000, fmt 0x00200010, flags 0x00002100, 0x00000005 interrupts 3757, overruns 0, feed 7514, hfree 512, sfree 512 [b:512/256/2|bs:512/256/2] channel flags=0x2100 {hardware} -> feeder_root(0x00200010) -> feeder_mixer(0x00200010) -> {userland} pcm2:record:dsp2.r0[pcm2:virtual:dsp2.vr0]: spd 44100/48000, fmt 0x00200010, flags 0x100011d0, 0x00000029, pid 92433 (pulseaudio) interrupts 0, overruns 0, feed 0, hfree 0, sfree 16384 [b:0/0/0|bs:16384/4096/4] channel flags=0x100011d0 {hardware} -> feeder_root(0x00200010) -> feeder_rate(0x00200010 q:1 48000 -> 44100) -> feeder_volume(0x00200010) -> {userland} pcm3: at ? kld snd_uaudio (0p:0v/1r:2v) snddev flags=0x100002e3 [pcm3:record:dsp3.r0]: spd 32000, fmt 0x00200010, flags 0x00002108, 0x00000005 interrupts 8402121, overruns 0, feed 16804242, hfree 2048, sfree 2047 [b:2048/1024/2|bs:2048/1024/2] channel flags=0x2108 {hardware} -> feeder_root(0x00200010) -> feeder_mixer(0x00200010) -> {userland} pcm3:record:dsp3.r0[pcm3:virtual:dsp3.vr0]: spd 48000/32000, fmt 0x00210000/0x00200010, flags 0x1000110c, 0x0000002b, pid 56557 (virtual_oss) interrupts 0, overruns 95, feed 43469004, hfree 0, sfree 7488 [b:0/0/0|bs:8160/1020/8] channel flags=0x1000110c {hardware} -> feeder_root(0x00200010) -> feeder_format(0x00200010 -> 0x00201000) -> feeder_volume(0x00201000) -> feeder_rate(0x00201000 q:1 32000 -> 48000) -> feeder_format(0x00201000 -> 0x00210000) -> {userland} pcm3:record:dsp3.r0[pcm3:virtual:dsp3.vr1]: spd 44100/32000, fmt 0x00200010, flags 0x10000000, 0x00000029 interrupts 0, overruns 0, feed 0, hfree 0, sfree 32768 [b:0/0/0|bs:32768/256/128] channel flags=0x10000000 {hardware} -> feeder_root(0x00200010) -> feeder_volume(0x00200010) -> feeder_rate(0x00200010 q:1 32000 -> 44100) -> {userland} No devices installed from userspace. ----- Thanks for your reply. Of the top, I don't see anything significantly different, so it may be a compatibility issue. Still, I *do* see an image when I call pwcview - it's just talking to the outside world that's not happening. Bob Melson On 3/17/21 5:57 PM, Dave Cottlehuber wrote: > On Wed, 17 Mar 2021, at 19:45, Bob Melson wrote: >> Has anybody out there successfully installed a Logitech C922 webcam? >> >> I've managed to install to the point where the device is recognized by >> pwview, and have, I think, gotten the mic (/dev/dsp3) and speaker >> (/dev/dsp2) correctly installed/activated/recognized. Problem is that I >> see no video with jitsi or zoom or with the VA's telemed system - all 3 >> just work on my clever phone, but not from my freebsd desktop. At this >> point, I'm also not sure of mic and speaker, but they could be failing >> because of the video failure. >> >> If anybody out there has successfully installed either a C920 or C922 >> and has video, mic and sound working, I'd appreciate it if you could >> post a how-to of just how you managed the trick. I don't do frustration >> well and need a wise head's guidance. >> >> Thanks in advance, >> Bob Melson > > hi Bob > > dmesg will help (see mine below). I've got a c920 here. if you want to go through this together (maybe over irc or something) reply back privately to organise. > > I don't see yours here https://wiki.freebsd.org/WebcamCompat what does dmesg report? > > I have the the following, on 13.0 & 14.0-CURRENT but I'm pretty sure this will be fine on 12.2 as well without changes. > > # packages > > multimedia/webcamd > multimedia/pwcview > multimedia/v4l-utils > multimedia/v4l_compat (mine works without this, but its in my notes) > > ** no pulseaudio, sndio daemons running** > > # rc.conf > kld_list="${kld_list} cuse" > webcamd_enable=YES > webcamd_user=dch > webcamd_group=webcamd > webcamd_0_flags="-N vendor-0x046d-HD-Pro-Webcam-C920 -S 7A9C9A7F" > > I probably added myself to groups video operator & webcamd as well. > > also, consider using firefox, the audio & mic detection works better; chrome doesn't handle this as neatly when you have multiple audio devices. in about:config for firefox, I have: > > media.cubeb.backend=oss > > > dmesg will help. > > # dmesg | grep -i webcam > [150339] ugen0.7: at usbus0 > [150339] uaudio1: on usbus0 > > # sysctl hw.snd.verbose=2 > # cat /dev/sndstat > FreeBSD Audio Driver (64bit 2009061500/amd64) > Installed devices: > > ####### USB speakers ###### > pcm0: at ? kld snd_uaudio (1p:4v/0r:0v) default > snddev flags=0x2e3 > [pcm0:play:dsp0.p0]: spd 48000, fmt 0x00200010/0x00201000, flags 0x00002100, 0x00000006 > interrupts 417074, underruns 0, feed 417073, ready 0 [b:6144/3072/2|bs:4096/2048/2] > channel flags=0x2100 > {userland} -> feeder_mixer(0x00200010) -> feeder_format(0x00200010 -> 0x00201000) -> {hardware} > pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp0]: spd 48000, fmt 0x00201000/0x00200010, flags 0x10000000, 0x00000023 > interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:16384/2048/8] > channel flags=0x10000000 > {userland} -> feeder_root(0x00201000) -> feeder_format(0x00201000 -> 0x00200010) -> feeder_volume(0x00200010) -> {hardware} > pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp1]: spd 8000/48000, fmt 0x00100008/0x00200010, flags 0x10000000, 0x0000006b > interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:512/64/8] > channel flags=0x10000000 > {userland} -> feeder_root(0x00100008) -> feeder_format(0x00100008 -> 0x00100010) -> feeder_rate(0x00100010 q:1 8000 -> 48000) -> feeder_matrix(1.0 -> 2.0) -> feeder_volume(0x00200010) -> {hardware} > pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp2]: spd 48000, fmt 0x00201000/0x00200010, flags 0x10000000, 0x00000023 > interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:16384/2048/8] > channel flags=0x10000000 > {userland} -> feeder_root(0x00201000) -> feeder_format(0x00201000 -> 0x00200010) -> feeder_volume(0x00200010) -> {hardware} > pcm0:play:dsp0.p0[pcm0:virtual:dsp0.vp3]: spd 48000, fmt 0x00100010/0x00200010, flags 0x10000000, 0x00000061 > interrupts 0, underruns 0, feed 0, ready 0 [b:0/0/0|bs:4096/512/8] > channel flags=0x10000000 > {userland} -> feeder_root(0x00100010) -> feeder_matrix(1.0 -> 2.0) -> feeder_volume(0x00200010) -> {hardware} > > ####### webcam record ####### > > pcm1: at ? kld snd_uaudio (0p:0v/1r:2v) > snddev flags=0x2e3 > [pcm1:record:dsp1.r0]: spd 32000, fmt 0x00200010, flags 0x00002100, 0x00000005 > interrupts 417065, overruns 0, feed 834130, hfree 2048, sfree 2048 [b:2048/1024/2|bs:2048/1024/2] > channel flags=0x2100 > {hardware} -> feeder_root(0x00200010) -> feeder_mixer(0x00200010) -> {userland} > pcm1:record:dsp1.r0[pcm1:virtual:dsp1.vr0]: spd 48000/32000, fmt 0x00201000/0x00200010, flags 0x10000000, 0x0000002b > interrupts 0, overruns 0, feed 0, hfree 0, sfree 65536 [b:0/0/0|bs:65536/512/128] > channel flags=0x10000000 > {hardware} -> feeder_root(0x00200010) -> feeder_format(0x00200010 -> 0x00201000) -> feeder_volume(0x00201000) -> feeder_rate(0x00201000 q:1 32000 -> 48000) -> {userland} > pcm1:record:dsp1.r0[pcm1:virtual:dsp1.vr1]: spd 8000/32000, fmt 0x00100008/0x00200010, flags 0x10000000, 0x0000006b > interrupts 0, overruns 0, feed 0, hfree 0, sfree 2048 [b:0/0/0|bs:2048/16/128] > channel flags=0x10000000 > {hardware} -> feeder_root(0x00200010) -> feeder_matrix(2.0 -> 1.0) -> feeder_volume(0x00100010) -> feeder_rate(0x00100010 q:1 32000 -> 8000) -> feeder_format(0x00100010 -> 0x00100008) -> {userland} > > https://lists.freebsd.org/pipermail/freebsd-multimedia/2020-March/020164.html has some excellent resources & tips as well. > > for testing, > > https://mozilla.github.io/webrtc-landing/gum_test.html > https://janus.conf.meetecho.com/echotest.html > https://test.webrtc.org/ > A+ > Dave > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.org" > -- Robert G. Melson | Rio Grande Microsolutions | El Paso, TX -- Minds are like parachutes. They only function when they are open. Sir James Dewar From owner-freebsd-questions@freebsd.org Thu Mar 18 03:36:20 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B34815ACE75 for ; Thu, 18 Mar 2021 03:36:20 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pj1-x1033.google.com (mail-pj1-x1033.google.com [IPv6:2607:f8b0:4864:20::1033]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1CP01zY0z4YQC for ; Thu, 18 Mar 2021 03:36:19 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pj1-x1033.google.com with SMTP id a22-20020a17090aa516b02900c1215e9b33so4281840pjq.5 for ; Wed, 17 Mar 2021 20:36:19 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=dtF+mG/gOj0h9NvUt3UzukxZKWM0bYanJ3JkjU+0IzI=; b=aKul7OfYjWLlg7seyvuGsnABKzXJ8LqDnTMbXaQJZWVs1bwg6B8ciunLORvi4OUR+i v+iP1wmymZcUanT1wPKy4OJ9gSbhcE6WxPep0N3UrXg0KZcWsDMSizJx8eqnnA3gFqq9 aSdGwoTVjyALfHWRK6sGB6K9uSpdiBQ/NTB8b7shxOdmxZDA2OJdbjNPoTi37jI06xEW 9ZPdQLxIC19HerGBwGzBjR8tYEKzKxH/BEcSNDu5Z3WwxOLgA56ZFz4ZGLxg1B3n9M+7 VnoopPoROOQB94DcnEtluyHmpx/VDUFlZnrB1KSEFoUPZJyam5VQkHwlWu8e29ei69+C ZLug== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=dtF+mG/gOj0h9NvUt3UzukxZKWM0bYanJ3JkjU+0IzI=; b=Xe0MYxEryHkZ8VulicJ2tkYBLGagvOMKKJoq5hbPd1tn0YJRjVANCRkYZrZuGeF2r/ nZ1H7QaEXkC3y3tRh4aw3CNysCD3PHYtPeX1wenaU9c1pqEvhvGVwDvOk0MtkPLcHYgj QNk2NytOAZA1vH/XQDWcvLRzb9Yc9QFhGpaDcIsH1XaZgaJplWF0UH8iNvyn8a36rV+C op2ttloY9whacQSVjn+lucDBWeC2doW6vSxxZhvJsaiOAUBDfl064BEJb6w6Q/ZYej1J BQAUdbCasmroGAJN1sKrNqQ5nU7V6TMai4eogc0RfSM87I3gZBFrYyEkyIEfNn4r8zNq /chw== X-Gm-Message-State: AOAM532oAZ9gUuAx012ox8PqIlDviRypomLqRE8thKx1Yfq3biQC944F vuCGMOJsdQ/sdikUjLUeEgjF92LK4VU+Kg== X-Google-Smtp-Source: ABdhPJxmgrTcLeB27DN8t/jh1nwg+gq53ki9noP8HvgIf/f0r9EoDbGun+2A1kArl8pZazot9Jg+FA== X-Received: by 2002:a17:90a:598e:: with SMTP id l14mr1964192pji.187.1616038578835; Wed, 17 Mar 2021 20:36:18 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id c6sm519117pfj.99.2021.03.17.20.36.18 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Wed, 17 Mar 2021 20:36:18 -0700 (PDT) Date: Wed, 17 Mar 2021 21:36:15 -0600 From: Duke Normandin To: freebsd-questions Subject: Partitioning 1T HDD Message-ID: <20210317213615.7e1443af@antix1> X-Mailer: Claws Mail 3.17.3 (GTK+ 2.24.32; i686-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1CP01zY0z4YQC X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=aKul7OfY; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::1033 as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.49 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-0.99)[-0.991]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::1033:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::1033:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::1033:from]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 03:36:20 -0000 I want to install both FreeBSD and a Linux distro on an ASUS laptop that I just upgraded with a 1T HDD. I'm not sure how to proceed for a 50-50 split the HDD storage. 2 equal Primary partitions? First one gets Freebsd; the 2nd left unused until I install a Linux distro? OR - do I have to dedicate the 2nd to some filesystem when I install FreeBSD? Any advise, suggestions, heads-ups, will be most appreciated! TIA -- Sidney From owner-freebsd-questions@freebsd.org Thu Mar 18 05:40:44 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id F0F8D5AECA0 for ; Thu, 18 Mar 2021 05:40:44 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-oi1-x22a.google.com (mail-oi1-x22a.google.com [IPv6:2607:f8b0:4864:20::22a]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1G8X0vMgz4dYY for ; Thu, 18 Mar 2021 05:40:43 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: by mail-oi1-x22a.google.com with SMTP id d16so1073134oic.0 for ; Wed, 17 Mar 2021 22:40:43 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=RDs+0NemZxCh6t6LGdT0iJvY5nOtpS3CY/MK/4r9MvQ=; b=BGm5QoQYSsfaLvo8ITIJV+3UPGn+415kUbpyNt2ZIZVx67JEDvMJ4JxnQo4lKBcQ9a 3JM1+eCRqp8lc39rQYqKeql5mc6llH/QXiYCi6Jmx9EqmU7LsaNhD/6p8UN2crqNp++/ WV1z3H4Hww0iRz+nTBuuhjqhU4p8JfZ3aotsKUfbZo24qU5a6e/HPDh4He2Hp33JN0a7 8/PxO4MZqLS8Yxg62s2NDH+dmKTngZS4R1TjWc2mbdY7A+C8LHlDYOLlOet9nrNl5oW7 wlof0fAw4gDic8pNiUIiRLNAfkbVD+Mmya8Po3pKNUjFg8gfMmA3OA7V/nEhu1v9k1LZ ffow== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=RDs+0NemZxCh6t6LGdT0iJvY5nOtpS3CY/MK/4r9MvQ=; b=cyoDtyqELnPbke2aPFcLOIQMag6xAi7OQYwFTf9KYRPZbPmU3nk0FJPjmkR1I2ULGQ qcsn/YGWH781JohKUyBKe3ypw83uQMyuK8jSjwcwziIbHGyzDBbRtIk3cVcXSJFJfvAy /Xaynoj+/1keMj3I3gsD1jsWatjMFozfT1S753bVRmjdBW36+TjJCBy8pTK07+maRAAn Y7q3pb9ihroOjvZtHLW+7lIMsjgRQUlTpIrUjKxJozc4Ds31SeLa6zw1fZ3dYN4gf25X LRSrDaZuP81xktEO/wlW1tSoqcMY9sxShU35tTZN0ZzijXQn9GOmWCkY7LwBExqxWD+7 ax1w== X-Gm-Message-State: AOAM530nP9+FrCLtOtm0rxs9vkaLC0Tf3NRWgeNz8vqEqK16P0kgjm54 W/UDRzX3SVXKUjamNjfLO38qTKvzFnCws/WpopA= X-Google-Smtp-Source: ABdhPJyzzn2AWmhn94ezVDh6g5jup1xj3XJqCI8Wh2agfzHZTnz0xaXF5/U0Tts9F+o22j54nL5aOOuaoHRYarBks10= X-Received: by 2002:aca:ed04:: with SMTP id l4mr1817181oih.27.1616046042899; Wed, 17 Mar 2021 22:40:42 -0700 (PDT) MIME-Version: 1.0 References: <20210317213615.7e1443af@antix1> In-Reply-To: <20210317213615.7e1443af@antix1> From: Kevin Oberman Date: Wed, 17 Mar 2021 22:40:27 -0700 Message-ID: Subject: Re: Partitioning 1T HDD To: Duke Normandin Cc: freebsd-questions X-Rspamd-Queue-Id: 4F1G8X0vMgz4dYY X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=BGm5QoQY; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kob6558@gmail.com designates 2607:f8b0:4864:20::22a as permitted sender) smtp.mailfrom=kob6558@gmail.com X-Spamd-Result: default: False [-3.70 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[rkoberman@gmail.com,kob6558@gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::22a:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[rkoberman@gmail.com,kob6558@gmail.com]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::22a:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::22a:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 05:40:45 -0000 On Wed, Mar 17, 2021 at 8:36 PM Duke Normandin wrote: > I want to install both FreeBSD and a Linux distro on an ASUS laptop > that I just upgraded with a 1T HDD. > > I'm not sure how to proceed for a 50-50 split the HDD storage. > 2 equal Primary partitions? First one gets Freebsd; the 2nd left unused > until I install a Linux distro? > > OR - do I have to dedicate the 2nd to some filesystem when I install > FreeBSD? > > Any advise, suggestions, heads-ups, will be most appreciated! TIA > -- > Sidney > FreeBSD defaults to putting everything in one partition. There is no requirement for more than one. I would strongly recommend partitioning as GPT. I find it much easier to work with and it is the modern standard. If you use UEFI, gpt is the way to go. Some old systems, like my 10 year old T520 that don't support EFI well or at all or well, but I'd still recommend GPT. I would expect any system newer than 5 years should be fine with EFI. -- Kevin Oberman, Part time kid herder and retired Network Engineer E-mail: rkoberman@gmail.com PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 From owner-freebsd-questions@freebsd.org Thu Mar 18 07:36:38 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3386E5B02DF for ; Thu, 18 Mar 2021 07:36:38 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-ed1-x52e.google.com (mail-ed1-x52e.google.com [IPv6:2a00:1450:4864:20::52e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1JkF1pv6z4kZm for ; Thu, 18 Mar 2021 07:36:37 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-ed1-x52e.google.com with SMTP id dm8so5403799edb.2 for ; Thu, 18 Mar 2021 00:36:37 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=kxBaoUVFcvLilU17chagCF6mYAFOt23VG43JUu9WW98=; b=aVzXM/8Fpe/cZ8EW1opwh5emuA2RpmGFXAoIbDjWdW2oxll7/RbHtvlqDMTatBihZm Q3AxxUelanMoTSzszr1X9zHly/cm1R6Y8ZagYUamE2XM6aY/JGWS9w0KFVAocDLl7Nh3 PqZSPV7d4Qjphyulh1mZhSHtXpnZZ7c9Wsms6J3qjHppPuzy6DrclI2Ythv1StoFsfII AYZ0Bdqb6welFfh3DDGiUz+ulGUBX7mNC1iJxHBCzvbzcIG5hIR6xdQC20rqoKvHB+3b Ae5IbuGuWEl4JV7lKVtWt11Rb8q3ssmMKFVOg/0XUaMgeBQHwy8/ayzicmJPldSFBwz4 IKJA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=kxBaoUVFcvLilU17chagCF6mYAFOt23VG43JUu9WW98=; b=h+NmsYWNuZHbh6ye3f0M+PicXpSB6P/8Pnjl5kv+ZJ07wWH24UEc4CANRZRPcAw/YA ZxwMM+Fyak60WTDGq10TShnfJjCF+DmTds/SWTcQaa/vmhI1W77pK4yV1tWCi15vKo9a LK36TDPZT9U6us6xS7JdwBuC4181/Gs4z8OzVK4K++Ds2Fe5Y+4qaeuQpDdqDlsbCeps kzy5XHcGp3CIkH4h1cLG+qV+IFoP1pUzLGru19dv5vc9ltmtQ1u7iHnzdvm+yX8fLwrN 2/HazTO6thFDN/bRhs0ZZ3p20SfkosMVZeboQurvOIORhDQt8+ObqdY3tT2gYOK8Hmu1 hKLQ== X-Gm-Message-State: AOAM530nMSw0XZthagjY8Na6p0QYHd36rwD4bGIwUDwnehxBplpx7uJQ sjiQAzciV1H4bcjoGumbCRL88PKD1JghdQ== X-Google-Smtp-Source: ABdhPJx8iY+9LXfJXaHO4KNrFuH7iaz/gGWtk/+4GGLp4mQoPe2+/FBdwkxh+k1cKo91d5lDtNq4Jw== X-Received: by 2002:aa7:c94b:: with SMTP id h11mr1938567edt.160.1616052995660; Thu, 18 Mar 2021 00:36:35 -0700 (PDT) Received: from [192.168.1.13] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id br13sm1070826ejb.87.2021.03.18.00.36.34 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Thu, 18 Mar 2021 00:36:34 -0700 (PDT) Subject: Interprocess networking is sluggish; and WireGuard To: freebsd-questions@freebsd.org References: From: Graham Perrin Message-ID: Date: Thu, 18 Mar 2021 07:36:34 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 7bit Content-Language: en-GB X-Rspamd-Queue-Id: 4F1JkF1pv6z4kZm X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=aVzXM/8F; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::52e as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::52e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::52e:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::52e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 07:36:38 -0000 On 16/03/2021 21:22, Paul wrote: > Just a simple command like pkg install git could take a few hours. That seems wrong. Are you certain that it's an interprocess networking issue? Which version of FreeBSD? > I installed wireguard, I am not a networking expert mentions a kernel implementation, however please read that alongside in particular the agreed removal from base. From owner-freebsd-questions@freebsd.org Thu Mar 18 07:47:55 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8CDE05B0AD1 for ; Thu, 18 Mar 2021 07:47:55 +0000 (UTC) (envelope-from 4250.82.1d4ce000332790b.df89f6b42e14a84a8ea1751936aa2914@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1JzG4xD1z4lQR for ; Thu, 18 Mar 2021 07:47:54 +0000 (UTC) (envelope-from 4250.82.1d4ce000332790b.df89f6b42e14a84a8ea1751936aa2914@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616053675; x=1618645675; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=w7yUXz93G/ynIcYEwUamM2HPrGyact3cLnwRst1LMGs=; b=ExLOyUu+utPiC5pX09+q49PCz57pUTwKWjLDMPdqhPAdy2tL/KGT1foH4039Z8Log4ZIzR5tM3ZkY+Ool20lHE+ixtqlwj2Wm/liWleBx7CljAXsglqQX/VQMA+3L8bK0GLVBlkKzmCDnGDvxgxyhcc1lH9SgVlqwEm2uAqdCWk= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDMzMjc5MGIuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.sg.in.socketlabs.com (r3.sg.in.socketlabs.com [142.0.179.13]) by mxsg2.email-od.com with ESMTP; Thu, 18 Mar 2021 03:47:38 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.sg.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 18 Mar 2021 03:47:37 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lMnNX-000EKO-96; Thu, 18 Mar 2021 07:47:35 +0000 Date: Thu, 18 Mar 2021 07:47:35 +0000 From: Steve O'Hara-Smith To: Michael Sierchio Cc: FreeBSD Questions Subject: Re: Repository availability and security updates for version 11 Message-Id: <20210318074735.450a16e5afc1500e1cd8a80d@sohara.org> In-Reply-To: References: X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1JzG4xD1z4lQR X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=ExLOyUu+; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce000332790b.df89f6b42e14a84a8ea1751936aa2914@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce000332790b.df89f6b42e14a84a8ea1751936aa2914@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce000332790b.df89f6b42e14a84a8ea1751936aa2914@email-od.com]; RWL_MAILSPIKE_POSSIBLE(0.00)[142.0.176.198:from]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce000332790b.df89f6b42e14a84a8ea1751936aa2914@email-od.com]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 07:47:55 -0000 On Wed, 17 Mar 2021 13:21:05 -0700 Michael Sierchio wrote: > On Wed, Mar 17, 2021 at 9:51 AM Guy Noir > wrote: > > 1. How long after September 2020 will the version 11 repository remain > > available? > > > > You can find old releases, back to 1.0, here > > http://ftp-archive.freebsd.org/pub/FreeBSD-Archive/old-releases/ I believe the tags in the source repository will also remain indefinitely. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Thu Mar 18 07:53:15 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 083655B1139 for ; Thu, 18 Mar 2021 07:53:15 +0000 (UTC) (envelope-from 4250.82.1d4ce0003327e69.01233cfb150d040b1933ef7541e35950@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1K5Q2w24z4lvN for ; Thu, 18 Mar 2021 07:53:14 +0000 (UTC) (envelope-from 4250.82.1d4ce0003327e69.01233cfb150d040b1933ef7541e35950@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616053994; x=1618645994; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=C8gCXVBosX0fj6vErBs8FHX5ZOH8aHV1hxxRQLyAtr8=; b=ZWMolHa8i9yIZFDy5cSRqxVk9Ey1KDqhA9NROpAh/xNwup3tzScBP1sD30E/5aDWAWl75RmyS47a+R9ILNQVFyycsCf6SEGngMIhabB3ODFWnT7HC/FidAc1ZZj0SXoqvA2NlOJXVe2yWjv0lNYIUvatBoPzY1jmdoJ10gvwGaI= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDMzMjdlNjkuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r2.us-east-1.aws.in.socketlabs.com (r2.us-east-1.aws.in.socketlabs.com [142.0.191.2]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 18 Mar 2021 03:53:04 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r2.us-east-1.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 18 Mar 2021 03:53:04 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lMnSo-000EKr-Iu for freebsd-questions@freebsd.org; Thu, 18 Mar 2021 07:53:02 +0000 Date: Thu, 18 Mar 2021 07:53:02 +0000 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210318075302.bc53f81121ad32ffbfe65961@sohara.org> In-Reply-To: <20210317213615.7e1443af@antix1> References: <20210317213615.7e1443af@antix1> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1K5Q2w24z4lvN X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=ZWMolHa8; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce0003327e69.01233cfb150d040b1933ef7541e35950@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce0003327e69.01233cfb150d040b1933ef7541e35950@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20:c]; MV_CASE(0.50)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[sohara.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DKIM_TRACE(0.00)[email-od.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce0003327e69.01233cfb150d040b1933ef7541e35950@email-od.com]; RWL_MAILSPIKE_POSSIBLE(0.00)[142.0.176.198:from]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce0003327e69.01233cfb150d040b1933ef7541e35950@email-od.com]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 07:53:15 -0000 On Wed, 17 Mar 2021 21:36:15 -0600 Duke Normandin wrote: > I want to install both FreeBSD and a Linux distro on an ASUS laptop > that I just upgraded with a 1T HDD. > > I'm not sure how to proceed for a 50-50 split the HDD storage. > 2 equal Primary partitions? First one gets Freebsd; the 2nd left unused > until I install a Linux distro? You can make any split you like, and leaving a partition marked unused is perfectly fine. I will second the suggestion to use GPT partitioning instead of the old MBR partitioning which is generally considered obsolete because of its limitations. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Thu Mar 18 08:10:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 37F865B194B for ; Thu, 18 Mar 2021 08:10:23 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1KTB1RLCz4n27 for ; Thu, 18 Mar 2021 08:10:21 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from fews2.riseup.net (fews2-pn.riseup.net [10.0.1.84]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F1KSw2N0fzDxct for ; Thu, 18 Mar 2021 01:10:08 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616055020; bh=pTAjTkYYrpR9IvsktCHnF0frG4qx/LSADqkHfL0A4yY=; h=Subject:References:From:In-Reply-To:Date:To:From; b=QcjacybSlF2GPS1c+TtueKg4KEIMjEA3PCNPIufGl3PsGHjynEGZbSbQp5fgKjrs7 sDymJeAthpGHhZtgBGgjgL+A3+5cJUK2wL7cmJmSQmP9lvvtcQwUc+F3d1dMGwBQwb ty3MYwYpwTxSGZpy79eVudo5Vh7xzWYIQpEuYo8c= X-Riseup-User-ID: BEE5217F5512F4736358013C7F56C5DE20FB8867201EE891DA7144181E5B9580 Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews2.riseup.net (Postfix) with ESMTPSA id 4F1KSv5kCnz1xmR for ; Thu, 18 Mar 2021 01:10:07 -0700 (PDT) Subject: Re: Partitioning 1T HDD References: <20210317213615.7e1443af@antix1> From: Ralf Mardorf Content-Type: text/plain; charset=us-ascii In-Reply-To: Message-Id: <933C2C35-16CB-4B3E-A2FF-781CDAAC62C2@riseup.net> Date: Thu, 18 Mar 2021 09:10:03 +0100 To: freebsd-questions Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (1.0) X-Rspamd-Queue-Id: 4F1KTB1RLCz4n27 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=QcjacybS; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of ralf-mardorf@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=ralf-mardorf@riseup.net X-Spamd-Result: default: False [-4.59 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+mx]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-0.99)[-0.986]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 08:10:23 -0000 > On 18 Mar 2021, at 06:40, Kevin Oberman wrote: > .I would strongly recommend partitioning as GPT. Hi, why? There's no reason to use UEFI for a Linux and FreeBSD dual-boot. Or doe= s FreeBSD enforce UEFI nowadays? Full address access of a 1 (and even a 2) T= iB drive works with MBR. If the computer gets borked and you urgently need a= ccess to data on a weekend, when all stores are closed, let alone Corona loc= kdowns, it's possible to use the drive with any old hardware providing the r= ight bus interface lying around. AFAIK this is something you can't do when u= sing GPT, since not all BIOS' support GPT. Regards, Ralf= From owner-freebsd-questions@freebsd.org Thu Mar 18 08:22:24 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6BB635B2042 for ; Thu, 18 Mar 2021 08:22:24 +0000 (UTC) (envelope-from jacques+freebsd@foucry.net) Received: from mail.foucry.net (fournil.foucry.net [95.217.83.231]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1Kl321xbz4nyn for ; Thu, 18 Mar 2021 08:22:22 +0000 (UTC) (envelope-from jacques+freebsd@foucry.net) Received: from mail.foucry.net (unknown [192.168.12.17]) by mail.foucry.net (Postfix) with ESMTP id 7F23346188 for ; Thu, 18 Mar 2021 08:22:15 +0000 (UTC) X-Virus-Scanned: amavisd-new at foucry.net Received: from mail.foucry.net ([192.168.12.17]) by mail.foucry.net (mail.foucry.net [192.168.12.17]) (amavisd-new, port 10024) with ESMTP id pSrP7oq7jYmq for ; Thu, 18 Mar 2021 08:22:15 +0000 (UTC) Received: by mail.foucry.net (Postfix, from userid 58) id E01FE45DE0; Thu, 18 Mar 2021 08:22:14 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=foucry.net; s=dkim; t=1616055735; bh=ZaYpQPPCLHOParPUsgfRnsQDg4dOiiBr8vLxJ6Vz6Yk=; h=Date:From:To:Cc:Subject:References:In-Reply-To; b=nrWt6kO9fJ3rhrTrEDDglS36DtHJrTbBAfoMHhtI36zlWOOhRXPW7Ue6yMfaOLboz hMddx4Znha/e5/Jle7O9LVOaR5H77Jh6nTF6MT38o6SJ5gSvSQlWKYs0aK7vw+BJNl /D+neWR3fzyIZCE0h7Tb3nE46OK0+JkgRsD9z5T0= Received: from mithril.foucry.net (unknown [IPv6:2a01:cb10:8e64:fe00:ea6a:64ff:fe07:95a1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-384) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mail.foucry.net (Postfix) with ESMTPSA id AA98545BE0; Thu, 18 Mar 2021 08:22:12 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=foucry.net; s=dkim; t=1616055732; bh=ZaYpQPPCLHOParPUsgfRnsQDg4dOiiBr8vLxJ6Vz6Yk=; h=Date:From:To:Cc:Subject:References:In-Reply-To; b=Zmevfil8/rlQkKPLNteor5IZDgawUp6lWvzBjRsS+aJnUhWOFdhOQQ3koyQR6xyP3 NKHoGt7glxkwuCmsSQl+NCsYnQDcTANi1bnPpEoIy5j5/mNOq5e+OSjMT0Vd41Smw+ bFfgeXUZWYjaXX8W/9uyHZUPEMyJ7s7j8GYZnpA0= Received: from mithril.foucry.net (localhost [IPv6:::1]) by mithril.foucry.net (Postfix) with ESMTPS id E70E8680A0; Thu, 18 Mar 2021 09:22:11 +0100 (CET) Date: Thu, 18 Mar 2021 09:22:10 +0100 From: Jacques Foucry To: Steve O'Hara-Smith Cc: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-ID: Mail-Followup-To: Steve O'Hara-Smith , freebsd-questions@freebsd.org References: <20210317213615.7e1443af@antix1> <20210318075302.bc53f81121ad32ffbfe65961@sohara.org> MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: <20210318075302.bc53f81121ad32ffbfe65961@sohara.org> X-Operating-System: FreeBSD X-Rspamd-Queue-Id: 4F1Kl321xbz4nyn X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=foucry.net header.s=dkim header.b=nrWt6kO9; dkim=pass header.d=foucry.net header.s=dkim header.b=Zmevfil8; dmarc=pass (policy=none) header.from=foucry.net; spf=pass (mx1.freebsd.org: domain of jacques@foucry.net designates 95.217.83.231 as permitted sender) smtp.mailfrom=jacques@foucry.net X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[95.217.83.231:from]; RCVD_COUNT_FIVE(0.00)[6]; R_DKIM_ALLOW(-0.20)[foucry.net:s=dkim]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; ARC_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[95.217.83.231:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[foucry.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[foucry.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:24940, ipnet:95.217.0.0/16, country:DE]; TAGGED_FROM(0.00)[freebsd]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 08:22:24 -0000 Le jeudi 18 mars 2021 à 07:53:02 (+0000), Steve O'Hara-Smith à écrit: > On Wed, 17 Mar 2021 21:36:15 -0600 > Duke Normandin wrote: > > > I want to install both FreeBSD and a Linux distro on an ASUS laptop > > that I just upgraded with a 1T HDD. > > > > I'm not sure how to proceed for a 50-50 split the HDD storage. > > 2 equal Primary partitions? First one gets Freebsd; the 2nd left unused > > until I install a Linux distro? > > You can make any split you like, and leaving a partition marked > unused is perfectly fine. > > I will second the suggestion to use GPT partitioning instead of the > old MBR partitioning which is generally considered obsolete because of its > limitations. I agree too, even I not a specialist. -- Jacques Foucry From owner-freebsd-questions@freebsd.org Thu Mar 18 12:10:31 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4793A572AC1 for ; Thu, 18 Mar 2021 12:10:31 +0000 (UTC) (envelope-from espanop@gmail.com) Received: from mail-lf1-x12b.google.com (mail-lf1-x12b.google.com [IPv6:2a00:1450:4864:20::12b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1QpG2y9wz3MPV for ; Thu, 18 Mar 2021 12:10:30 +0000 (UTC) (envelope-from espanop@gmail.com) Received: by mail-lf1-x12b.google.com with SMTP id q29so4163233lfb.4 for ; Thu, 18 Mar 2021 05:10:30 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=7dIh+t4dhZB3toh3VuKeNOY25mXXwDprpGVdN0vas6o=; b=XmmZYCH8IiZfoMavXkTr88Q4Dbfctfn6hOSd/B9Ciw76KeSXusuxrQzZc9jaVpf2qY 16hQcJxHME38YQklQwBmnI6ZbNAekQjaHUYGr/g6Udtl428mOMXB1xCUkialEaKW+r8d /dAuNrc55ddleqFSkzj0cMat0T7lq6/00OM7YxYcYjy95S9q1gY+DPoi32S3uy/aV85x GDa3O0vmD7vMyAaVc+dE738pFPtIWw+7SA1XPGMpFoJ1QIdfx0HeIWNWH4WbKbQ801TM U9QbGRvIGGbYixWsqC+/iBcT4sWo3+pwherX0FeHV/8tFJ8oWB4/7qqeXdQAshtNwOC/ KWTw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=7dIh+t4dhZB3toh3VuKeNOY25mXXwDprpGVdN0vas6o=; b=XpLQ+e385TzT7vwTNShK42fyU427LdgqqOf7DkzKsnhqYmZ4UXQAxY48ECCbI9EFOk g2j6mpkmzH25TLn7ds8NrLYMm+niIbcjmDtYpZjwBedssAnvYng54AvRxNTRxDxP9cJC mnAxyZq+0LYc6t2iNNcv3LvfXtnEtIq43bkiX9Q7hASKVo+2N64ubCYYwLFbWQ6DMZc1 fPhpoIZbF5UTqiATYX0wxwhQtIFE16QdsJCdsHHSogqKNzxKZfUNV+Xdud52t6uHCEgc 5ZENzITPLH7mbye7Ra+8VWQKmBqfyLqvyVEiXJi5rNpVyqhBtXZ8EHCupifdMkQIZGIC 3dSQ== X-Gm-Message-State: AOAM533uOK6zryGpet2cFRYzYXULbasbFsXpzSUze6vTpVv4VZLvvQal Bi1wTGhA4bifpeWyaneviL0skA+WEKdeIQA6wENQf+PJ4xg= X-Google-Smtp-Source: ABdhPJwY3aNx6vIKKPDQ58D0+7NdnPZqRYlMWYuZZJqcMJlHUoG6oS4t9aIvPv19AXekEZkcRwY+iQbyaKzRpcvUKgE= X-Received: by 2002:a19:c309:: with SMTP id t9mr5081271lff.348.1616069428801; Thu, 18 Mar 2021 05:10:28 -0700 (PDT) MIME-Version: 1.0 References: <20210317213615.7e1443af@antix1> <20210318075302.bc53f81121ad32ffbfe65961@sohara.org> In-Reply-To: From: irene spanopoulou Date: Thu, 18 Mar 2021 14:09:45 +0200 Message-ID: Subject: Re: Partitioning 1T HDD To: "Steve O'Hara-Smith" , freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F1QpG2y9wz3MPV X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=XmmZYCH8; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of espanop@gmail.com designates 2a00:1450:4864:20::12b as permitted sender) smtp.mailfrom=espanop@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::12b:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::12b:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::12b:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 12:10:31 -0000 It depends on what you want to do, if you do not need gpt, don't go with it= . On Thu, 18 Mar 2021 at 10:22, Jacques Foucry wrote: > Le jeudi 18 mars 2021 =C3=A0 07:53:02 (+0000), Steve O'Hara-Smith =C3=A0 = =C3=A9crit: > > On Wed, 17 Mar 2021 21:36:15 -0600 > > Duke Normandin wrote: > > > > > I want to install both FreeBSD and a Linux distro on an ASUS laptop > > > that I just upgraded with a 1T HDD. > > > > > > I'm not sure how to proceed for a 50-50 split the HDD storage. > > > 2 equal Primary partitions? First one gets Freebsd; the 2nd left unus= ed > > > until I install a Linux distro? > > > > You can make any split you like, and leaving a partition marked > > unused is perfectly fine. > > > > I will second the suggestion to use GPT partitioning instead of t= he > > old MBR partitioning which is generally considered obsolete because of > its > > limitations. > > > I agree too, even I not a specialist. > > -- > Jacques Foucry > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Thu Mar 18 12:36:32 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EFBC757394F for ; Thu, 18 Mar 2021 12:36:32 +0000 (UTC) (envelope-from 4250.82.1d4ce0003379295.f0cbf5108b43d6d6803eaf48a79a87d6@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1RNJ16yWz3P2b for ; Thu, 18 Mar 2021 12:36:31 +0000 (UTC) (envelope-from 4250.82.1d4ce0003379295.f0cbf5108b43d6d6803eaf48a79a87d6@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616070992; x=1618662992; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=kebykEQBwM+ESdJf3dBf2aAHReOz0maM3CDWKsm7NHU=; b=X7HcX0nCOCrp0QiA3qTPYegjjiRkmSfqkmF5aOog6anPW3Sj3RHukVpsg+tzq7uvYqXU1Uvd+OwPKNStGAN/PrWQ0gGhAcmXv3SeOWW2Isrkyo524012XWSkqnqivWqixyueQjZrE6sIp5BqR8G3kjZ1Kdt2+aUvQL39nSzC678= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDMzNzkyOTUuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.us-east-1.aws.in.socketlabs.com (r3.us-east-1.aws.in.socketlabs.com [142.0.191.3]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 18 Mar 2021 08:36:21 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.us-east-1.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 18 Mar 2021 08:36:21 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lMrsx-000F9U-LK; Thu, 18 Mar 2021 12:36:19 +0000 Date: Thu, 18 Mar 2021 12:36:19 +0000 From: Steve O'Hara-Smith To: irene spanopoulou Cc: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210318123619.515bbd42bf196b5023e4ac0f@sohara.org> In-Reply-To: References: <20210317213615.7e1443af@antix1> <20210318075302.bc53f81121ad32ffbfe65961@sohara.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1RNJ16yWz3P2b X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=X7HcX0nC; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce0003379295.f0cbf5108b43d6d6803eaf48a79a87d6@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce0003379295.f0cbf5108b43d6d6803eaf48a79a87d6@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce0003379295.f0cbf5108b43d6d6803eaf48a79a87d6@email-od.com]; RCVD_TLS_LAST(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; MID_RHS_MATCH_FROM(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce0003379295.f0cbf5108b43d6d6803eaf48a79a87d6@email-od.com]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[142.0.176.198:from]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 12:36:33 -0000 On Thu, 18 Mar 2021 14:09:45 +0200 irene spanopoulou wrote: > It depends on what you want to do, if you do not need gpt, don't go with > it. MBR is a kludge from the early 1980s, the whole primary secondary partition business shows that the original design ran out of steam really early on. There's no good reason to use it now. -- Steve O'Hara-Smith | Directable Mirror Arrays C:\>WIN | A better way to focus the sun The computer obeys and wins. | licences available see You lose and Bill collects. | http://www.sohara.org/ From owner-freebsd-questions@freebsd.org Thu Mar 18 13:38:55 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7CFFA575561 for ; Thu, 18 Mar 2021 13:38:55 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt21.smtp-out.videotron.ca (alt21.smtp-out.videotron.ca [70.80.0.72]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1SmG5mcnz3hg2 for ; Thu, 18 Mar 2021 13:38:54 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from LenovoPC ([173.176.219.200]) by Videotron with SMTP id MsrRlIreMsO2gMsrUltgga; Thu, 18 Mar 2021 09:38:53 -0400 X-Authority-Analysis: v=2.3 cv=BMfNU2YG c=1 sm=1 tr=0 a=oaKXazPqqAQRKKEMLXbeDQ==:117 a=oaKXazPqqAQRKKEMLXbeDQ==:17 a=DAwyPP_o2Byb1YXLmDAA:9 a=z5duqJcgb3X7U0zPQLsA:9 a=CjuIK1q_8ugA:10 a=yMhMjlubAAAA:8 a=SSmOFEACAAAA:8 a=PEuY6KT_LNhKtP0K0mEA:9 a=gKO2Hq4RSVkA:10 a=UiCQ7L4-1S4A:10 a=hTZeC7Yk6K0A:10 a=frz4AuCg-hUA:10 From: To: Subject: cannot upload file via http Date: Thu, 18 Mar 2021 09:38:50 -0400 Message-ID: <02c101d71bfc$09a2ed20$1ce8c760$@videotron.ca> MIME-Version: 1.0 X-Mailer: Microsoft Outlook 16.0 Thread-Index: Adcb+738RBhS/dpESKCp+ScvHq4T7A== Content-language: en-us X-CMAE-Envelope: MS4wfHlU3wDJ+04hqkLR2wZEsl9y7zJpK1Us1pfqEmyQnn+O1F2tEM2Lpo/fY++sedjwIVucJjxMVDL73jrg6MrzMyvPehLgP98NKjHwzcFQ/8Gxu+wg+v9e RNU5s05+LmS8C5/U2xyjUb/mEl9iaAt8Ow5/8rNjo0oFFbwvUx58T80o11svdCzuQj2VL8kNADV6fw== X-Rspamd-Queue-Id: 4F1SmG5mcnz3hg2 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 70.80.0.72 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-3.40 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RWL_MAILSPIKE_VERYGOOD(0.00)[70.80.0.72:from]; FREEMAIL_FROM(0.00)[videotron.ca]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[videotron.ca]; RCPT_COUNT_ONE(0.00)[1]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCVD_IN_DNSWL_LOW(-0.10)[70.80.0.72:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_ALLOW(-0.20)[+ip4:70.80.0.72/30]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_NO_DN(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:70.80.0.0/18, country:CA]; MIME_TRACE(0.00)[0:+,1:+,2:~]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: 7bit X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 13:38:55 -0000 Hi I am trying and have been trying in multiple ways to be able to upload a file with php programming and http but for some reason it is not able to write. I know this because no write takes place. This could be with a wordpress or any content management system as well as my own php code. I went ahead and changed the user permissions to 755 and the ownership to www. What could be the problem? From owner-freebsd-questions@freebsd.org Thu Mar 18 15:33:07 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E210057A4F3 for ; Thu, 18 Mar 2021 15:33:07 +0000 (UTC) (envelope-from byrnejb@harte-lyne.ca) Received: from mx32.harte-lyne.ca (mx32.harte-lyne.ca [216.185.71.32]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mx32.harte-lyne.ca", Issuer "CA_HLL_ISSUER_2016" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1WJ31zDvz3rpg for ; Thu, 18 Mar 2021 15:33:06 +0000 (UTC) (envelope-from byrnejb@harte-lyne.ca) Received: from mx32.harte-lyne.ca (localhost [127.0.32.1]) by mx32.harte-lyne.ca (Postfix) with ESMTP id A828A3FE02; Thu, 18 Mar 2021 11:33:02 -0400 (EDT) X-Virus-Scanned: amavisd-new at harte-lyne.ca Received: from mx32.harte-lyne.ca ([127.0.32.1]) by mx32.harte-lyne.ca (mx32.harte-lyne.ca [127.0.32.1]) (amavisd-new, port 10024) with ESMTP id ZMFXjeGjDHcZ; Thu, 18 Mar 2021 11:33:00 -0400 (EDT) Received: from webmail.harte-lyne.ca (webmail.hamilton.harte-lyne.ca [216.185.71.106]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mx32.harte-lyne.ca (Postfix) with ESMTPSA id 2F6703FDF7; Thu, 18 Mar 2021 11:33:00 -0400 (EDT) Received: from 216.185.71.41 (SquirrelMail authenticated user byrnejb_hll) by webmail.harte-lyne.ca with HTTP; Thu, 18 Mar 2021 11:33:00 -0400 Message-ID: In-Reply-To: References: Date: Thu, 18 Mar 2021 11:33:00 -0400 Subject: Re: Repository availability and security updates for version 11 From: "James B. Byrne" To: "Guy Noir" Cc: freebsd-questions@freebsd.org Reply-To: byrnejb@harte-lyne.ca User-Agent: SquirrelMail/1.4.23 [SVN] MIME-Version: 1.0 Content-Type: text/plain;charset=iso-8859-1 Content-Transfer-Encoding: 8bit X-Priority: 3 (Normal) Importance: Normal X-Rspamd-Queue-Id: 4F1WJ31zDvz3rpg X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.70 / 15.00]; HAS_REPLYTO(0.00)[byrnejb@harte-lyne.ca]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:216.185.71.0/26]; REPLYTO_ADDR_EQ_FROM(0.00)[]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; RCVD_IN_DNSWL_MED(-0.20)[216.185.71.32:from]; RCPT_COUNT_TWO(0.00)[2]; HAS_X_PRIO_THREE(0.00)[3]; DKIM_TRACE(0.00)[harte-lyne.ca:+]; DMARC_POLICY_ALLOW(-0.50)[harte-lyne.ca,quarantine]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:12021, ipnet:216.185.64.0/20, country:CA]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_COUNT_FIVE(0.00)[5]; R_DKIM_ALLOW(-0.20)[harte-lyne.ca:s=dkim_hll]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DWL_DNSWL_LOW(-1.00)[harte-lyne.ca:dkim]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 15:33:07 -0000 On Wed, March 17, 2021 12:51, Guy Noir wrote: > Hello, > > I am working with a team to upgrade our infrastructure to version 12, > however I have a few questions about the EoL event in September for version > 11: > > > 1. How long after September 2020 will the version 11 repository remain > available? It will disappear withing days of eol, if not within hours. > 2. Does the FreeBSD team continue to provide security updates for > version 11 after the EoL in September? No. A possible solution to 1 is to create your own local repository and populate it using 'pkg fetch -a -o /path/to/local/repo/All' (man pkg-fetch). Fetch up to and including the EoL date and then stop. You will have all the packages that were available to 11 at its EoL in /path/to/local/repo/All/. You can use pkg repo (man pkg-repo) to create the pkg infrastructure in /path/to/local/repo/. A configuration file (local.conf) for the repo needs to be created and placed in /usr/local/etc/pkg/repos/. If you are delivering to other systems via http(s) then naturally you will need an httpd service running on your repo host. There are threads discussing this on the forums at freebsd.org. An alternative is to setup a host as a Poudriere build system and build packages using a FreeBSD-11 jail (man poudriere-create). Again, you will need to cutoff source updates when the EoL arrives or Poudriere will happily try to build packages that cannot succeed on an older architecture. I have used this method to recreate packages for 10.3 from sources pulled from svn as of a specific date, but it was not a pleasant experience. -- *** e-Mail is NOT a SECURE channel *** Do NOT transmit sensitive data via e-Mail Unencrypted messages have no legal claim to privacy Do NOT open attachments nor follow links sent by e-Mail James B. Byrne mailto:ByrneJB@Harte-Lyne.ca Harte & Lyne Limited http://www.harte-lyne.ca 9 Brockley Drive vox: +1 905 561 1241 Hamilton, Ontario fax: +1 905 561 0757 Canada L8E 3C3 From owner-freebsd-questions@freebsd.org Thu Mar 18 16:52:22 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2D5D057CB90 for ; Thu, 18 Mar 2021 16:52:22 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pl1-x634.google.com (mail-pl1-x634.google.com [IPv6:2607:f8b0:4864:20::634]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1Y3T3yxtz4RHb for ; Thu, 18 Mar 2021 16:52:21 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pl1-x634.google.com with SMTP id f17so1596086plr.0 for ; Thu, 18 Mar 2021 09:52:21 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:in-reply-to:references:mime-version :content-transfer-encoding; bh=hisyT16MNmLPwd0RdounoWLd/JgKDl8FoEf4H0vK5zQ=; b=lXVkLD2Id3o1ZImdEz5LyiFsGBpYNq1MtgktlS07XxYGb/Yiv22oJYjCloCNEwYyT2 K2gfTCDPI7S1sHnsfQsb+PvXpaOssm3QWYmHfMD0eH2lXzeHrRqAglRvcxMnnKJu2NXS AE3L5IrnqURtNkEOrgadaZ3NHh5fquT5660XNi2owqfjSwqxsjQL7x8RhpotT5B2OZUT l5LurJH2SDVAJ+xeMcfr6vnHgLzQIUIT+C98/plQwlcdHw/EBzzpXKL3vjXZqNgcLZSA fpLQqUTLVjIG/xgt/zm5+OFRd8BNe3Ey11DyXoFW7Kuxrz88vxXofCTVWx3tffrOaqUX j1ww== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=hisyT16MNmLPwd0RdounoWLd/JgKDl8FoEf4H0vK5zQ=; b=GpG7hcDl+b/sJ8+aXl60eSw1gpfaQ1WjNTsXqFrUFeJnuF1L/i/gmlRgfbFheQUIQC FwisPGp7q7q668gerDCst3iF51SaF5wr9pVpTeaSyap9388/08dQOgWSHl4e/3VW3khj 1UPyQo3KRn/hnyPAb0aIv6bSFO42qFGKEPHXAkbOYhL/O1CXeUTirgZI4ScjfACELrq3 mNJbAnSL+n7pTQkyTqACJoCDpl4Lva6yPMwxt3n57Ff8+H9hK2ibQ4G4diJtLCPp5seY JW0Ns2rKrX7BBPohCLpzr4YJO9/8+odz3JfGIrCTpP1qk3V/6LAOzkgPH0NZzd6zRcFa ktuA== X-Gm-Message-State: AOAM531URB6IMv1mz1xbGXuLZuglPDClNW1eXOvNL9Nz7TyzD3K2Cw96 mRF7jYtkVW1gE+8NitHaTsh/2g86qmUsypd4 X-Google-Smtp-Source: ABdhPJyqGmUcBKssF5cqB2CtpMJgDQxsPc0f4JzM3Q/KGq8PdFEmCKNc+XuijehNxefrLPNxIad3PQ== X-Received: by 2002:a17:903:228c:b029:e6:4c7e:1cbc with SMTP id b12-20020a170903228cb02900e64c7e1cbcmr10539140plh.38.1616086339782; Thu, 18 Mar 2021 09:52:19 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id w15sm2898953pfn.84.2021.03.18.09.52.18 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 18 Mar 2021 09:52:18 -0700 (PDT) Date: Thu, 18 Mar 2021 10:52:17 -0600 From: Duke Normandin To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210318105217.ab390407698e001ae86b5935@gmail.com> In-Reply-To: <933C2C35-16CB-4B3E-A2FF-781CDAAC62C2@riseup.net> References: <20210317213615.7e1443af@antix1> <933C2C35-16CB-4B3E-A2FF-781CDAAC62C2@riseup.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1Y3T3yxtz4RHb X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=lXVkLD2I; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::634 as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::634:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::634:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::634:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 16:52:22 -0000 On Thu, 18 Mar 2021 09:10:03 +0100 Ralf Mardorf wrote: > > > On 18 Mar 2021, at 06:40, Kevin Oberman wrote: > > .I would strongly recommend partitioning as GPT. > > Hi, > > why? There's no reason to use UEFI for a Linux and FreeBSD dual-boot. Or does FreeBSD enforce UEFI nowadays? Full address access of a 1 (and even a 2) TiB drive works with MBR. If the computer gets borked and you urgently need access to data on a weekend, when all stores are closed, let alone Corona lockdowns, it's possible to use the drive with any old hardware providing the right bus interface lying around. AFAIK this is something you can't do when using GPT, since not all BIOS' support GPT. Good point. Thx!! This ASUS laptop of mine WAS a windoze 7/10 box - off-the-shelf. Got fed up with with the OS BS. ;) According to the BIOS, it does support UEFI, but isn't that yet another Windoze thing that everybody is forced to live with? To my knowledge and non-professional experience dating back to 1981, I've never had a problem with MBR-based boxes. Thx for the input!! -- Duke From owner-freebsd-questions@freebsd.org Thu Mar 18 16:59:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E073A57D0A4 for ; Thu, 18 Mar 2021 16:59:06 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pj1-x1034.google.com (mail-pj1-x1034.google.com [IPv6:2607:f8b0:4864:20::1034]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1YCG1Khpz4S31 for ; Thu, 18 Mar 2021 16:59:06 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pj1-x1034.google.com with SMTP id mz6-20020a17090b3786b02900c16cb41d63so3457254pjb.2 for ; Thu, 18 Mar 2021 09:59:05 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:in-reply-to:references:mime-version :content-transfer-encoding; bh=hK0oUkEwboRK4kzwSlMDsK/tHJG+PNUhpeOsUtEvtIs=; b=PZ4ICzMJQJOkiRDNSomvrnLTSwoe7/x8z2cQSa0HvyoOLz7Oz6SawkRsTI9CfrqKL/ 4zGp9VlzwYyGZgPNGKxLfNNL3Y7CxBiorwO4/Igm4yLqxFL9dmf9qFBNsFdJ95ric8Bp tYHC2Xub7fZE6aM+y5za2vImWhPtrB+1xJmIpUvaDEb8uqJUuAMSrNNSoaVH8gSZDlCw 3mHjKI8ds4/w/RXK8LENx8Dh7p0fX5PWJCZG8U16uyp9oElkbHn7ZT/o6rSuqPW/uN12 ZexORYNAHr7fTKHNg4E5xzJe161ANMcS6W3Wl1pcfN38hxnq0ygu7Rk44CBlQuPFbJ/X sV6g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=hK0oUkEwboRK4kzwSlMDsK/tHJG+PNUhpeOsUtEvtIs=; b=rHCB2YcVYN+h4bz3VZxp3kQXWCTt9gbYRZR5sxOcTw47rehm/FotgsQ0k3QtFAJtO3 5cIJT47nLUI8R7S8OhWb4kPUlKqCKGEhQf+HQV25cQPK7SEmdyu3PP4vdzIDtFPxJ0wV b0qGMHgdYlTCGrebs310YiXTCax6ahWB0qwgSDDdxLNQCwQ8tPK26G8GmL13Cx34Q+w4 5zNVItwrpwl7jAVN/SjksEp4UFPGxSF/sw805d328i66GUXDpwedOs6Cr+ZqxSN5cA24 lvFhIu0cemK8WKg9tfuIgHLk8hHnauva7TMaB45QgURKd+EPMTkkcQhTAX4W8nwyPK86 1ZTQ== X-Gm-Message-State: AOAM530cLKgAB+m1iZMWUjGFd4WHVXJxbEGlmkcomhlYHWVohOWTWsAI +M4tw2F3yu7H1KWGfa50z3B42ycMk+9V9Sp2 X-Google-Smtp-Source: ABdhPJw7a6eerhmdElm51Jb27S7gxSItdqVBODqe3PlTlIOXvAKNPuRhk6ZFMbC7QpaBakBGtDY4iw== X-Received: by 2002:a17:90a:8a8b:: with SMTP id x11mr5297411pjn.151.1616086744349; Thu, 18 Mar 2021 09:59:04 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id j26sm2906378pfa.35.2021.03.18.09.59.03 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 18 Mar 2021 09:59:04 -0700 (PDT) Date: Thu, 18 Mar 2021 10:59:02 -0600 From: Duke Normandin To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> In-Reply-To: References: <20210317213615.7e1443af@antix1> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1YCG1Khpz4S31 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=PZ4ICzMJ; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::1034 as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-0.998]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::1034:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::1034:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::1034:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 16:59:06 -0000 On Wed, 17 Mar 2021 22:40:27 -0700 Kevin Oberman wrote: > On Wed, Mar 17, 2021 at 8:36 PM Duke Normandin > wrote: > [snip] > FreeBSD defaults to putting everything in one partition. There is no > requirement for more than one. Good to know! But what if I want to dual-boot a Linux distro as well? Do I allow space for it beforehand, i.e while I'm partitioning for FreeBSD? OR do I shrink the FreeBSD partition while trying to install the Linux distro? -- Duke From owner-freebsd-questions@freebsd.org Thu Mar 18 17:14:21 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 46BA657D752 for ; Thu, 18 Mar 2021 17:14:21 +0000 (UTC) (envelope-from freebsd-questions-local@be-well.ilk.org) Received: from be-well.ilk.org (be-well.ilk.org [23.30.133.173]) by mx1.freebsd.org (Postfix) with ESMTP id 4F1YXr3D4dz4TBR for ; Thu, 18 Mar 2021 17:14:20 +0000 (UTC) (envelope-from freebsd-questions-local@be-well.ilk.org) Received: from lowell-desk.be-well.ilk.org (router.lan [172.30.250.2]) by be-well.ilk.org (Postfix) with ESMTP id 1DA4B33C0A; Thu, 18 Mar 2021 13:14:09 -0400 (EDT) Received: by lowell-desk.be-well.ilk.org (Postfix, from userid 1147) id 79D6B176BC0C; Thu, 18 Mar 2021 13:14:07 -0400 (EDT) From: Lowell Gilbert To: Duke Normandin Cc: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD References: <20210317213615.7e1443af@antix1> <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> Date: Thu, 18 Mar 2021 13:14:07 -0400 In-Reply-To: <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> (Duke Normandin's message of "Thu, 18 Mar 2021 10:59:02 -0600") Message-ID: <44czvwgza8.fsf@be-well.ilk.org> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/27.1 (berkeley-unix) MIME-Version: 1.0 Content-Type: text/plain X-Rspamd-Queue-Id: 4F1YXr3D4dz4TBR X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of freebsd-questions-local@be-well.ilk.org has no SPF policy when checking 23.30.133.173) smtp.mailfrom=freebsd-questions-local@be-well.ilk.org X-Spamd-Result: default: False [-2.00 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[ilk.org]; AUTH_NA(1.00)[]; SPAMHAUS_ZRD(0.00)[23.30.133.173:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[23.30.133.173:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7922, ipnet:23.30.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 17:14:21 -0000 Duke Normandin writes: > On Wed, 17 Mar 2021 22:40:27 -0700 > Kevin Oberman wrote: > >> FreeBSD defaults to putting everything in one partition. There is no >> requirement for more than one. > > Good to know! But what if I want to dual-boot a Linux distro as well? > Do I allow space for it beforehand, i.e while I'm partitioning for > FreeBSD? OR do I shrink the FreeBSD partition while trying to install > the Linux distro? Just leave it unused for now. There's no need to complicate things. From owner-freebsd-questions@freebsd.org Thu Mar 18 17:18:55 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 92F4F57DC3A for ; Thu, 18 Mar 2021 17:18:55 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1Yf64PhXz4T8x for ; Thu, 18 Mar 2021 17:18:54 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from fews1.riseup.net (fews1-pn.riseup.net [10.0.1.83]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F1Yf42zJqzDqrC for ; Thu, 18 Mar 2021 10:18:52 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616087932; bh=kVTmZP0S1D35/IciMzLrJotaaBfSSo3uW/IFf874b0I=; h=Date:From:To:Subject:In-Reply-To:References:From; b=gwaLYfEZomJfOUut4MrlB0ugMF8tVA3ckmmkqdOxPttWe+zBtkXvNmPqNphVyqDC3 lNX7n6v7JS4sjyb6eJhkldwDf2Vo602ni71A74M9QLGU38X76+h9YI9vcmGj6mwUFt H/PH9yHPSUiSizJGUUUem2wFT2tfiLC+RrtZlyco= X-Riseup-User-ID: F9D2E7FF541A11212748114BE0F48572139AEA8A3953ABF131AB17273B75D4AE Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews1.riseup.net (Postfix) with ESMTPSA id 4F1Yf35ryBz5wGF for ; Thu, 18 Mar 2021 10:18:51 -0700 (PDT) Date: Thu, 18 Mar 2021 18:18:46 +0100 From: Ralf Mardorf To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-ID: <20210318181846.3e8fc6b3@archlinux> In-Reply-To: <20210317213615.7e1443af@antix1> References: <20210317213615.7e1443af@antix1> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1Yf64PhXz4T8x X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=gwaLYfEZ; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of ralf-mardorf@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=ralf-mardorf@riseup.net X-Spamd-Result: default: False [-4.60 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 17:18:55 -0000 On Wed, 17 Mar 2021 21:36:15 -0600, Duke Normandin wrote: >2 equal Primary partitions? Since there are strong opinions related to limitations of MBR, a bootable Linux doesn't need a primary partition at all. It can be installed on an extended partition, too. However, you might want to use three partitions, one for FreeBSD another for Linux and a third for a Linux swap. Actually there's no need to use a Linux swap partition, a swap file can be used, too. For Linux I'm in favour for everything in one partition, excepted of the swap. You didn't ask for a Linux multi-boot, since when using the syslinux bootloader without chainloading, the kernels of all Linux installs need to be on one partition. In a nutshell, assuming 1 FreeBSD install and 1 Linux install, I would go for 3 MBR partitions, assuming ext4 for Linux. Note, a lot of people claim to be satisfied with using ZFS on Linux, too. I'm not taking this path. If you consider to do so, also consider to care about hints such as "Warning: Do not run zpool import pool! This will import your pools using /dev/sd? which will lead to problems the next time you rearrange your drives. This may be as simple as rebooting with a USB drive left in the machine." - https://wiki.archlinux.org/index.php/ZFS#Importing_a_pool_created_by_id "Your boot time can be significantly impacted if you update your intitramfs (eg when doing a kernel update) when you have additional but non-permanently attached pools imported because these pools will get added to your initramfs zpool.cache and ZFS will attempt to import these extra pools on every boot, regardless of whether you have exported it and removed it from your regular zpool.cache." - https://wiki.archlinux.org/index.php/ZFS#Fix_slow_boot_caused_by_failed_import_of_unavailable_pools_in_the_initramfs_zpool.cache From owner-freebsd-questions@freebsd.org Thu Mar 18 17:25:52 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id D057957DFD5 for ; Thu, 18 Mar 2021 17:25:52 +0000 (UTC) (envelope-from pprocacci@gmail.com) Received: from mail-pg1-x532.google.com (mail-pg1-x532.google.com [IPv6:2607:f8b0:4864:20::532]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1Yp81f75z4V1j for ; Thu, 18 Mar 2021 17:25:51 +0000 (UTC) (envelope-from pprocacci@gmail.com) Received: by mail-pg1-x532.google.com with SMTP id e33so1889391pgm.13 for ; Thu, 18 Mar 2021 10:25:51 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=D34XmF82LI7dnyy9IzvAt5DLOzeKZcV61MlwRrJ0b8I=; b=B1HmC4Z48IxNet0ZkMBjOV0mXx9eZ4oJsHUly7CuKJ6uUbjOzF2T6BDZ4suJxTDIfH 6Pmd8K3BlRUv9aPNmWZr2FVGJf27sNqGOIjCwzeOx4t3aFiIFOIj6txUUdb/wGZI+91u c0BoHyQCO/gywhuz/JBRItZkfz/7G9xpXT5EGz8NSKbzJr9r/awYEQXVZvj6/RcoNNQI OLRRC65ojiua8MuLqLMEVPQJpkWtqOXDC6RDUqMVKu7VlTdqX8wZFJlKUpfvoio6+qy+ zyEMlIR45AEvzvWb000rQlWXjzk5Z1MGJbW8zNr+QcpuIbXF8fWD4sFt9CRv9dXoiLVj 3acg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=D34XmF82LI7dnyy9IzvAt5DLOzeKZcV61MlwRrJ0b8I=; b=BVVRmbeOXSkko3ftu/eCVxsdQxB2MuWCqCvtmpdDhir0utfKh7tgPp9OFc677kCdVe aC2vYRig2HP9cxewJyCuIQQmoOxgwrkVk1FQEqF/7mJm92OggxauGVIp9O6CDZKOV8Lv vRf/9REaCrMxDfSNEPTvNHm0azS/dJ6PQ9pCOCcRKIUwSrDTGH28wHI1qGqvR+MoXf+9 gWVtLexpIuc4SrWt3RpDCVHpwtto9BimQ6HSPP/RAYOLzFeAiceQoqFfd9X2e/sSMenB 32M2BlIqHmN6uAH3umA627F8nZaiN6JBQkRQAw075FUIQrloGyU5w5WsxRLV+kwSAByG tdyw== X-Gm-Message-State: AOAM532lrABt19JT04U4gFA4XS47Bi7UzlPVR29ZCfsYsta/IVpVbE88 skzSgI+sHo/PqeQU01tw5Up8clBuOCzKxUp/sfCvcXdIKBZJ X-Google-Smtp-Source: ABdhPJyvCd08kI5zJYLX0MN2fZof1IkU1RFx5mIZJsfHmhrD0jfdpnj4wCOnSVkF1650/fFstmqMxVCDYZMKpJAWmX8= X-Received: by 2002:a05:6a00:ac8:b029:1ed:f8dc:cb3b with SMTP id c8-20020a056a000ac8b02901edf8dccb3bmr5094928pfl.60.1616088349320; Thu, 18 Mar 2021 10:25:49 -0700 (PDT) MIME-Version: 1.0 References: <02c101d71bfc$09a2ed20$1ce8c760$@videotron.ca> In-Reply-To: <02c101d71bfc$09a2ed20$1ce8c760$@videotron.ca> From: Paul Procacci Date: Thu, 18 Mar 2021 13:25:34 -0400 Message-ID: Subject: Re: cannot upload file via http To: pkagan@videotron.ca Cc: FreeBSD Questions X-Rspamd-Queue-Id: 4F1Yp81f75z4V1j X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=B1HmC4Z4; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of pprocacci@gmail.com designates 2607:f8b0:4864:20::532 as permitted sender) smtp.mailfrom=pprocacci@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[videotron.ca]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::532:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::532:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::532:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 17:25:52 -0000 This question isn't suitable for the FreeBSD mailing list as this isn't a FreeBSD problem. With that said, you must ensure all the directories leading up to the directory you want to place the file in has the execute bit set so that the user running as the web server has the ability to traverse the file system. Not just the primary directory where the file will end up. An example of what I mean: root@nas:~ # find /tmp/test -type d -ls 101190 1 drwx------ 3 root wheel 3 Mar 18 13:20 /tmp/test 101327 1 drwxrwxrwx 2 root wheel 2 Mar 18 13:20 /tmp/test/this % touch /tmp/test/this/ touch: /tmp/test/this/: Permission denied This advice is `blind` in a sense because there is no error message that you actually provided. Perhaps it boils down to the write actually taking place, yet happens in a location you aren't expecting. In cases like this, and in the case of FreeBSD you can truss(1) the web server process and figure out exactly what it's doing. ~Paul On Thu, Mar 18, 2021 at 9:39 AM wrote: > Hi I am trying and have been trying in multiple ways to be able to upload a > file with php programming and http but for some reason it is not able to > write. I know this because no write takes place. This could be with a > wordpress or any content management system as well as my own php code. I > went ahead and changed the user permissions to 755 and the ownership to > www. > What could be the problem? > > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > -- __________________ :(){ :|:& };: From owner-freebsd-questions@freebsd.org Thu Mar 18 18:07:54 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8078A57F2EC for ; Thu, 18 Mar 2021 18:07:54 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pj1-x102e.google.com (mail-pj1-x102e.google.com [IPv6:2607:f8b0:4864:20::102e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1Zkd4npbz4Xfk for ; Thu, 18 Mar 2021 18:07:53 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pj1-x102e.google.com with SMTP id j6-20020a17090adc86b02900cbfe6f2c96so3557149pjv.1 for ; Thu, 18 Mar 2021 11:07:53 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:cc:subject:message-id:in-reply-to:references :mime-version:content-transfer-encoding; bh=3WaATwVvJ7ol4e0/FQ5Van/3KC4OQjb+OCHkAktnQDQ=; b=qkrXwH+lwDzDy6/cu8z6nQrnGM5RjE3vXrDhSzxSRcKIhdP6hf+i6n8dXo2QiBDVCk wtr4eBIxZq6uIQAjwgLRmnZ7zaKN9DC4yOboJLbrBYdBpQQA/jVkNdSM7MwycM8T5zPq OjGzBd0FiYj6ThPGoX3LMLMp1yrXb2y6VggXi4ab/G7zR4/Fz8xPJ9VvhvgX67zOFPVV KINa/BtYpCZSMe6XH30sULpIXUzR79mpg8FuCtW5/DOG9+73StzFy0RebtySlcsQaq1k CSeRAFPCuXlxMbyDE/2cS8GyxChu0oUZD5Z2l3TAMulHP9wwcuCR4Bj1lZWtwUStOq0+ 9vhQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:cc:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=3WaATwVvJ7ol4e0/FQ5Van/3KC4OQjb+OCHkAktnQDQ=; b=OlIPwf300+1L/fs22zCbEIDT/GSli8ZBgRkZ9GQYZTtfg9iXyWlndr9HQdZuTyBWEG xGEqyFTd3bJdHHiio71vAxwFQ91UOzMh2Yl2bnMTSzEEGPaWX5dBz4bzJO86W8AqK0kr +DQQLNyPWhBizVRSDXzemMrIr7LQBsYkFHDIPg5bOdRfWYIJvmZOoriYGrvjyE7aNwTn kcxMsOdn+Dn2o/lGxK3n3teuLQsIDj3tOpgcqQ+nYQZTaAc7XqjL10lBRx3Uwry/lycx +nx6xCKg3shpmQpsunJlq9sgwpKK6zRbdcH4lRPfCVvIG/BcXWswiCqju1U7GCJGEjAc nocA== X-Gm-Message-State: AOAM531Nwqy8SgY/Zxvubcxg9DVJ9HWqYV1bMp1t5kE0qH2LmeDAzCXe hw5z1Tj7yca7wv0OAmCzPKutTRWlrXUp8Bta X-Google-Smtp-Source: ABdhPJw87Rkqq+x3fUjgeNrp2pH3N3+Dh2nD7YIfFWJF4a4P8GDN1HuMad9W0BlWzBSlTEqtIg0nZQ== X-Received: by 2002:a17:90a:f298:: with SMTP id fs24mr5708842pjb.57.1616090872510; Thu, 18 Mar 2021 11:07:52 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id q10sm2713789pgs.44.2021.03.18.11.07.51 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 18 Mar 2021 11:07:52 -0700 (PDT) Date: Thu, 18 Mar 2021 12:07:51 -0600 From: Duke Normandin To: Lowell Gilbert Cc: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210318120751.23e1e2f565e2face195d9d73@gmail.com> In-Reply-To: <44czvwgza8.fsf@be-well.ilk.org> References: <20210317213615.7e1443af@antix1> <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> <44czvwgza8.fsf@be-well.ilk.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1Zkd4npbz4Xfk X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=qkrXwH+l; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::102e as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; MV_CASE(0.50)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::102e:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::102e:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::102e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 18:07:54 -0000 On Thu, 18 Mar 2021 13:14:07 -0400 Lowell Gilbert wrote: > Duke Normandin writes: > > > On Wed, 17 Mar 2021 22:40:27 -0700 > > Kevin Oberman wrote: > > > >> FreeBSD defaults to putting everything in one partition. There is no > >> requirement for more than one. > > > > Good to know! But what if I want to dual-boot a Linux distro as well? > > Do I allow space for it beforehand, i.e while I'm partitioning for > > FreeBSD? OR do I shrink the FreeBSD partition while trying to install > > the Linux distro? > > Just leave it unused for now. There's no need to complicate things. Will do!! Much obliged! -- Duke From owner-freebsd-questions@freebsd.org Thu Mar 18 20:00:39 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2A21D5AACB1 for ; Thu, 18 Mar 2021 20:00:39 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-oo1-xc2c.google.com (mail-oo1-xc2c.google.com [IPv6:2607:f8b0:4864:20::c2c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1dDk1LZ5z4gFF for ; Thu, 18 Mar 2021 20:00:37 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: by mail-oo1-xc2c.google.com with SMTP id c12-20020a4ae24c0000b02901bad05f40e4so1737115oot.4 for ; Thu, 18 Mar 2021 13:00:37 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=4wu1felxwbkvez8xYakMlcM1ZK0IR1115MaxvGslOxc=; b=L0IGL1uNtTIdhonvzrr4TepA2MBcEfO9JsmdQ8gU1AIC5h6WBhiYsSU80Rj7dUlyah MPgJ68AgTjXwiqrcyWZhjzKA35M6b9QqE6JB13mF/266d541+IcAYqNGAiNXkGoJYqrG SYDK+Mv8bPmRhZIE+YUpGorDkn6WWsZLw/Q8VWN5qZf6Wrh1c95g5ET6Gw8H+zbqcfo2 uNHpT+/jackqwtUkZfSRRk7QSst/qmKQQRMNtkqhBwZB15UcCdvBrNsfv/m+OXze1rGL wt1QEPFCqhHNITz1YAF2NxxlJ1ZG0kTDyBak5GyV7j2zs5IGq87n1R78I6XrCv4c8X5d BShg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=4wu1felxwbkvez8xYakMlcM1ZK0IR1115MaxvGslOxc=; b=J552k4p0+fNBCySzvP4PDu+9LgN3stSetZL037M+wznMx0sag+aFwgE+WhVEV319sS TJvOZD3j5BvU773/A/Cuudo0YYFvhake2Hxv2UPFkN/NspAxp3kG1AXPg7KCo5mnTS0S IXn45CNtrtyp/flMGdTzJkvd3cjxOIlJ0pCRiKn9zpzRZ/3ARLAsdF7HyCo2dos5HS5E RX8boMIpHXbHQp+DwT3UKBCUJ2eUVdlCqKm1+C88oH+tEF2SbAPpUbL7Zy9l4CSMloYa 8Pyl9bcjtKtE4gtWC4jGcxU6JcOqrJe4d50MfLqwz9JU81wMuKJw0U2YdGukegMzxLIi ziBg== X-Gm-Message-State: AOAM532sMDnRWf5Hko9TOGTl6J1HR70Hf9iHvJuNGAFid742CtMH4hLi JtAFHcOpQBMfh5n0of9MON8QUGL+sRCt6YbmRn8= X-Google-Smtp-Source: ABdhPJxSpxmDLT1/byKdLVX4qanecUU1gTW36b2jGQ75xf4I33WEi598kWB9iaAVJ2m1ZV8rog2HfHv9uUEieHBa1h4= X-Received: by 2002:a4a:be86:: with SMTP id o6mr8891597oop.70.1616097636835; Thu, 18 Mar 2021 13:00:36 -0700 (PDT) MIME-Version: 1.0 References: <20210317213615.7e1443af@antix1> <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> <44czvwgza8.fsf@be-well.ilk.org> <20210318120751.23e1e2f565e2face195d9d73@gmail.com> In-Reply-To: <20210318120751.23e1e2f565e2face195d9d73@gmail.com> From: Kevin Oberman Date: Thu, 18 Mar 2021 13:00:20 -0700 Message-ID: Subject: Re: Partitioning 1T HDD To: Duke Normandin Cc: Lowell Gilbert , "freebsd-questions@freebsd.org" X-Rspamd-Queue-Id: 4F1dDk1LZ5z4gFF X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=L0IGL1uN; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kob6558@gmail.com designates 2607:f8b0:4864:20::c2c as permitted sender) smtp.mailfrom=kob6558@gmail.com X-Spamd-Result: default: False [-3.70 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[rkoberman@gmail.com,kob6558@gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[rkoberman@gmail.com,kob6558@gmail.com]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::c2c:from]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::c2c:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::c2c:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 20:00:39 -0000 I'd like to point out the GPT works for either MBR or EFI booting. My old laptop had broken EFI support, so had to be MBR, but the partitioning was GPT which is far easier to use and manage. It is likely true that EFI requires GPT, but MBR does not. I'm not even positive about EFI requirements, but it does need more partitions, so using it without GPT would be, at best, awkward. -- Kevin Oberman, Part time kid herder and retired Network Engineer E-mail: rkoberman@gmail.com PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 On Thu, Mar 18, 2021 at 11:08 AM Duke Normandin wrote: > On Thu, 18 Mar 2021 13:14:07 -0400 > Lowell Gilbert wrote: > > > Duke Normandin writes: > > > > > On Wed, 17 Mar 2021 22:40:27 -0700 > > > Kevin Oberman wrote: > > > > > >> FreeBSD defaults to putting everything in one partition. There is no > > >> requirement for more than one. > > > > > > Good to know! But what if I want to dual-boot a Linux distro as well? > > > Do I allow space for it beforehand, i.e while I'm partitioning for > > > FreeBSD? OR do I shrink the FreeBSD partition while trying to install > > > the Linux distro? > > > > Just leave it unused for now. There's no need to complicate things. > > Will do!! Much obliged! > -- > Duke > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Thu Mar 18 20:10:45 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C8DD15AB7D3 for ; Thu, 18 Mar 2021 20:10:45 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt41.smtp-out.videotron.ca (alt41.smtp-out.videotron.ca [23.233.128.28]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1dSN6GlCz4hTk for ; Thu, 18 Mar 2021 20:10:44 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [192.168.1.20] ([173.176.219.200]) by Videotron with SMTP id MyyfllFMHbSemMyyhl7L2T; Thu, 18 Mar 2021 16:10:43 -0400 X-Authority-Analysis: v=2.3 cv=COhUoijD c=1 sm=1 tr=0 a=oaKXazPqqAQRKKEMLXbeDQ==:117 a=oaKXazPqqAQRKKEMLXbeDQ==:17 a=pGLkceISAAAA:8 a=aE0cJvjpAAAA:8 a=6I5d2MoRAAAA:8 a=Sm-718XjqODxzBf6sCAA:9 a=QEXdDO2ut3YA:10 a=bvjMhJzLnbMMivruDs4A:9 a=IYLoui_MP1wx5Suy:21 a=_W_S_7VecoQA:10 a=y-4rJCg2yiSUOuYm88t7:22 a=IjZwj45LgO3ly-622nXo:22 From: Paul Mime-Version: 1.0 (1.0) Subject: Re: cannot upload file via http Date: Thu, 18 Mar 2021 16:10:41 -0400 Message-Id: <2B2FAC62-8B7D-4682-BDD0-B2C1491625A5@videotron.ca> References: Cc: FreeBSD Questions In-Reply-To: To: Paul Procacci X-Mailer: iPad Mail (18D52) X-CMAE-Envelope: MS4wfCE80rBMelFWGo+KHiGxgB4ikMANSYOdhmNo7sEF6ASftmt+eMZ2ztIWz7nA55Hp66r+nX8MPoOlXE642dLZVqLal2ezLN6rEK0VCuYLSWIux8j7LJYc URjSXJzlqSduDxKWI9A8nrLpPXVGp8TffnnXSTufAekyM0+ngesHdF4n4JIZ1rkplUtratFaGfLcKfQznJjqNQ9clVNgy12nBQb9EK8kHZTxSmrIkwuOwmVR X-Rspamd-Queue-Id: 4F1dSN6GlCz4hTk X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 23.233.128.28 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; FREEMAIL_FROM(0.00)[videotron.ca]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:23.233.128.28/30]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-0.995]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[gmail.com]; RCVD_IN_DNSWL_LOW(-0.10)[23.233.128.28:from]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; MIME_TRACE(0.00)[0:+,1:+,2:~]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:5769, ipnet:23.233.128.0/18, country:CA]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[23.233.128.28:from]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[23.233.128.28:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 18 Mar 2021 20:10:45 -0000 It does not work I set the permissions to 777 for document root and it does n= ot work. The owner is www. I wish to be able to upload a file , it worked at= 1 time not sure why it no longer works on several websites. It=E2=80=99s us= eful for wordpress or like if I just want to be able to upload a document. Envoy=C3=A9 de mon iPad > Le 18 mars 2021 =C3=A0 13:25, Paul Procacci a =C3=A9= crit : >=20 > =EF=BB=BF > This question isn't suitable for the FreeBSD mailing list as this isn't a = FreeBSD problem. >=20 > With that said, you must ensure all the directories leading up to the dire= ctory you want to place the file in has the execute bit set so that the user= running as the web server has the ability to traverse the file system. > Not just the primary directory where the file will end up. >=20 > An example of what I mean: > root@nas:~ # find /tmp/test -type d -ls > 101190 1 drwx------ 3 root wheel = 3 Mar 18 13:20 /tmp/test > 101327 1 drwxrwxrwx 2 root wheel = 2 Mar 18 13:20 /tmp/test/this >=20 > % touch /tmp/test/this/ > touch: /tmp/test/this/: Permission denied >=20 > This advice is `blind` in a sense because there is no error message that y= ou actually provided. > Perhaps it boils down to the write actually taking place, yet happens in a= location you aren't expecting. > In cases like this, and in the case of FreeBSD you can truss(1) the web se= rver process and figure out exactly what it's doing. >=20 > ~Paul >=20 >> On Thu, Mar 18, 2021 at 9:39 AM wrote: >> Hi I am trying and have been trying in multiple ways to be able to upload= a >> file with php programming and http but for some reason it is not able to >> write. I know this because no write takes place. This could be with a >> wordpress or any content management system as well as my own php code. I >> went ahead and changed the user permissions to 755 and the ownership to w= ww. >> What could be the problem? >>=20 >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.o= rg" >=20 >=20 > --=20 > __________________ >=20 > :(){ :|:& };: From owner-freebsd-questions@freebsd.org Fri Mar 19 00:51:10 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A86D85B2607 for ; Fri, 19 Mar 2021 00:51:10 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pj1-x1034.google.com (mail-pj1-x1034.google.com [IPv6:2607:f8b0:4864:20::1034]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1lgx6Dsbz3GPs for ; Fri, 19 Mar 2021 00:51:09 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pj1-x1034.google.com with SMTP id k23-20020a17090a5917b02901043e35ad4aso5836309pji.3 for ; Thu, 18 Mar 2021 17:51:09 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:cc:subject:message-id:in-reply-to:references :mime-version:content-transfer-encoding; bh=OSWpGXkRBbRD9X0BbMhpmGruPoitgygDTmQC3ZQKdLI=; b=Vqg6H3R/HGvkm4s2iVSoAQ5M5BmwzmdK5OOZhQMAvKGQt4vS2irFS+M4GYMDhdS+Qw dygHlEL3Jb2GOlh0e7d2VPs32q1tWEt3aFVFUKOCKJotYSINE4k2OuUzm6azaZqFLedv afq7yF4jN6QHlTYLNSTPpA/8fpCCG7XmX6XAsCA7sDgMB7FON6CzmUDub34z+v5OZbwg aAhmLj6leUq11cjfMcV4NHmv5HuPzr8DyUI8rS9fMxlbYNWcpji0TW227A8sDE7soom5 T52XSm1BImxBkvkimx7nfU+n4YOsl8SISWsHjRVtIUNA/YapGqv6rrReCnt8GyDtFRgM OSOg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:cc:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=OSWpGXkRBbRD9X0BbMhpmGruPoitgygDTmQC3ZQKdLI=; b=CV266ECoFmvqPzJGxhTZfcXIF6fmeMGF5uO0ld1f893rOvKCRGsg7AwU608JHqpn81 p4C+7I6foVMbB6Ck+m51J4bziMVApBauQeComqm7K1Ly5McSNcGgHCOomOuVHUUpwEJq gvVNPTuUJZd7d0tZStEFlL6eu8HQy5+pSUWfXn0vOq10IXc1JKV/4ChjdJlOjDGiZtzV sh7PeYysBQpSeEjYGlB3QTEfOBGwyNDniAKC1R3Wa4AjykXj1qn8m2+Oenkd4lh+Hvg4 /rDRhwKj2DwOQGNs4R7erMEdkbNGCI0CxRiyzl8StBitsc15yYoWR87J8Aw56WFgwjD1 repg== X-Gm-Message-State: AOAM532eYuyrCW/bqE1dCI6GvE5Cb4rUrbqg6FqQli6I4qpMe03AbpI6 32r6SGDW3nITp/1f7xmx/Bk= X-Google-Smtp-Source: ABdhPJxxiVAhkHna9liIbTKBL7LkdLGfIWI060TlR8kkQ8nstPX0GL7Ulns7Dua+Jy/bEd9wFnwQhQ== X-Received: by 2002:a17:90a:ce0d:: with SMTP id f13mr6950404pju.85.1616115068186; Thu, 18 Mar 2021 17:51:08 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id h14sm3300832pjc.37.2021.03.18.17.51.07 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 18 Mar 2021 17:51:07 -0700 (PDT) Date: Thu, 18 Mar 2021 18:51:06 -0600 From: Duke Normandin To: Kevin Oberman Cc: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210318185106.82ace6b0a2e6d3b78ecc890f@gmail.com> In-Reply-To: References: <20210317213615.7e1443af@antix1> <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> <44czvwgza8.fsf@be-well.ilk.org> <20210318120751.23e1e2f565e2face195d9d73@gmail.com> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F1lgx6Dsbz3GPs X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=Vqg6H3R/; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::1034 as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::1034:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::1034:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::1034:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 00:51:10 -0000 On Thu, 18 Mar 2021 13:00:20 -0700 Kevin Oberman wrote: > I'd like to point out the GPT works for either MBR or EFI booting. My old > laptop had broken EFI support, so had to be MBR, but the partitioning was > GPT which is far easier to use and manage. It is likely true that EFI > requires GPT, but MBR does not. I'm not even positive about EFI > requirements, but it does need more partitions, so using it without GPT > would be, at best, awkward. Thanks for fleshing out the answer to my questions. Are you talking about using GPT rather than fdisk/cfdisk? -- Duke Normandin From owner-freebsd-questions@freebsd.org Fri Mar 19 06:45:03 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 474675B9AF6 for ; Fri, 19 Mar 2021 06:45:03 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-ot1-x331.google.com (mail-ot1-x331.google.com [IPv6:2607:f8b0:4864:20::331]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F1vXG2Kxmz3q4D for ; Fri, 19 Mar 2021 06:45:02 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: by mail-ot1-x331.google.com with SMTP id 31-20020a9d00220000b02901b64b9b50b1so7560551ota.9 for ; Thu, 18 Mar 2021 23:45:02 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=gEPuHFJ0rUh5FkV7msETaGKGdUGsHOsYEkxxLpUrtbM=; b=tPZN95DUvyM4j4jW04ulEddMqgGc2D4INquPMF/q8SCi+z1jvgNWYHh2UezO2nIOrz +ijfmQK4GwzlnBEdoh41h+w4Vqu7xjv7LW60Jc9qBstvXKhfD6zQjOgx8f2zcGbICvx7 rkPheijHT5WcOAbjtHtiToUwQT80XB74/R4oSils3TIuADX34j0gkxriFbcjqxJcTvzh juuPTxHiCnm+E/dZcnJFPBBRJ1z8kzM5Q1RZW8IywBWuAXcGCrF5l7Zin3FPYJcrLM2h uN6OwdUQTpbznQu1jt0B8XPQQfR4y6Hgq+reLpOAg5/H9twu9M+Gix1ktveGNFtq1g2W YfhQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=gEPuHFJ0rUh5FkV7msETaGKGdUGsHOsYEkxxLpUrtbM=; b=l2cxmU243hNiqwc21Seum9BXkKKBngJBuJ2tTu9baA4ajwPlsTrk6yanoKeddGCcfm vncYHsotnXrt/BchS0jhAOOgk4Mo0kaz3tNNVvik/QA8clgavmMH94yRBzjvJr7Vm6nZ MiP1TSdf2jNTCBXG0l+2zh3QcnBQujuZ57enASc8lPq/mwDF6yBWPNqnfjHAojIzXAi9 AJ3T2ZvZLM3rFm1+EFJWwwGQLGgHZnRt6fhISWOSL01DOC6tuFEumW5299AupsnM6riS EeFYX0YtMKXs5zzDmudNT0T5gAD8P/CNDxlE1qRnozqSNMxv3a2vD2afCzXD86WKP4Mu 3i2w== X-Gm-Message-State: AOAM530imrOMQYtlbpM23NhKUdcIeBCsC3cHI5fU+OE86nuPvxYYOvIJ KjLYSdRP+HegWDGzQdp5Chx9iBwowuakVrBqDUs= X-Google-Smtp-Source: ABdhPJwnKGfY1uCseOsAA2Jp9pr94BO5KhkinqNiE9Lng6EbxFMQwO9JhxZQrDuy6HXK6p8WK8QCjnbl0jWuxpYHGE0= X-Received: by 2002:a05:6830:1e14:: with SMTP id s20mr10831235otr.199.1616136301138; Thu, 18 Mar 2021 23:45:01 -0700 (PDT) MIME-Version: 1.0 References: <20210317213615.7e1443af@antix1> <20210318105902.0fad52928f1c43dea056bcb6@gmail.com> <44czvwgza8.fsf@be-well.ilk.org> <20210318120751.23e1e2f565e2face195d9d73@gmail.com> <20210318185106.82ace6b0a2e6d3b78ecc890f@gmail.com> In-Reply-To: <20210318185106.82ace6b0a2e6d3b78ecc890f@gmail.com> From: Kevin Oberman Date: Thu, 18 Mar 2021 23:44:45 -0700 Message-ID: Subject: Re: Partitioning 1T HDD To: Duke Normandin Cc: "freebsd-questions@freebsd.org" X-Rspamd-Queue-Id: 4F1vXG2Kxmz3q4D X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=tPZN95DU; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of kob6558@gmail.com designates 2607:f8b0:4864:20::331 as permitted sender) smtp.mailfrom=kob6558@gmail.com X-Spamd-Result: default: False [-3.70 / 15.00]; TO_DN_EQ_ADDR_SOME(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FORGED_SENDER(0.30)[rkoberman@gmail.com,kob6558@gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; FROM_NEQ_ENVFROM(0.00)[rkoberman@gmail.com,kob6558@gmail.com]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::331:from]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::331:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::331:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 06:45:03 -0000 Exactly. It replaces fdisk and bsdlabel. Use "gpart create" to set the disk as GPT or BSD. Use "gpart add" to partition the drive. Then use newfs and glabel as needed to finish up the file system. The gpart man page is pretty good with several examples. Several more presentations may be found with a web search. "gpart show " and "gpart list" to check that things look right. List has all details while "show" just shows partitions. Generally recommended that the boot block be padded to 2048. Do this by setting the -b option to 2048 for the "add" of the partition after the boot block. This is an example of an GPT setup. It has separate partitions for root, usr, var, swap, and tmp plus an encrypted partition for sensitive files. Don't forget swap! gpart show ada => 40 3906963376 da0 GPT (1.8T) 40 1024 1 freebsd-boot (512K) 1064 984 - free - (492K) 2048 4194304 2 freebsd-ufs (2.0G) 4196352 4194304 3 freebsd-swap (2.0G) 8390656 10217464 4 freebsd-ufs (4.9G) 18608120 641728512 5 freebsd-ufs (306G) 660336632 1287722512 6 freebsd-ufs (614G) 1948059144 471040000 7 freebsd-ufs (225G) 2419099144 314572800 8 freebsd-ufs (150G) 2733671944 1173291472 - free - (559G) 34 2014 - free - (1.0M) 2048 532480 1 efi (260M) 534528 262144 2 ms-reserved (128M) 796672 541927424 3 ms-basic-data (258G) 542724096 1258291200 5 freebsd-ufs (600G) 1801015296 33554432 6 freebsd-swap (16G) 1834569728 2069889024 7 freebsd-ufs (987G) 3904458752 1034240 - free - (505M) 3905492992 1536000 4 ms-recovery (750M) 3907028992 143 - free - (72K) Kevin Oberman, Part time kid herder and retired Network Engineer E-mail: rkoberman@gmail.com PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 On Thu, Mar 18, 2021 at 5:51 PM Duke Normandin wrote: > On Thu, 18 Mar 2021 13:00:20 -0700 > Kevin Oberman wrote: > > > I'd like to point out the GPT works for either MBR or EFI booting. My old > > laptop had broken EFI support, so had to be MBR, but the partitioning was > > GPT which is far easier to use and manage. It is likely true that EFI > > requires GPT, but MBR does not. I'm not even positive about EFI > > requirements, but it does need more partitions, so using it without GPT > > would be, at best, awkward. > > Thanks for fleshing out the answer to my questions. Are you talking about > using GPT rather than fdisk/cfdisk? > -- > Duke Normandin > From owner-freebsd-questions@freebsd.org Fri Mar 19 14:16:20 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5B24D575B26 for ; Fri, 19 Mar 2021 14:16:20 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qt1-x831.google.com (mail-qt1-x831.google.com [IPv6:2607:f8b0:4864:20::831]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F25Xz1WR4z4qRL for ; Fri, 19 Mar 2021 14:16:18 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qt1-x831.google.com with SMTP id a11so6796170qto.2 for ; Fri, 19 Mar 2021 07:16:18 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:reply-to:organization:mime-version; bh=GHeDRI7Ndt7/Ug3mnDQWvfL9N2xJtkX7/lNuO3Q9iyc=; b=QKn+ap8AOEU7VpX9i7xTNo5AL579E7BZNzyjACFNt1W4pxhrxto5jMoNjS7Il1sSHz /x0/RMwpc/7u+I7zl6oQhBpGIUdD0UVVxlR5bG/hbxZVwd2hhB2QMxOwvriPm+A9ridK 32DqcTrjfmFnVztu92GpVf3ijCJr0rcWJrJpY= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:reply-to :organization:mime-version; bh=GHeDRI7Ndt7/Ug3mnDQWvfL9N2xJtkX7/lNuO3Q9iyc=; b=a9lpMGehFpx2JChoFBuJW1mHqSX1Aak0EzjgHbCaZnrI5iwOmkbgwZDo2eIZuK4xJX +W0o2AmrTbGmJ41ykD3uVMsg0SYd2UA8Jjz+73L4+dvRTvZ1Trr8Zzely0cJqmCWc30w q1Qw7teYntcyGdkSd6g2Fs4M3nh6S9zbseNsR1fW3kFleRN5HTj5ozrjaLIwVd/5gKsg uqnE2ogvL4lrkx5TyDuGPVLH8IMHa5RY9lLigws3/zIrMZSmqVohkcbdgTq9KvnxwchJ pB4JPCZQ28NKhMGLkpHsPggsmQipZntQIA89OubOSGlvxt4QamzaoX/RS2sNXoBfiMbV H5dA== X-Gm-Message-State: AOAM533+nfNaaXmzLgM1UX7f3E56EKRzZgOMVjTkftK5XZKZHJk+YX/w G+sqI2SWQ/LJZVFNkM3aOq3sZgAKNB2jeg== X-Google-Smtp-Source: ABdhPJzi8BBZAAyCWpu68wjoAmHImwVn8ME1CdeAzzbINoOuGW44vtoJp4WekGXnuTQxCOq7H877iA== X-Received: by 2002:a05:620a:2455:: with SMTP id h21mr9637969qkn.447.1616163065215; Fri, 19 Mar 2021 07:11:05 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id g7sm3809152qti.20.2021.03.19.07.11.03 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 07:11:04 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F25Qt2ZkTz1y0J for ; Fri, 19 Mar 2021 10:11:02 -0400 (EDT) Date: Fri, 19 Mar 2021 10:10:40 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: OS to replace FreeBSD Message-ID: <20210319101040.00005c35@seibercom.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/SGb+vD9imgissEmUKC+VItJ"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F25Xz1WR4z4qRL X-Spamd-Bar: ++++++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=QKn+ap8A; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::831 as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [6.10 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,body]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::831:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.30)[-0.303]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::831:from:127.0.2.255]; NEURAL_SPAM_SHORT(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::831:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-Spam: Yes X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 14:16:20 -0000 --Sig_/SGb+vD9imgissEmUKC+VItJ Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable With the soon-to-be release of version 13 of FreeBSD and the EOL of FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99s unfortunate inability to squash bug https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left with no choice but to seek out a new OS. I need a bare-bones system that can run a mail server, Postfix with Dovecot, and a few other utilities. --=20 Jerry --Sig_/SGb+vD9imgissEmUKC+VItJ Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBUsOkACgkQgHBP8gv9 FXeLJgwAgfQ6bjdbNiBzQhM2rx03/yY0j+ae4Y1MVnqvb1bwHLR/wSoglAx//kb0 LecDUp6zNkui7L9WvxYnEJuAvSDnoFthiwknUsfO+H+ejFcq9zYfIKOZCK52vfwd S0jM9mHPA+8WYzO1DIld772pBpxwHkEBbXHVJI32ETdQq+EqIszMg5zIEPrm7+6i 27jDLHDgB2oQTEtZompM72mbOyj/x6HKpdnDuWMKc5ASkaVcmeMoEE+QszZzHmk4 gMXXoIyT8DuiocVMrGjaZ4OrWa40QZOpDA5iCxZ7ppV8kAD5pe3XSc9HZzG7TqnF T5Gb3TSfWzpsb3cVfgDLHDTmZ4tse8QzNIeDo9JK/WmTOrO0b7s4BBR2F8/3NHJc WBBDbUNARjDPDM20JcciK4zA7UfHG4XTjkpeWP7sx8ykj7BnCHNpPI5BksuCnKCk G2wlE4tR0t/kYTFwTISjVnzzZLJjLgJUS+6qSj+GehhMQKZeEK/VFJAMcm34Zm/d xEcvUlMU =jc6D -----END PGP SIGNATURE----- --Sig_/SGb+vD9imgissEmUKC+VItJ-- From owner-freebsd-questions@freebsd.org Fri Mar 19 14:34:03 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 30EA45764F9 for ; Fri, 19 Mar 2021 14:34:03 +0000 (UTC) (envelope-from mgamsjager@gmail.com) Received: from mail-ed1-x52b.google.com (mail-ed1-x52b.google.com [IPv6:2a00:1450:4864:20::52b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F25xQ2hVLz4s8F for ; Fri, 19 Mar 2021 14:34:02 +0000 (UTC) (envelope-from mgamsjager@gmail.com) Received: by mail-ed1-x52b.google.com with SMTP id bf3so11044144edb.6 for ; Fri, 19 Mar 2021 07:34:02 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=gKqR2RUeHSaIPCS3WmxCDCYo+w3a5zngD4LzsXpfh1w=; b=haY+yaW/y6gSuylZTSrkvd9SYAB+QK/SRKKJFB9MWFhsf6EgdUaWmlU0j8lnM+x47W Il/p+iq4FV2QEUyPE3xMbfky9xg8+3WmncKicj3L2FvkTXNwQlpOxJ29X/FL1rOnIhdA 9XCqSfz2Hb1i0PcZ973Lw8rl2pt9UshbLqJAq9VNKZdoaQ+R35OtXXPXDKCzKdGG8FPv ZJkj5HsNBwcohwh0EjKeQaXfmjn3zCyHsjA1kvRogrb+RITqFLOiQ+FR/xIECMLIzWfr s16nv1uvOva1qjCyWK6eCsZCjLts0vJwG1Gg+ZgWKUsz+aR5gPBy1CXVd0S+yWm3NIxg pQlw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=gKqR2RUeHSaIPCS3WmxCDCYo+w3a5zngD4LzsXpfh1w=; b=VKWAbM8917fx/RPJa03a4aT9ZG8l7FQ8jP4FV3d+2Ox6/ODyoVNQkrEC/I9t7l2v3A YL5kUzrSU1+NJ307KPJ4ntcNCfmxZUv9tae4C+FRyNePRU6UbN7WOjVL7AviTiHygYfu Qn4+XnMBWtXi5WVixp9TvEx55KzbZkJ01BiUn7/WiqpsjjzqwP2Fk9sQcriQFyfkgHMQ yYHQiGJQU2t/A1dbsnVoiJ9J2QpzC64gu9wxJKEh0soEKo1EhygEc0ifhwROj1R6NYXQ dSzpamhEa8YmnyAQBMZcZCZYWIV+Ktq/eDO+3YPsdXJIs44rm+PcDGmVPvE5jiwbdzVl Xz/Q== X-Gm-Message-State: AOAM533o/RrwKomO519ehRMSDIaH5fgJx/AyZwC9reayoH7509jteH8L ZFv1UqNRgWg4R96Ufee6/4UzhOY4+3rpBwJrLVWoqdQT X-Google-Smtp-Source: ABdhPJz9vxC/cXEPG+clQwAIBuAZTE3pI9sWlOM284+/uxbnQ+moLsPsu3xafhSEisWNFunoZCyHnKbEjAF+FTfuwdk= X-Received: by 2002:a50:fa04:: with SMTP id b4mr10096072edq.293.1616164440795; Fri, 19 Mar 2021 07:34:00 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> In-Reply-To: <20210319101040.00005c35@seibercom.net> From: Matthias Gamsjager Date: Fri, 19 Mar 2021 15:33:24 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F25xQ2hVLz4s8F X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=haY+yaW/; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of mgamsjager@gmail.com designates 2a00:1450:4864:20::52b as permitted sender) smtp.mailfrom=mgamsjager@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-0.999]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::52b:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::52b:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::52b:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 14:34:03 -0000 On Fri, 19 Mar 2021 at 15:16, Jerry wrote: > With the soon-to-be release of version 13 of FreeBSD and the EOL of > FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99s > unfortunate inability to squash bug > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left > with no choice but to seek out a new OS. I need a bare-bones system > that can run a mail server, Postfix with Dovecot, and a few other > utilities. > > -- > Jerry > Not sure what you want to hear. You could also try a different motherboard. From owner-freebsd-questions@freebsd.org Fri Mar 19 14:39:21 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C8949576378 for ; Fri, 19 Mar 2021 14:39:21 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt32.smtp-out.videotron.ca (alt32.smtp-out.videotron.ca [24.53.0.21]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F263X4kTlz4s4f for ; Fri, 19 Mar 2021 14:39:20 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [10.252.0.40] ([169.57.185.69]) by Videotron with SMTP id NGHUlkGB0kLVBNGHWlRAmI; Fri, 19 Mar 2021 10:39:19 -0400 X-Authority-Analysis: v=2.3 cv=Ka+sTjQD c=1 sm=1 tr=0 a=VuWP7ngXSxyjRYdIVNbaQw==:117 a=VuWP7ngXSxyjRYdIVNbaQw==:17 a=IkcTkHD0fZMA:10 a=AfEfcmvjAAAA:8 a=6I5d2MoRAAAA:8 a=kthP9bw_NXR-IcGwG20A:9 a=QEXdDO2ut3YA:10 a=xIDnvljIO3wZ5qv32AfX:22 a=IjZwj45LgO3ly-622nXo:22 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 10:39:14 -0400 Message-Id: <547CBADF-2EB5-4AD8-BD22-D11969358797@videotron.ca> References: In-Reply-To: To: freebsd-questions@freebsd.org X-Mailer: iPad Mail (18D52) X-CMAE-Envelope: MS4wfAj39uBKpTigQO464l6lpnDhA/J8+HgfEN+gGe0PhtVzrvZ3LmJCheTEhKnqy8MO2zzTpy5qwpqKgmW6hNA3AbAN/mfpEmnsWWeo2HiaqKVLIX4fI2Sh Ti6SaDNrD6jiC4mA/mF3Cjmg33dW/H8zUeQ2u0lqd0il+49LUvEB92BBir1P22bbJ04SfxJIB9o0PA== X-Rspamd-Queue-Id: 4F263X4kTlz4s4f X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 24.53.0.21 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-1.33 / 15.00]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; NEURAL_SPAM_SHORT(0.57)[0.566]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[24.53.0.21:from]; FREEMAIL_FROM(0.00)[videotron.ca]; MV_CASE(0.50)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[videotron.ca]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[24.53.0.21:from:127.0.2.255]; RCVD_IN_DNSWL_LOW(-0.10)[24.53.0.21:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; R_SPF_ALLOW(-0.20)[+ip4:24.53.0.20/30]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:24.53.0.0/18, country:CA]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 14:39:21 -0000 Jerry don=E2=80=99t threaten us like that or we will get you... you don=E2=80= =99t switch and become an outsider, we need you like you need us... so stop w= ith the shananiggans . =20 Envoy=C3=A9 de mon iPad > Le 19 mars 2021 =C3=A0 10:16, Jerry a =C3=A9crit : >=20 > =EF=BB=BFWith the soon-to-be release of version 13 of FreeBSD and the EOL o= f > FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99s > unfortunate inability to squash bug > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left > with no choice but to seek out a new OS. I need a bare-bones system > that can run a mail server, Postfix with Dovecot, and a few other > utilities. >=20 > --=20 > Jerry From owner-freebsd-questions@freebsd.org Fri Mar 19 14:42:12 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0C7DB576CFF for ; Fri, 19 Mar 2021 14:42:12 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt22.smtp-out.videotron.ca (alt22.smtp-out.videotron.ca [70.80.0.73]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F266q105jz4sh7 for ; Fri, 19 Mar 2021 14:42:10 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [10.252.0.40] ([169.57.185.69]) by Videotron with SMTP id NGKElCOED8ZBoNGKGlRGNd; Fri, 19 Mar 2021 10:42:09 -0400 X-Authority-Analysis: v=2.3 cv=NpuvjPVJ c=1 sm=1 tr=0 a=VuWP7ngXSxyjRYdIVNbaQw==:117 a=VuWP7ngXSxyjRYdIVNbaQw==:17 a=IkcTkHD0fZMA:10 a=sa8qx-EqAAAA:8 a=pGLkceISAAAA:8 a=AfEfcmvjAAAA:8 a=6I5d2MoRAAAA:8 a=DAdjurZ4nrDdHgMtrTUA:9 a=QEXdDO2ut3YA:10 a=xIDnvljIO3wZ5qv32AfX:22 a=IjZwj45LgO3ly-622nXo:22 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 10:42:04 -0400 Message-Id: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: Matthias Gamsjager X-Mailer: iPad Mail (18D52) X-CMAE-Envelope: MS4wfI2/Vo+4VDPG33zHG2AOAPtkSEjQ/osqp46+rmSbIqEs99JUPl9NvrnVUHVODdJr+ups+mvKFIuhNMaBCO9zMjZCgAQ1xCb2KAsbz5tpkX0N4H29OlGn 2QLbDiMEdyUX32csC6Ja1LzY+EcfosUaSBJwY8NhDLQiBJ/S3whux0jOEXmK+7uPaNvZJ2UxILks2Ii1byJd0QZJuTOW5ZpUlZw= X-Rspamd-Queue-Id: 4F266q105jz4sh7 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 70.80.0.73 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-1.17 / 15.00]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:70.80.0.72/30:c]; FREEMAIL_FROM(0.00)[videotron.ca]; MV_CASE(0.50)[]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[gmail.com]; RCVD_IN_DNSWL_LOW(-0.10)[70.80.0.73:from]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[70.80.0.73:from]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:70.80.0.0/18, country:CA]; MID_RHS_MATCH_FROM(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_NA(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.73)[0.731]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[70.80.0.73:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_TLS_LAST(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 14:42:12 -0000 Or you could try not being lazy and fixing the bug yourself it=E2=80=99s an o= pen source software and you=E2=80=99re free to rewrite the kernel however yo= u like so don=E2=80=99t play these games with us if freebsd is good enough f= or Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT SHOUL= D BE GOOD ENOUGH FOR JERRY, so don=E2=80=99t play this game with us and send= mail.org is the default mail server not postfix... Envoy=C3=A9 de mon iPad > Le 19 mars 2021 =C3=A0 10:34, Matthias Gamsjager a =C3= =A9crit : >=20 > =EF=BB=BFOn Fri, 19 Mar 2021 at 15:16, Jerry wrote: >=20 >> With the soon-to-be release of version 13 of FreeBSD and the EOL of >> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99s= >> unfortunate inability to squash bug >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >> with no choice but to seek out a new OS. I need a bare-bones system >> that can run a mail server, Postfix with Dovecot, and a few other >> utilities. >>=20 >> -- >> Jerry >>=20 >=20 > Not sure what you want to hear. You could also try a different motherboard= . > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.or= g" From owner-freebsd-questions@freebsd.org Fri Mar 19 15:00:21 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 964C4577484 for ; Fri, 19 Mar 2021 15:00:21 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qt1-x82d.google.com (mail-qt1-x82d.google.com [IPv6:2607:f8b0:4864:20::82d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F26Wm6f2hz4tLn for ; Fri, 19 Mar 2021 15:00:20 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qt1-x82d.google.com with SMTP id r14so6898452qtt.7 for ; Fri, 19 Mar 2021 08:00:20 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=w+7xyRZDcvWtleHqWkOb5YTviQ/5coeit4bqnC2k5xY=; b=PC6lDzqu89JvXWoABT50HXu7/RZp/XVkPDJNu3NVLOzELz8vRh8qz+9S8bQ8DPl9mi JDtxskinYaV9IJbjcbb0mYJvxouyeU16Os5in/A6TLotD0NuI2vrVtaTJQbebx3oNEXi I6QWNtUlVxDOXizJz+9qYekhU0kT91sJUzEP0= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=w+7xyRZDcvWtleHqWkOb5YTviQ/5coeit4bqnC2k5xY=; b=fJ9+wMXkYKI0Z2Rh8J+oXgpbpPk/yk8qeXj48P7zFdOx3kfJ3pTwcNCklavWrmP9w2 1ACY2nUlExFOSK9GbpkyVjaSejsF3/tYrvUNn2k/DSK7sbeUAhtAOT7zasFn2cILZmF1 0hAZ1hK1JM0Q8aS6wF4FDEsj/Pn49bh6PX24MxCYtjLvtM+a420Z68cXyDNRpFUSaLi8 DQAtae1ejFPAqia/yRUuc2aDXUYz46iI0dBGILsNNo2Ht0nto3vS1vGXcpEHIF2wSD8J v1Sl8/ko2H3kubXTw1xDcze8cvji4gFiwfMzri0vlb2vzK5cI/DVVmW5mNsTfDioB/AP cMYw== X-Gm-Message-State: AOAM530R9o4NJFr3mz0D+r1GrkGc89L3obEFoQdkP6RJfwdL4hCWxhnN HzKSzzO+CYIZREnelhel/3uaJS5YBDMgCg== X-Google-Smtp-Source: ABdhPJyWdmXSqvJ/VgYEqB5cCR921iYzs1mlR5LlawFMPJ13ykYdebFUKHHwy47pCNclELgeD8D5tg== X-Received: by 2002:a05:622a:293:: with SMTP id z19mr8384774qtw.309.1616166019431; Fri, 19 Mar 2021 08:00:19 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id l9sm3795729qtv.65.2021.03.19.08.00.18 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 08:00:18 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F26Wj3Xmhz1y1B for ; Fri, 19 Mar 2021 11:00:17 -0400 (EDT) Date: Fri, 19 Mar 2021 11:00:01 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319110001.00000bf8@seibercom.net> In-Reply-To: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/l6bmFDwWznlzW+P1.vrX3hH"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F26Wm6f2hz4tLn X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=PC6lDzqu; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::82d as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.36 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::82d:from]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::82d:from:127.0.2.255]; NEURAL_SPAM_LONG(0.96)[0.964]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::82d:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:00:21 -0000 --Sig_/l6bmFDwWznlzW+P1.vrX3hH Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 10:42:04 -0400, Paul stated: >> Le 19 mars 2021 =C3=A0 10:34, Matthias Gamsjager a >> =C3=A9crit : >>=20 >> =EF=BB=BFOn Fri, 19 Mar 2021 at 15:16, Jerry wrote: >> =20 >>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80= =99s >>> unfortunate inability to squash bug >>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >>> with no choice but to seek out a new OS. I need a bare-bones system >>> that can run a mail server, Postfix with Dovecot, and a few other >>> utilities. >>>=20 >>> -- >>> Jerry >>> =20 >>=20 >> Not sure what you want to hear. You could also try a different >> motherboard. _______________________________________________ >Or you could try not being lazy and fixing the bug yourself it=E2=80=99s an >open source software and you=E2=80=99re free to rewrite the kernel however= you >like so don=E2=80=99t play these games with us if freebsd is good enough f= or >Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT >SHOULD BE GOOD ENOUGH FOR JERRY, so don=E2=80=99t play this game with us a= nd >sendmail.org is the default mail server not postfix... > >Envoy=C3=A9 de mon iPad Interestingly enough, I am not the only person with this problem. So, using your reasoning, all the others must also be lazy. Also, Mickrosoft works fine on this PC. I tried it to rule out a problem with the unit itself. The problem, confirmed by Dell, is with the OS. They won't create a work-around to fix it because they claim it is a bug with FreeBSD and they are not going to introduce a potential problem for other OSs. By the way, why would I care if sendmail is the default? It is a remnant from bygone days. Postfix is far superior. Other OSs have already switched away from sendmail. Obviously, you are of no assistance. --=20 Jerry --Sig_/l6bmFDwWznlzW+P1.vrX3hH Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBUvHgACgkQgHBP8gv9 FXewSAv+LiALTLruqOh55PlHEfs5Z4oEBlBL9iKG6UFz3WOy59XI9FLl3gxixiQO rorBQEckSmpDafsCW9r3PzmM8g9+PwaSe+3V/xG/dqscJklTq72IxKAs55qw/Aiu aofhP6A+qlC4WzDW4le9esbLVv/0n5f3CmM3VPOjm/hyuHtG9HyvSfB+oMobU2Kg qTlKypiHDDe73DLAJ/ZRRvZbyw1+KC7LM/PBnyQ3FTjn9ZWpb/ekMCFc+eolyuxv VPhOcA4nwx60bF6GbClESjnmqeX+an2KgS1k6MIEXN/Yo8JWymHm8COF0Zl17uad cOHv4IbmHXCWUBMIyEs9jzwksyHNmO/qNQKWjMo6ZRTmlWRw8Vwj6ullJuawxvzn d1GguWZuMvhLkW4ECY+Vdzt9pfQaNjhe7aqOgHK9prkgOx9Sp57azKRDFC715p9r orv+reGGjpl4oFOeQjYKZ9HmyoJFsYlL0eB8IiRqhRjoMk2L15HFxgKAlyQLc2cN o20uDTyc =MJo2 -----END PGP SIGNATURE----- --Sig_/l6bmFDwWznlzW+P1.vrX3hH-- From owner-freebsd-questions@freebsd.org Fri Mar 19 15:04:10 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0F6815773E4 for ; Fri, 19 Mar 2021 15:04:10 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F26c91KdZz4tWN for ; Fri, 19 Mar 2021 15:04:08 +0000 (UTC) (envelope-from kremels@kreme.com) Content-Type: text/plain; charset=utf-8 Subject: Re: OS to replace FreeBSD From: "@lbutlr" In-Reply-To: <20210319101040.00005c35@seibercom.net> Date: Fri, 19 Mar 2021 09:04:06 -0600 Content-Transfer-Encoding: quoted-printable Message-Id: <28CE3B19-C72A-4932-8624-E0EA4E34D609@kreme.com> References: <20210319101040.00005c35@seibercom.net> To: FreeBSD X-Mailer: Apple Mail (2.3654.80.0.2.43) X-Rspamd-Queue-Id: 4F26c91KdZz4tWN X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [-1.40 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.121.55.42:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; MISSING_MIME_VERSION(2.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; R_SPF_ALLOW(-0.20)[+mx]; DMARC_NA(0.00)[kreme.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.121.55.42:from:127.0.2.255]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[65.121.55.42:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:04:10 -0000 On 19 Mar 2021, at 08:10, Jerry wrote: > With the soon-to-be release of version 13 of FreeBSD and the EOL of > FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99= s > unfortunate inability to squash bug > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, Isn't this the Dell onboard USB controller issue? (I've read that thread = before, I am not re-reading it all again, but it looks like it is). If I = recall correctly from last month, there is a workaround where you = disable USB3 onboard and recompile without it. I mean, disabling USB3 on a server is a good idea ANYWAY, but if you = need it, you can disable the onboard USB3 and add a card with a = known-food controller. --=20 'I thought we could do it without anyone getting hurt. By using our brains.' 'Can't. History don't work like that. Blood first, then brains.' 'Mountains of skulls,' said Truckle. 'There's got to be a better way than fighting,' said Mr Saveloy. 'Yep. Lots of 'em. Only none of 'em work.' From owner-freebsd-questions@freebsd.org Fri Mar 19 15:06:43 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 27AAD577832 for ; Fri, 19 Mar 2021 15:06:43 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F26g62BCmz4tfm for ; Fri, 19 Mar 2021 15:06:42 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from point.uchicago.edu (point.uchicago.edu [128.135.52.6]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 161C74E6CA for ; Fri, 19 Mar 2021 10:06:36 -0500 (CDT) Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> From: Valeri Galtsev Message-ID: Date: Fri, 19 Mar 2021 10:06:35 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.7.1 MIME-Version: 1.0 In-Reply-To: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4F26g62BCmz4tfm X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [-2.90 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:06:43 -0000 On 3/19/21 9:42 AM, Paul wrote: > Or you could try not being lazy and fixing the bug yourself it’s an open source software and you’re free to rewrite the kernel however you like so don’t play these games with us if freebsd is good enough for Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT SHOULD BE GOOD ENOUGH FOR JERRY, so don’t play this game with us and sendmail.org is the default mail server not postfix... > I join you on all counts... but I for one always replace sendmail with postfix since forever (for over 2 decades). But of course, I will refrain to list my (and other people) reasons. Valeri > Envoyé de mon iPad > >> Le 19 mars 2021 à 10:34, Matthias Gamsjager a écrit : >> >> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >> >>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >>> unfortunate inability to squash bug >>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >>> with no choice but to seek out a new OS. I need a bare-bones system >>> that can run a mail server, Postfix with Dovecot, and a few other >>> utilities. >>> >>> -- >>> Jerry >>> >> >> Not sure what you want to hear. You could also try a different motherboard. >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.org" > > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.org" > -- ++++++++++++++++++++++++++++++++++++++++ Valeri Galtsev Sr System Administrator Department of Astronomy and Astrophysics Kavli Institute for Cosmological Physics University of Chicago Phone: 773-702-4247 ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Fri Mar 19 15:07:10 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 36E51577764 for ; Fri, 19 Mar 2021 15:07:10 +0000 (UTC) (envelope-from luzar722@gmail.com) Received: from mail-qv1-xf36.google.com (mail-qv1-xf36.google.com [IPv6:2607:f8b0:4864:20::f36]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F26gd2byBz4tlt for ; Fri, 19 Mar 2021 15:07:09 +0000 (UTC) (envelope-from luzar722@gmail.com) Received: by mail-qv1-xf36.google.com with SMTP id x16so5167405qvk.3 for ; Fri, 19 Mar 2021 08:07:09 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=message-id:date:from:user-agent:mime-version:to:subject:references :in-reply-to:content-transfer-encoding; bh=jg54WIw388YarLF+BDHIyMb1LsA/KOH1FSQv2t3Qrvo=; b=h9w9wu2mQdI+w/XOC2k45f/Hv01bOgxrGbZuy3dv/nHvMsOiLQFSWWPjTd/EdPmUPu q3I1N/Cl0hGSrCuMnCey623g+w/khpc+4RNYciHAAdD+nwkc6ftOxohkiZesoKdBAQYn SDgXJvchgzyYbTEyKsQ+eHp+PEvmFO2pMiEuqYLIEfobUSOsqcqsGobyiPi2cmDbWoFw fITCa3vHVgPTlECBeIbHnhPWGl4xiHVC7mcNiGK4ibBlLlEBmQQclbt5CWwOmvWR7vWm NqXYlt/rhjN9NLNPStcKekxng0HoJdbkO0zN4O7zK6E9GDJtVSclw5VKCHrla90J3Bxy i91w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:message-id:date:from:user-agent:mime-version:to :subject:references:in-reply-to:content-transfer-encoding; bh=jg54WIw388YarLF+BDHIyMb1LsA/KOH1FSQv2t3Qrvo=; b=Rdz9WSha4H0r3FxLPguof8UuvbbCCtFKxC41DwCRlN+yFDs/JVWyukJUI6Ou5gGfQ6 ORntdTFcgvgBkHWJneNnvNcZ67ry18WgZhCenM0hjmupWZQyngKZLj5KXJH6ixQLlcll M3aqPhywSzdD1pNl0Nj9HedIvuRKTFL8R1UBf83T4ucFYORJNIkdLS7M7zhhyGbuEbFa EAaj08Jaq8o7LIrv3ToPHGyHdSzVpBOT7HzZNkMOT2l21kouX5JnESpO2db5oTJfFsZK A4e2dwXzVYWO0+Tpy7fZ1FVuFKteR3mU0pzeYQ9z1SdYVRQIi7WKEvA+Ef2F6lY+N95i 008g== X-Gm-Message-State: AOAM531eYD9FBFgsaj1n9IYTu8zNXZNRxo9HrDwaefBAw8hVbr7bbaQB c97uy9QGDe2FGzM4ivQmS3x+noriE+A= X-Google-Smtp-Source: ABdhPJztbNXTE+i+z06yTtpNlJbRW3LEoniDxQ+IiwlMpjDRGKs8v6/wr00GMak4cY3R77G9G4W6tw== X-Received: by 2002:ad4:4e23:: with SMTP id dm3mr9955955qvb.4.1616166428073; Fri, 19 Mar 2021 08:07:08 -0700 (PDT) Received: from [10.0.10.8] (cpe-65-25-51-0.neo.res.rr.com. [65.25.51.0]) by smtp.googlemail.com with ESMTPSA id q24sm4426992qki.120.2021.03.19.08.07.07 for (version=TLS1 cipher=ECDHE-RSA-AES128-SHA bits=128/128); Fri, 19 Mar 2021 08:07:07 -0700 (PDT) Message-ID: <6054BE1B.50706@gmail.com> Date: Fri, 19 Mar 2021 11:07:07 -0400 From: Ernie Luzar User-Agent: Thunderbird 2.0.0.24 (Windows/20100228) MIME-Version: 1.0 To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD References: <20210319101040.00005c35@seibercom.net> In-Reply-To: Content-Type: text/plain; charset=windows-1252; format=flowed Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4F26gd2byBz4tlt X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=h9w9wu2m; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of luzar722@gmail.com designates 2607:f8b0:4864:20::f36 as permitted sender) smtp.mailfrom=luzar722@gmail.com X-Spamd-Result: default: False [0.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[65.25.51.0:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f36:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f36:from:127.0.2.255]; FORGED_MUA_THUNDERBIRD_MSGID(4.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f36:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:07:10 -0000 Matthias Gamsjager wrote: > On Fri, 19 Mar 2021 at 15:16, Jerry wrote: > >> With the soon-to-be release of version 13 of FreeBSD and the EOL of >> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >> unfortunate inability to squash bug >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >> with no choice but to seek out a new OS. I need a bare-bones system >> that can run a mail server, Postfix with Dovecot, and a few other >> utilities. >> This sounds like only 2 things. 1. Something in your hardware tower is falling. 2. The way you updated from one release to another something went wrong. I would start with a clean build of release 12.2 using a disk drive on a usb stick. See if problem is still there. If so you have hardware problem and no amount of PR is going to fix that. From owner-freebsd-questions@freebsd.org Fri Mar 19 15:09:18 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4F464577AC5 for ; Fri, 19 Mar 2021 15:09:18 +0000 (UTC) (envelope-from dvoich@aim.com) Received: from sonic309-13.consmr.mail.bf2.yahoo.com (sonic309-13.consmr.mail.bf2.yahoo.com [74.6.129.123]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F26k52dw7z4v7K for ; Fri, 19 Mar 2021 15:09:16 +0000 (UTC) (envelope-from dvoich@aim.com) X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1616166555; bh=T087FBCl5T1sg1edMm6SnR6wW10fEw6TMogkYiqsQLO=; h=X-Sonic-MF:Date:From:To:Subject:From:Subject; b=Zeyr56oi9O4zxxQRJeaqH+fnrSVySKpSEiEhSv8RgWPs4IvgRj48mh8BmanDk6clhq6Vgs+OSDrwJ6UPa5axkcjuxpzfLeg+m9gMX0coiWArHTQ222QCfAbLO/ROXvJjSqkZ4AlbqRVHNz8Q8YcbCLWtCDW4IuiYSqjpSoq8jOqg3+FIYj7f44aCjVLoWrvHXbXgV9bhizHxGbhiuGvs0lSYqkblYf6psiOb3YCnLdph9TJpk6ceMtNLcIB3H1RlGAE4ZZzKB6OSkOEhEBQ2//+C46h1Z/tooDWI3CzVshMo24HbJOoK/dAkUD/KiV+NsD5xVTcOagCWSyu2FqOJQw== X-YMail-OSG: kw1jDSgVM1nkj8YN55Dn7affDr8p9sld8h5Aa1JilmMs1zUuwwSdN2cAOwiykot sf6LcSTarWLG2EQugo8Rhp8rOKLBPKvP1qA41qc7r3iJpkeGP33octINy_HsHYskfKc570QoLTB9 domC9IC63TAxIVCWVqZcZS3NqIfV7WJ0yPBPGPtaQkfKu3hpq1vuY9lmBaTp0thxAwbxvCVVmVjW V2IjEWEv6qdZg9zK2ZmDp4c2XTQ1719mKvM6pGlEhDKZgOYkd1rE46r888i8WXuA1vVjPHwB5g7W nUCBOiKU8qIx0To3E0e7xYM_ll.f8aR8_TXn7GgQd45Y0JKkdWdGQV47JspQWShGNUB0_5BLkGxI 3lPhgodoQ0chpeFSC6h.fZTwndi_0qD35YafZHJ.uHijZtb73aUqqWJwIk1UqBQM_TlJFFz3mfY1 XrFMVj6CAOt_79q8L8L1dCsG4E7lAKZfkN53Wwb0se0vMUEXglz1018adePGs8GN6uapNsFeLV.G d60G4E970gNRSjr0I2xH0lVN4RH34UkyaBAV2zjoB_76RzKBzanqJXC9hYD3c5x9sQSZhV0hngBS BPDV2.K7jTaY2WaMLrbaIN9LzR44o5iAq0neEjeHM5ZKDS8tCmKUqiMv5mpw2JZ_H8j2uFsUl804 hXRZ5tJVGBU7KV8Pcs6ASNPwrSsDF2HwSmSWemLa39mIiLXWnH1OSi7L.ieHXN5MnM3bfnDj764D 8HHkpSudzUbVB3LIEYT62ezdIWApuGTbSeDhKq4qQaMVpo84o_6BELvnekMOzROHoQ_2F8o4pGyt wTv2ons0GKD2zuE.XuZD8IJ68bbi8Z.xPlWr8Iby_SqiUaEHoCe3UdPaERt4RyxYnLTWzrvcoMDf EUvuRGemPZSCNlKqXzydF2.nTT1qwTTc0QgNrjtXefKmEjGdmwRAiooAPnFsrbKoo7dC8.DvSljf mzaHshSqIE.PFYrzyMFnStOqTOHVeMqbufIiTYfCbr4aQ38Rb_dUY7HoZVA85iK7Y6N3qNrc3an0 uRn.ZhrPOAZvxkd3sb9Izd1FICRPJw0bb17FOPJvKUtdkRnZUO30BvdpDcP8fa4Tb3fGdx82x4nM S9E5v7Lfh_qeEeqiq3lP3.2BCZUUQNlCI31Va875F99JuALN2BDEdVSOXdOk9iuahub6DRnfX72O FpWe6lEHT5neeICwJDlYrH7gfy9QlsfetlemBtwv51aXDvU31p_2YDxGNODTBp.tKPfTB1OXs_.H fVTP003Tz9G7maDLTtYf68ilwlWJ1TG7hVqWFoDzaJjBzvzr5a8m1vVeselZebAo0rynMFOkBhay Czg6XDOcHa1RO4yRL7yG72kovrbN7Zu8nbvTGd.zXsBNCHm7BUJX59x6_CQodIbjKkI9nKXfQOyu gw.M6nI7dcRl.WHjjw6WdFMnLZ_IRA006frH06AlSNgTUK6zLhm6f.VshwBnv3V1UzqnQc9rzkpu jENo2YwhUTFME_UBAJXlFZwR17Dinh7U4.ogaR7RBu.ZXawso0NG69oyYuHEC6L5UYsNzX9dYfRn 1gJaUVrb_Xhj9UZf0knt3To0PZb2NFoO0R00MnfTsjpy7NAgvh3yNpbJjhY5S3sgM9GvzeOLYyus h6_cBEo2CYqkCiKknFJjrKKP2U4WkY_cxYS6XH4Tl__mKynrS0m65yyRj6Y1bUzwdZ6T2vbxU0KA nuqFGd2ISEzrcdOCzkrlmEQf5Fy6OF_cuoYCEkP7AxSovSWPrxgWqALLR3gOIaerUbsDu13yEdsU RAOghSDJRwn_bft9RH6AHc5k6as_x6RcnHAoF4i15CTUZxKD8XUdXqtfJ5YJbLb6Ii7tIaWrIhHJ C2y3DbdGdxrQsYJzwci6OWPEj3fionJwcRNAM.rwhBdl_PzOnxcR0aZzWicluP16WKCYCeTTKCUT Vk79av4vQ1WZkR1tb8XAvvWAtrROeardhpmVXa6nNuBOSdhQnXQ0H6FF35kokAhOGLWI5wRhKOMP 0y6GenqYs.W737xn6EBeApgE8AAYD4dOq4y10MIRu_4cVXVw2LNrGYHRnH5k24lTLLDXFAA4SRJt RzlziKLdOog0zQt0rrhXiBdmj.DD1S6tLPyqMdn4CXOSWcP_GWV_g.JqaCjOHSyG43Eg0hJoyWLu tK7FkxD5MzugVYgQWuKUBrckfX2tVZ..ItSkEtELEs1gvdiPYfhpZKb6GY9mndjdnsdLo6hHZ3lr XAGic2DdjZkEx6J1pmqjGEMkyD5HvE0leNjNnCRNW2LR3t6fx0aoY_STt8gDMOANxRFTDuM_96.J jhg4DxQdlTbnB8V_1tUIpTuqm79G4NvUhMYPmVj9kQruH28mOvsRByheK0.2fjYwjnGTjZkIElFt cqEA- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic309.consmr.mail.bf2.yahoo.com with HTTP; Fri, 19 Mar 2021 15:09:15 +0000 Received: by smtp411.mail.bf1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 5da0a048d71c9345fcecd532acc34e11; Fri, 19 Mar 2021 15:09:14 +0000 (UTC) Date: Fri, 19 Mar 2021 11:09:14 -0400 From: Aim To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-Id: <20210319110914.71e347136f6819b86a96aa8b@aim.com> In-Reply-To: <20210319101040.00005c35@seibercom.net> References: <20210319101040.00005c35@seibercom.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) Mime-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: quoted-printable X-Rspamd-Queue-Id: 4F26k52dw7z4v7K X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.50 / 15.00]; FREEMAIL_FROM(0.00)[aim.com]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:74.6.128.0/21]; DKIM_TRACE(0.00)[aim.com:+]; DMARC_POLICY_ALLOW(-0.50)[aim.com,reject]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[aim.com]; ASN(0.00)[asn:26101, ipnet:74.6.128.0/21, country:US]; RBL_DBL_DONT_QUERY_IPS(0.00)[74.6.129.123:from]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[aim.com:s=a2048]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[74.6.129.123:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[74.6.129.123:from]; RWL_MAILSPIKE_POSSIBLE(0.00)[74.6.129.123:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:09:18 -0000 On Fri, 19 Mar 2021 10:10:40 -0400 Jerry wrote: > With the soon-to-be release of version 13 of FreeBSD and the EOL of > FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD?s > unfortunate inability to squash bug > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left > with no choice but to seek out a new OS. I need a bare-bones system > that can run a mail server, Postfix with Dovecot, and a few other > utilities. >=20 > --=20 > Jerry https://distrowatch.com/ Plenty of choices there. Download a live instance of something that strikes= your fancy, insure it drives your problem interface and enjoy. Vlad --=20 From owner-freebsd-questions@freebsd.org Fri Mar 19 15:24:27 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id BF6AB577CC3 for ; Fri, 19 Mar 2021 15:24:27 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt32.smtp-out.videotron.ca (alt32.smtp-out.videotron.ca [24.53.0.21]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F273Z73y0z4vqs for ; Fri, 19 Mar 2021 15:24:26 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([169.57.185.94]) by Videotron with SMTP id NGz6lkMypkLVBNGzAlRF4t; Fri, 19 Mar 2021 11:24:26 -0400 X-Authority-Analysis: v=2.3 cv=Ka+sTjQD c=1 sm=1 tr=0 a=vnLmCCwk4Yh8rhog+SbulQ==:117 a=vnLmCCwk4Yh8rhog+SbulQ==:17 a=RpNjiQI2AAAA:8 a=sa8qx-EqAAAA:8 a=pGLkceISAAAA:8 a=AfEfcmvjAAAA:8 a=6I5d2MoRAAAA:8 a=NNv_tHQwOp9R6C3TpOgA:9 a=QEXdDO2ut3YA:10 a=pTfG0XxAYjkA:10 a=73T3PqG4-xaWWuNsDjAA:9 a=oAyOmJ_cOP9rdFs6:21 a=_W_S_7VecoQA:10 a=xIDnvljIO3wZ5qv32AfX:22 a=IjZwj45LgO3ly-622nXo:22 From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 11:24:18 -0400 Message-Id: References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: Valeri Galtsev X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfLQcSG/ob3oXkb86GBckIXJNg1ewReXYeG97V4CBfKrjy7/rhRjm7PTqB2Pt6MwsKiUEuXDe7KcI4zVJEWMESmr/s02s+mms4c0VbqkF/vgreYeXbPYi jDiI375/miLKQbeMpV8BF+VGQT7kYYTavOyw+diaGZqZn+TIyuq3fOf3zASQtE2C2Z8ZJ6SFwd/frMb7V70A5HoLzfDOn/1j/QLDp0P7qWurOhPnP1bZrL0D X-Rspamd-Queue-Id: 4F273Z73y0z4vqs X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 24.53.0.21 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; ARC_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:24.53.0.20/30:c]; FREEMAIL_FROM(0.00)[videotron.ca]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; MV_CASE(0.50)[]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[24.53.0.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[24.53.0.21:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:5769, ipnet:24.53.0.0/18, country:CA]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[24.53.0.21:from] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:24:27 -0000 Sendmail is good enough for Microsoft Outlook Exchange Servers and Apple ICl= oud but it=E2=80=99s not good enough for poor Jerry. Maybe you should upgrad= e to their commercial version if you think that the open source is not servi= ng you massively enough. They are serving more than 1/2 of the Fortune 500 c= ompanies maybe even your favorite Mike Dell but poor Jerry doesn=E2=80=99t l= ike it... https://www.proofpoint.com/us/customer-stories Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 11:06, Valeri Galtsev a= =C3=A9crit : >=20 > =EF=BB=BF >=20 >> On 3/19/21 9:42 AM, Paul wrote: >> Or you could try not being lazy and fixing the bug yourself it=E2=80=99s a= n open source software and you=E2=80=99re free to rewrite the kernel however= you like so don=E2=80=99t play these games with us if freebsd is good enoug= h for Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT SH= OULD BE GOOD ENOUGH FOR JERRY, so don=E2=80=99t play this game with us and s= endmail.org is the default mail server not postfix... >=20 > I join you on all counts... but I for one always replace sendmail with pos= tfix since forever (for over 2 decades). But of course, I will refrain to li= st my (and other people) reasons. >=20 > Valeri >=20 >> Envoy=C3=A9 de mon iPad >>>> Le 19 mars 2021 =C3=A0 10:34, Matthias Gamsjager = a =C3=A9crit : >>>=20 >>> =EF=BB=BFOn Fri, 19 Mar 2021 at 15:16, Jerry wrote= : >>>=20 >>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99= s >>>> unfortunate inability to squash bug >>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >>>> with no choice but to seek out a new OS. I need a bare-bones system >>>> that can run a mail server, Postfix with Dovecot, and a few other >>>> utilities. >>>>=20 >>>> -- >>>> Jerry >>>>=20 >>>=20 >>> Not sure what you want to hear. You could also try a different motherboa= rd. >>> _______________________________________________ >>> freebsd-questions@freebsd.org mailing list >>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.= org" >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.o= rg" >=20 > --=20 > ++++++++++++++++++++++++++++++++++++++++ > Valeri Galtsev > Sr System Administrator > Department of Astronomy and Astrophysics > Kavli Institute for Cosmological Physics > University of Chicago > Phone: 773-702-4247 > ++++++++++++++++++++++++++++++++++++++++ > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.or= g" From owner-freebsd-questions@freebsd.org Fri Mar 19 15:28:33 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2A1CE578489 for ; Fri, 19 Mar 2021 15:28:33 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt22.smtp-out.videotron.ca (alt22.smtp-out.videotron.ca [70.80.0.73]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F278J1Qbnz3BwH for ; Fri, 19 Mar 2021 15:28:31 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([169.57.185.94]) by Videotron with SMTP id NH33lCVEp8ZBoNH35lRKpk; Fri, 19 Mar 2021 11:28:29 -0400 X-Authority-Analysis: v=2.3 cv=NpuvjPVJ c=1 sm=1 tr=0 a=vnLmCCwk4Yh8rhog+SbulQ==:117 a=vnLmCCwk4Yh8rhog+SbulQ==:17 a=RpNjiQI2AAAA:8 a=6I5d2MoRAAAA:8 a=AfEfcmvjAAAA:8 a=3AID3nCUAAAA:8 a=ZxHcbNTyaKI0tPsCFY8A:9 a=QEXdDO2ut3YA:10 a=qQNrhF5NohUmZpe5bEAA:9 a=bXdCcvCBKEMs8FOb:21 a=_W_S_7VecoQA:10 a=IjZwj45LgO3ly-622nXo:22 a=xIDnvljIO3wZ5qv32AfX:22 a=mxckdVm6PK6AvOQZnz5X:22 From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 11:28:23 -0400 Message-Id: <066ABC69-E8E8-4EAD-85C1-BEEBE2865331@videotron.ca> References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: Aim X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfDd9WW8gDHRfvAKR8fkwPuRLTGlq0TxhBdEzOnOL+hfCMc5DHcER3zi2j5+0I8jUNPR9LCEE3WoIQhDpuwc07z9flDdn8zd7xvrZ7wS+ZbGyW28+qF55 krkdhNMJNeTxvahcndP+GSoyZeNV0lxvXMnzK6tF42tlENXPbcqxUKwHRktdctCp5B9Ca89UFYOiqTnaBHSNVe1bKgkgf6XZk3o= X-Rspamd-Queue-Id: 4F278J1Qbnz3BwH X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 70.80.0.73 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:70.80.0.72/30:c]; FREEMAIL_FROM(0.00)[videotron.ca]; MV_CASE(0.50)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[aim.com]; RCVD_IN_DNSWL_LOW(-0.10)[70.80.0.73:from]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; RBL_DBL_DONT_QUERY_IPS(0.00)[70.80.0.73:from]; R_DKIM_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:5769, ipnet:70.80.0.0/18, country:CA]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[70.80.0.73:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_TLS_LAST(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:28:33 -0000 Maybe if you upgraded to the latest version you would not be complaining abo= ut sendmail ... https://www.proofpoint.com/us/products/email-protection/open= -source-email-solution Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 11:09, Aim via freebsd-questions a =C3=A9crit : >=20 > =EF=BB=BFOn Fri, 19 Mar 2021 10:10:40 -0400 > Jerry wrote: >=20 >> With the soon-to-be release of version 13 of FreeBSD and the EOL of >> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD?s >> unfortunate inability to squash bug >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >> with no choice but to seek out a new OS. I need a bare-bones system >> that can run a mail server, Postfix with Dovecot, and a few other >> utilities. >>=20 >> --=20 >> Jerry >=20 > https://distrowatch.com/ >=20 > Plenty of choices there. Download a live instance of something that strike= s your fancy, insure it drives your problem interface and enjoy. >=20 > Vlad >=20 > --=20 >=20 > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.or= g" From owner-freebsd-questions@freebsd.org Fri Mar 19 15:34:59 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9D524578A00 for ; Fri, 19 Mar 2021 15:34:59 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt32.smtp-out.videotron.ca (alt32.smtp-out.videotron.ca [24.53.0.21]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F27Hk5pcbz3CSY for ; Fri, 19 Mar 2021 15:34:58 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([189.1.169.141]) by Videotron with SMTP id NH9IlRnHI4ryvNH9LlJxG4; Fri, 19 Mar 2021 11:34:57 -0400 X-Authority-Analysis: v=2.3 cv=O+9HQy1W c=1 sm=1 tr=0 a=FDHXRMPyIO39wzS/+YhoXA==:117 a=FDHXRMPyIO39wzS/+YhoXA==:17 a=IkcTkHD0fZMA:10 a=6I5d2MoRAAAA:8 a=AfEfcmvjAAAA:8 a=3AID3nCUAAAA:8 a=ZxHcbNTyaKI0tPsCFY8A:9 a=QEXdDO2ut3YA:10 a=IjZwj45LgO3ly-622nXo:22 a=xIDnvljIO3wZ5qv32AfX:22 a=mxckdVm6PK6AvOQZnz5X:22 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 11:34:50 -0400 Message-Id: References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: Aim X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfH+V1SxTLcb611GLRsOZls/8IQ4rGuj0NazvzyPvssudS6jzyxGSuYTyaRraYoKBLV3SukdEaaIHJ9wxlTNaaENqCLcX/ROTuCm28mjyUat8x5UlYa79 rKPfCjkRRfH9m08ZbijFadKGfe9K5X3JiDhKCKT99dWNwcjSfvs+Ia2bVDvBq4SO2uJkyfpHGzkUvTG6kSUi37HXly01nwyCB+U= X-Rspamd-Queue-Id: 4F27Hk5pcbz3CSY X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 24.53.0.21 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; FREEMAIL_FROM(0.00)[videotron.ca]; R_SPF_ALLOW(-0.20)[+ip4:24.53.0.20/30]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_TO(0.00)[aim.com]; RCVD_IN_DNSWL_LOW(-0.10)[24.53.0.21:from]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:24.53.0.0/18, country:CA]; MID_RHS_MATCH_FROM(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[24.53.0.21:from]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[24.53.0.21:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:34:59 -0000 Exactly normally it=E2=80=99s the parents that tell their children to leave t= he house for the streets but now we have Jerry that chooses to hit the stree= ts on his own while all his brethren beg him to stick around and open his ey= es...=20 Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 11:09, Aim via freebsd-questions a =C3=A9crit : >=20 > =EF=BB=BFOn Fri, 19 Mar 2021 10:10:40 -0400 > Jerry wrote: >=20 >> With the soon-to-be release of version 13 of FreeBSD and the EOL of >> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD?s >> unfortunate inability to squash bug >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >> with no choice but to seek out a new OS. I need a bare-bones system >> that can run a mail server, Postfix with Dovecot, and a few other >> utilities. >>=20 >> --=20 >> Jerry >=20 > https://distrowatch.com/ >=20 > Plenty of choices there. Download a live instance of something that strike= s your fancy, insure it drives your problem interface and enjoy. >=20 > Vlad >=20 > --=20 >=20 > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.or= g" From owner-freebsd-questions@freebsd.org Fri Mar 19 15:50:52 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6F829578E82 for ; Fri, 19 Mar 2021 15:50:52 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F27f35073z3D6v for ; Fri, 19 Mar 2021 15:50:51 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from point.uchicago.edu (point.uchicago.edu [128.135.52.6]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 12CAF4E678; Fri, 19 Mar 2021 10:50:51 -0500 (CDT) Subject: Re: OS to replace FreeBSD To: Paul Cc: freebsd-questions@freebsd.org References: From: Valeri Galtsev Message-ID: <8b67da35-29e2-4930-ff86-f6af0814a019@kicp.uchicago.edu> Date: Fri, 19 Mar 2021 10:50:49 -0500 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.7.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4F27f35073z3D6v X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [-2.90 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[videotron.ca]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 15:50:52 -0000 On 3/19/21 10:24 AM, Paul wrote: > Sendmail is good enough for Microsoft Outlook Exchange Servers and Apple > ICloud but it’s not good enough for poor Jerry. Maybe you should upgrade > to their commercial version if you think that the open source is not > serving you massively enough. They are serving more than 1/2 of the > Fortune 500 companies maybe even your favorite Mike Dell but poor Jerry > doesn’t like it... https://www.proofpoint.com/us/customer-stories > > Paul, do not mock people who prefer postfix. And I am NOT Jerry, BTW. But you forced me. Some 20+ years back it was fresh in everyone's memory that the worm used sendmail bug and did a lot of damage on the internet (everybody remembers the name of the guy who wrote the worm, right?). So, back then when I was deciding what SMTP server I run, here were the decisive factors: 1. Postfix is written (by brilliant guy Vietse Venema working then for IBM) from scratch with security in mind. It has several separate components. Most notably: the daemon that is listening to the SMTP (SMTPS) port(s) and the only component that is exposed to external world is very simple short code that just communicates, checks what's necessary and accepts message for further processing. It is very hard to have overlooked bugs in simple short program. And that daemon runs as regular user. Sendmail (at that time at least) was one huge program (hence it is much harder to debug and make it clean) that did everything, including listening to internet, and the daemon runs as user root. That is really big difference security wise. 2. This did not matter at the moment of making choice, but over years I became really appreciative of this: postfix has plain ASCII configuration files, which clear logic. And you read the file that IS used by the server running. I know, things have changed since long time ago, and sendmail is secure, etc. But the above still is true to a significant extent. And, BTW, as all sysadmins I did not miss a chapter: "configuring and running sendmail". And I can (to an extent) edit sendmail's "low level" config files directly (not only config file from which these are "compiled"), which loosely compares to editing assembly code vs high level programming language code ;-) Yet, I still prefer postfix's plain ASCII config files. I do not believe you made me write this. Valeri > Envoyé de mon iPhone > >> Le 19 mars 2021 à 11:06, Valeri Galtsev a >> écrit : >> >>  >> >> On 3/19/21 9:42 AM, Paul wrote: >>> Or you could try not being lazy and fixing the bug yourself it’s an >>> open source software and you’re free to rewrite the kernel however >>> you like so don’t play these games with us if freebsd is good enough >>> for Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , >>> IT SHOULD BE GOOD ENOUGH FOR JERRY, so don’t play this game with us >>> and sendmail.org is the default mail server not postfix... >> >> I join you on all counts... but I for one always replace sendmail with >> postfix since forever (for over 2 decades). But of course, I will >> refrain to list my (and other people) reasons. >> >> Valeri >> >>> Envoyé de mon iPad >>>> Le 19 mars 2021 à 10:34, Matthias Gamsjager a >>>> écrit : >>>> >>>> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >>>> >>>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >>>>> unfortunate inability to squash bug >>>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >>>>> with no choice but to seek out a new OS. I need a bare-bones system >>>>> that can run a mail server, Postfix with Dovecot, and a few other >>>>> utilities. >>>>> >>>>> -- >>>>> Jerry >>>>> >>>> >>>> Not sure what you want to hear. You could also try a different >>>> motherboard. >>>> _______________________________________________ >>>> freebsd-questions@freebsd.org mailing list >>>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>>> To unsubscribe, send any mail to >>>> "freebsd-questions-unsubscribe@freebsd.org" >>> _______________________________________________ >>> freebsd-questions@freebsd.org mailing list >>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>> To unsubscribe, send any mail to >>> "freebsd-questions-unsubscribe@freebsd.org" >> >> -- >> ++++++++++++++++++++++++++++++++++++++++ >> Valeri Galtsev >> Sr System Administrator >> Department of Astronomy and Astrophysics >> Kavli Institute for Cosmological Physics >> University of Chicago >> Phone: 773-702-4247 >> ++++++++++++++++++++++++++++++++++++++++ >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to >> "freebsd-questions-unsubscribe@freebsd.org" -- ++++++++++++++++++++++++++++++++++++++++ Valeri Galtsev Sr System Administrator Department of Astronomy and Astrophysics Kavli Institute for Cosmological Physics University of Chicago Phone: 773-702-4247 ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Fri Mar 19 16:04:46 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 469D7579079 for ; Fri, 19 Mar 2021 16:04:46 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt42.smtp-out.videotron.ca (alt42.smtp-out.videotron.ca [23.233.128.29]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F27y52VRXz3F5B for ; Fri, 19 Mar 2021 16:04:45 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([169.57.185.92]) by Videotron with SMTP id NHc7l0IJaJ2slNHc9ltjai; Fri, 19 Mar 2021 12:04:43 -0400 X-Authority-Analysis: v=2.3 cv=UrkdyN4B c=1 sm=1 tr=0 a=BD8lSONnhCUYeXsYlf6QRw==:117 a=BD8lSONnhCUYeXsYlf6QRw==:17 a=IkcTkHD0fZMA:10 a=RpNjiQI2AAAA:8 a=sa8qx-EqAAAA:8 a=pGLkceISAAAA:8 a=AfEfcmvjAAAA:8 a=6I5d2MoRAAAA:8 a=B8UgiwIiZSm2lE5V23EA:9 a=QEXdDO2ut3YA:10 a=pTfG0XxAYjkA:10 a=xIDnvljIO3wZ5qv32AfX:22 a=IjZwj45LgO3ly-622nXo:22 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 12:04:36 -0400 Message-Id: References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: Valeri Galtsev X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfEXU3207P0L1vns1XELUeivzG64pm76iu3zYqZUJQtRF17JP328VMOff81YWx02+zGNP8UEuiypXIYLsu4vehe5LbAfjm0LF+InbP9SmIn2GoO7Laxzt Q2trppShC+Tx6vVl26bvILpvt5iquIZRN8rxN5OvXyUZsMMrN9ySnJCgym4tpnV6aGrIjSljkuVWrDzft9DCtf8zKHy8praIJd3EDHOzDaKkPdvdeI+PmT2Y X-Rspamd-Queue-Id: 4F27y52VRXz3F5B X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 23.233.128.29 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[23.233.128.29:from]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:23.233.128.28/30:c]; MIME_GOOD(-0.10)[text/plain]; FREEMAIL_FROM(0.00)[videotron.ca]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[23.233.128.29:from:127.0.2.255]; RCVD_IN_DNSWL_LOW(-0.10)[23.233.128.29:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:23.233.128.0/18, country:CA]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:04:46 -0000 You are free to use Postfix , I was not mocking Postfix users I was justifyi= ng the use of Sendmail as the default mail server in Bsd.=20 The person who created the virus was Dr. Robert T. Morris, MIT Professor... Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 11:50, Valeri Galtsev a= =C3=A9crit : >=20 > =EF=BB=BF >=20 >> On 3/19/21 10:24 AM, Paul wrote: >> Sendmail is good enough for Microsoft Outlook Exchange Servers and Apple I= Cloud but it=E2=80=99s not good enough for poor Jerry. Maybe you should upgr= ade to their commercial version if you think that the open source is not ser= ving you massively enough. They are serving more than 1/2 of the Fortune 500= companies maybe even your favorite Mike Dell but poor Jerry doesn=E2=80=99t= like it... https://www.proofpoint.com/us/customer-stories >=20 > Paul, do not mock people who prefer postfix. And I am NOT Jerry, BTW. >=20 > But you forced me. Some 20+ years back it was fresh in everyone's memory t= hat the worm used sendmail bug and did a lot of damage on the internet (ever= ybody remembers the name of the guy who wrote the worm, right?). So, back th= en when I was deciding what SMTP server I run, here were the decisive factor= s: >=20 > 1. Postfix is written (by brilliant guy Vietse Venema working then for IBM= ) from scratch with security in mind. It has several separate components. Mo= st notably: the daemon that is listening to the SMTP (SMTPS) port(s) and the= only component that is exposed to external world is very simple short code t= hat just communicates, checks what's necessary and accepts message for furth= er processing. It is very hard to have overlooked bugs in simple short progr= am. And that daemon runs as regular user. Sendmail (at that time at least) w= as one huge program (hence it is much harder to debug and make it clean) tha= t did everything, including listening to internet, and the daemon runs as us= er root. >=20 > That is really big difference security wise. >=20 > 2. This did not matter at the moment of making choice, but over years I be= came really appreciative of this: postfix has plain ASCII configuration file= s, which clear logic. And you read the file that IS used by the server runni= ng. >=20 > I know, things have changed since long time ago, and sendmail is secure, e= tc. But the above still is true to a significant extent. >=20 > And, BTW, as all sysadmins I did not miss a chapter: "configuring and runn= ing sendmail". And I can (to an extent) edit sendmail's "low level" config f= iles directly (not only config file from which these are "compiled"), which l= oosely compares to editing assembly code vs high level programming language c= ode ;-) Yet, I still prefer postfix's plain ASCII config files. >=20 >=20 > I do not believe you made me write this. >=20 > Valeri >=20 >> Envoy=C3=A9 de mon iPhone >>>> Le 19 mars 2021 =C3=A0 11:06, Valeri Galtsev a =C3=A9crit : >>>=20 >>> =EF=BB=BF >>>=20 >>> On 3/19/21 9:42 AM, Paul wrote: >>>> Or you could try not being lazy and fixing the bug yourself it=E2=80=99= s an open source software and you=E2=80=99re free to rewrite the kernel howe= ver you like so don=E2=80=99t play these games with us if freebsd is good en= ough for Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT= SHOULD BE GOOD ENOUGH FOR JERRY, so don=E2=80=99t play this game with us an= d sendmail.org is the default mail server not postfix... >>>=20 >>> I join you on all counts... but I for one always replace sendmail with p= ostfix since forever (for over 2 decades). But of course, I will refrain to l= ist my (and other people) reasons. >>>=20 >>> Valeri >>>=20 >>>> Envoy=C3=A9 de mon iPad >>>>> Le 19 mars 2021 =C3=A0 10:34, Matthias Gamsjager a =C3=A9crit : >>>>>=20 >>>>> =EF=BB=BFOn Fri, 19 Mar 2021 at 15:16, Jerry wro= te: >>>>>=20 >>>>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80= =99s >>>>>> unfortunate inability to squash bug >>>>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left= >>>>>> with no choice but to seek out a new OS. I need a bare-bones system >>>>>> that can run a mail server, Postfix with Dovecot, and a few other >>>>>> utilities. >>>>>>=20 >>>>>> -- >>>>>> Jerry >>>>>>=20 >>>>>=20 >>>>> Not sure what you want to hear. You could also try a different motherb= oard. >>>>> _______________________________________________ >>>>> freebsd-questions@freebsd.org mailing list >>>>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>>>> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebs= d.org" >>>> _______________________________________________ >>>> freebsd-questions@freebsd.org mailing list >>>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>>> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd= .org" >>>=20 >>> --=20 >>> ++++++++++++++++++++++++++++++++++++++++ >>> Valeri Galtsev >>> Sr System Administrator >>> Department of Astronomy and Astrophysics >>> Kavli Institute for Cosmological Physics >>> University of Chicago >>> Phone: 773-702-4247 >>> ++++++++++++++++++++++++++++++++++++++++ >>> _______________________________________________ >>> freebsd-questions@freebsd.org mailing list >>> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >>> To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.= org" >=20 > --=20 > ++++++++++++++++++++++++++++++++++++++++ > Valeri Galtsev > Sr System Administrator > Department of Astronomy and Astrophysics > Kavli Institute for Cosmological Physics > University of Chicago > Phone: 773-702-4247 > ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Fri Mar 19 16:10:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 20F795792FB for ; Fri, 19 Mar 2021 16:10:23 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from johnea.net (johnea.net [75.60.233.73]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F284Z2BzMz3DvX for ; Fri, 19 Mar 2021 16:10:22 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from [192.168.100.201] (w520.johnea.net [192.168.100.201]) (using TLSv1 with cipher AES128-SHA (128/128 bits)) (No client certificate requested) by johnea.net (Postfix) with ESMTPSA id 07D165F236F4 for ; Fri, 19 Mar 2021 09:10:19 -0700 (PDT) Subject: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> From: freebsd@johnea.net Message-ID: <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> Date: Fri, 19 Mar 2021 09:10:19 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319110001.00000bf8@seibercom.net> Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4F284Z2BzMz3DvX X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=pass (policy=none) header.from=johnea.net; spf=pass (mx1.freebsd.org: domain of freebsd@johnea.net designates 75.60.233.73 as permitted sender) smtp.mailfrom=freebsd@johnea.net X-Spamd-Result: default: False [-3.90 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[75.60.233.73:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:75.60.233.73]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[75.60.233.73:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[johnea.net,none]; FROM_NO_DN(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7018, ipnet:75.48.0.0/12, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[75.60.233.73:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:10:23 -0000 On 3/19/21 8:00 AM, Jerry wrote: > On Fri, 19 Mar 2021 10:42:04 -0400, Paul stated: >>> Le 19 mars 2021 à 10:34, Matthias Gamsjager a >>> écrit : >>> >>> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >>> >>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >>>> unfortunate inability to squash bug >>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >>>> with no choice but to seek out a new OS. I need a bare-bones system >>>> that can run a mail server, Postfix with Dovecot, and a few other >>>> utilities. >>>> >>>> -- >>>> Jerry >>>> >>> >>> Not sure what you want to hear. You could also try a different >>> motherboard. _______________________________________________ > >> Or you could try not being lazy and fixing the bug yourself it’s an >> open source software and you’re free to rewrite the kernel however you >> like so don’t play these games with us if freebsd is good enough for >> Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT >> SHOULD BE GOOD ENOUGH FOR JERRY, so don’t play this game with us and >> sendmail.org is the default mail server not postfix... >> >> Envoyé de mon iPad To anyone who has read the bug report, this is clearly a serious regression issue on certain USB (probably 3) host controller hardware. Those same unread individuals claim anyone unlucky enough to have purchased affected hardware should: 1) Read several million lines of code 2) Become an expert in low level kernel debug of USB/PCI/ACPI issues 3) bisect, build, and debug several dozen kernels that may, or may not, work with an installed userland, or even compile for that matter. Anyone not ready to jump into this fray is "lazy". Why? because the "source" is available. Ironically, the info in these accusatory emails demonstrates these individuals have not even made the effort to read the bug report before hurling their insults. > > Obviously, you are of no assistance. > Well said Jerry. This is clearly a regression with 11.x kernels being unaffected. As such, the 11 series should NOT be EOL'd until resolution of this issue reached. This is a request to the release engineering team to please continue to support 11.x until USB3 issues in 12.x and 13.x are resolved. Thank you... johnea p.s. This is not a thread about email servers. From owner-freebsd-questions@freebsd.org Fri Mar 19 16:16:43 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 683D7579ABD for ; Fri, 19 Mar 2021 16:16:43 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt42.smtp-out.videotron.ca (alt42.smtp-out.videotron.ca [23.233.128.29]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F28Ct3K9dz3Fvl for ; Fri, 19 Mar 2021 16:16:42 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([189.1.169.145]) by Videotron with SMTP id NHnfl0K5nJ2slNHnjltkgb; Fri, 19 Mar 2021 12:16:41 -0400 X-Authority-Analysis: v=2.3 cv=UrkdyN4B c=1 sm=1 tr=0 a=kWMK5e0XekNDq/06YhufdQ==:117 a=kWMK5e0XekNDq/06YhufdQ==:17 a=IkcTkHD0fZMA:10 a=Tw93OqNOAAAA:8 a=pGLkceISAAAA:8 a=AfEfcmvjAAAA:8 a=6I5d2MoRAAAA:8 a=sa8qx-EqAAAA:8 a=3G0GgwMM-U8RX77G_gQA:9 a=QEXdDO2ut3YA:10 a=tojzhCJciAGkLn-TEnmn:22 a=xIDnvljIO3wZ5qv32AfX:22 a=IjZwj45LgO3ly-622nXo:22 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 12:16:33 -0400 Message-Id: References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: freebsd@johnea.net X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfPfwrTa4yaJQnLTWNBAJow6tAnVBNXhBls6T0ChrWrApJ/kwNoKMYxOm6VPh4Gw2JraII6+fLUlnHBgBaqax8Sgf2dRyYNB9lE1pVXgw2h8XCrTTLam+ U4ZXDNe/0VQAhOelWWUwUfT3qj068aFJDk+WgHdV/JgNL7Y4y6ecYODVHeg+ihOKowUP3HnmsLu+NAS8YncNBJVHXrABIHfkZ4k= X-Rspamd-Queue-Id: 4F28Ct3K9dz3Fvl X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 23.233.128.29 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[23.233.128.29:from]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:23.233.128.28/30:c]; MIME_GOOD(-0.10)[text/plain]; FREEMAIL_FROM(0.00)[videotron.ca]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[23.233.128.29:from:127.0.2.255]; RCVD_IN_DNSWL_LOW(-0.10)[23.233.128.29:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:23.233.128.0/18, country:CA]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:16:43 -0000 disable USB3 onboard and recompile without it. add a card with a known-food controller. Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 12:10, freebsd@johnea.net a =C3=A9crit : >=20 > =EF=BB=BFOn 3/19/21 8:00 AM, Jerry wrote: >> On Fri, 19 Mar 2021 10:42:04 -0400, Paul stated: >>>> Le 19 mars 2021 =C3=A0 10:34, Matthias Gamsjager = a >>>> =C3=A9crit : >>>>=20 >>>> =EF=BB=BFOn Fri, 19 Mar 2021 at 15:16, Jerry wrot= e: >>>>=20 >>>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99= s >>>>> unfortunate inability to squash bug >>>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >>>>> with no choice but to seek out a new OS. I need a bare-bones system >>>>> that can run a mail server, Postfix with Dovecot, and a few other >>>>> utilities. >>>>>=20 >>>>> -- >>>>> Jerry >>>>>=20 >>>>=20 >>>> Not sure what you want to hear. You could also try a different >>>> motherboard. _______________________________________________ >>=20 >>> Or you could try not being lazy and fixing the bug yourself it=E2=80=99s= an >>> open source software and you=E2=80=99re free to rewrite the kernel howev= er you >>> like so don=E2=80=99t play these games with us if freebsd is good enough= for >>> Apple in their build of xnu , Microsoft and Seagate, ARM, etc. , IT >>> SHOULD BE GOOD ENOUGH FOR JERRY, so don=E2=80=99t play this game with us= and >>> sendmail.org is the default mail server not postfix... >>>=20 >>> Envoy=C3=A9 de mon iPad >=20 > To anyone who has read the bug report, this is clearly a serious regressio= n issue on certain USB (probably 3) host controller hardware. >=20 > Those same unread individuals claim anyone unlucky enough to have purchase= d affected hardware should: >=20 > 1) Read several million lines of code >=20 > 2) Become an expert in low level kernel debug of USB/PCI/ACPI issues >=20 > 3) bisect, build, and debug several dozen kernels that may, or may not, wo= rk with an installed userland, or even compile for that matter. >=20 > Anyone not ready to jump into this fray is "lazy". Why? because the "sourc= e" is available. >=20 > Ironically, the info in these accusatory emails demonstrates these individ= uals have not even made the effort to read the bug report before hurling the= ir insults. >=20 >>=20 >> Obviously, you are of no assistance. >>=20 >=20 > Well said Jerry. >=20 > This is clearly a regression with 11.x kernels being unaffected. As such, t= he 11 series should NOT be EOL'd until resolution of this issue reached. >=20 > This is a request to the release engineering team to please continue to su= pport 11.x until USB3 issues in 12.x and 13.x are resolved. >=20 > Thank you... >=20 > johnea >=20 > p.s. This is not a thread about email servers. > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.or= g" From owner-freebsd-questions@freebsd.org Fri Mar 19 16:22:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C562C579BCF for ; Fri, 19 Mar 2021 16:22:06 +0000 (UTC) (envelope-from 4250.82.1d4ce0003790005.e5032095e3404ed574aa093d02673ca3@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F28L55vXKz3Fx6 for ; Fri, 19 Mar 2021 16:22:05 +0000 (UTC) (envelope-from 4250.82.1d4ce0003790005.e5032095e3404ed574aa093d02673ca3@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616170926; x=1618762926; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=5v2xA0rmJPLLVLFEHunlSorEZs9M2Rdl6chgofG/UI8=; b=q4KYQz3y1E0HSLyUhsfikkrQgauxnLKKtgfQ5ZB8GPQIHPtgT3rj4fIzd6X+RyrsfmKScxJIC48lvMes9xiRkhecIOLWrv1rsaY/r542ZRuoyXVomx5xBykokVnItr/t2vw7eikYU0ZnSaoYrufJ0qeg0kYmzzDmTJw9OeTprO8= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDM3OTAwMDUuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r4.h.in.socketlabs.com (s1-b40f.socketlabs.email-od.com [142.0.180.15]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Fri, 19 Mar 2021 12:21:55 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r4.h.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Fri, 19 Mar 2021 12:21:54 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lNHsm-000KeG-Ot; Fri, 19 Mar 2021 16:21:52 +0000 Date: Fri, 19 Mar 2021 16:21:52 +0000 From: Steve O'Hara-Smith To: freebsd@johnea.net Cc: freebsd-questions@freebsd.org Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD Message-Id: <20210319162152.08e5fba74e4d3228c859617c@sohara.org> In-Reply-To: <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F28L55vXKz3Fx6 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=q4KYQz3y; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce0003790005.e5032095e3404ed574aa093d02673ca3@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce0003790005.e5032095e3404ed574aa093d02673ca3@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[sohara.org]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce0003790005.e5032095e3404ed574aa093d02673ca3@email-od.com]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce0003790005.e5032095e3404ed574aa093d02673ca3@email-od.com]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:22:06 -0000 On Fri, 19 Mar 2021 09:10:19 -0700 freebsd@johnea.net wrote: > This is a request to the release engineering team to please continue to > support 11.x until USB3 issues in 12.x and 13.x are resolved. I doubt very much that anyone in that team will have read your request (@freebsd.org addresses are not common among posters here) - if you want it to be heard by people who can do anything with it you will have to make it more directly. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Fri Mar 19 16:26:53 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 219BD579D5D for ; Fri, 19 Mar 2021 16:26:53 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pl1-x62c.google.com (mail-pl1-x62c.google.com [IPv6:2607:f8b0:4864:20::62c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F28Rc3P5Vz3GBT for ; Fri, 19 Mar 2021 16:26:52 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pl1-x62c.google.com with SMTP id h20so3200344plr.4 for ; Fri, 19 Mar 2021 09:26:52 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=nBCNEaeCqLvv3hu7I7AimXCOgK4esmxkXw2bXClW1gc=; b=DXnYOjch1Qd8hSx4yli9WJWy1cpfEWLLVaMq1fGiS46rfXnuZDz4aPPWk1ZPAC/Gs7 sQiKLYu8tF/LaSgDv1gqEliWdPpb06m57PYie2gUkGUfxEeulcnmRaMxXpD//JCte5GI G75GWEGR0Nf0Idfpv75g666i7n887gGk1XVhGjCpzFhNFamqLTDGd+bK0gkRn2Z7lmPk HRuE8HeKx3iYbThzNPNPlZyrlfXmxRZNN0e19m85y6+THEN3Emv2GBOD7G8ykPjSNBi/ qpkUSvGWoGr8xBRAmqzjce8WWIvr+JKskEJFS53laFoAoBmfz2k4Qu6y4PeNF4toWTm7 Gx3A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:mime-version :content-transfer-encoding; bh=nBCNEaeCqLvv3hu7I7AimXCOgK4esmxkXw2bXClW1gc=; b=s0GWaPta7r5VEfWgWKRdeeV/6ptX4H6SsGcwmxAdMkQdTwwi3V58csPWMjptaoPxgV ezmdgL6XmmAlPgZBuFuIy46cVHWbvJ77llEJNeiiSW30e+GxgfuqANpf5AUNVHNqDWwX Qv4et7vbEob1Zrm/e+/U++D7nreQv5zemeK7p7c/+Gf7lHCJn9fXAOXXFluh4nDblKWJ cJkCFKHO+CS1oJAzUyhUz5+v08oXAk284OUes+B5+CYq460bsJ3lF5IFaYBV8mBaiUzM Kk8McnM+lYWiUnsEcIladHClwhXg6DB7jAjJFFT/ZVYsVEfosJaBQulqJxBfmvEtBMyf H9Hg== X-Gm-Message-State: AOAM532rq9w68RnJyhyCOkDZwAdnr5JGylLP5oxOY+SOm4b/FI0Ofvhd BAoftF76rzTls0GYm2yhEJG5UokavDeQ7Uft X-Google-Smtp-Source: ABdhPJymF2Z50Amhj+YWpcCIhzsMyjPMQJPneXLCFrIzT0i9RANFINB0r8oyF+f8n5VSue958mzVLw== X-Received: by 2002:a17:90b:100a:: with SMTP id gm10mr10428153pjb.0.1616171210733; Fri, 19 Mar 2021 09:26:50 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id v26sm5780257pff.195.2021.03.19.09.26.50 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 09:26:50 -0700 (PDT) Date: Fri, 19 Mar 2021 10:26:49 -0600 From: Duke Normandin To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210319102649.2bace327e17eca8602877618@gmail.com> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F28Rc3P5Vz3GBT X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=DXnYOjch; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::62c as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-2.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; MV_CASE(0.50)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; FAKE_REPLY(1.00)[]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::62c:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::62c:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::62c:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:26:53 -0000 On Thu, 18 Mar 2021 23:44:45 -0700 Kevin Oberman wrote: > Exactly. It replaces fdisk and bsdlabel. Much obliged for the advice and example!! But I could do all of that with fdisk/cfdisk! Other than being GUI-based, is there any distinct advantage to using GPT? I've used GPT/Gparted on a few occasions in the past when messing with various Debian-based distros install. The colour scheme used was so faint that I had a rough time grokking what I was looking at. That never happened with fdisk. Just saying .... While on the subject of booting and partitioning etc, I've included below, 2 Dropbox links of images of my ASUS BIOS. Would you be in a position to explain to me what AHCI vs IDE is? As well, I see that I can enable/disable UEFI and PXE ROM. What is PXE ROM? Given that ASUS laptop will NEVER again have any microsoft products loaded/running on it, do I need UEFI enabled? https://www.dropbox.com/s/wqatyrlsdatzkaa/BIOS1.JPG?dl=0 https://www.dropbox.com/s/1ojod4f8ad3zo59/BIOS2.jpg?dl=0 -- Duke Normandin From owner-freebsd-questions@freebsd.org Fri Mar 19 16:43:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9A1CE57A377 for ; Fri, 19 Mar 2021 16:43:06 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from johnea.net (johnea.net [75.60.233.73]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F28pK68ykz3H7c for ; Fri, 19 Mar 2021 16:43:05 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from [192.168.100.201] (w520.johnea.net [192.168.100.201]) (using TLSv1 with cipher AES128-SHA (128/128 bits)) (No client certificate requested) by johnea.net (Postfix) with ESMTPSA id 849255F236F4 for ; Fri, 19 Mar 2021 09:43:04 -0700 (PDT) Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <20210319162152.08e5fba74e4d3228c859617c@sohara.org> From: freebsd@johnea.net Message-ID: Date: Fri, 19 Mar 2021 09:43:04 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319162152.08e5fba74e4d3228c859617c@sohara.org> Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F28pK68ykz3H7c X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=pass (policy=none) header.from=johnea.net; spf=pass (mx1.freebsd.org: domain of freebsd@johnea.net designates 75.60.233.73 as permitted sender) smtp.mailfrom=freebsd@johnea.net X-Spamd-Result: default: False [-3.90 / 15.00]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_TLS_ALL(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[75.60.233.73:from]; R_SPF_ALLOW(-0.20)[+ip4:75.60.233.73:c]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[75.60.233.73:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MID_RHS_MATCH_FROM(0.00)[]; FROM_NO_DN(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[johnea.net,none]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7018, ipnet:75.48.0.0/12, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[75.60.233.73:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:43:06 -0000 On 3/19/21 9:21 AM, Steve O'Hara-Smith wrote: > On Fri, 19 Mar 2021 09:10:19 -0700 > freebsd@johnea.net wrote: > >> This is a request to the release engineering team to please continue to >> support 11.x until USB3 issues in 12.x and 13.x are resolved. > > I doubt very much that anyone in that team will have read your > request (@freebsd.org addresses are not common among posters here) - if you > want it to be heard by people who can do anything with it you will have to > make it more directly. > Thank you Steve, Resent to: re@freebsd.org From owner-freebsd-questions@freebsd.org Fri Mar 19 16:52:34 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A367B57A82C for ; Fri, 19 Mar 2021 16:52:34 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F291G3Cpdz3Hyn for ; Fri, 19 Mar 2021 16:52:34 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 6BD2257A76E; Fri, 19 Mar 2021 16:52:34 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 6B93057A8C9 for ; Fri, 19 Mar 2021 16:52:34 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F291F4wRYz3HnF for ; Fri, 19 Mar 2021 16:52:33 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1616172751; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=2XfZFaxUVm5Gm2vAg9niH/TdPto=; b=CTzbd+Q9CiKTi9K2JC8VRzGE2s4dMwfFcBokvlWv+Mos09z2v4WUhh3I6mEw8XkX /JDgmerOtb8PB3AVQ3m2nHQFh9RXGEI216LY7odoeLxAoVB2w7/yScAuTqCFbLXL YK+GzjHj2lGyDumhUn/WxQd39Icxk/JtBXqKnrGha5PtFMtNaY138j017PQbrij1 YpVlnqF4VttBmId764YRyuYbyK6JkfQse0RESNNjZKk80uVjZR2XfhKfJx+/iALm CqPxzTMp2pD5vfttSPhkkH7radw/kp9XcEq/UYgPepl5PYA/PO9JhJb6SvhhckUS XI5ySC4w5epwKBVTiHfvmQ==; X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:56678] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id 64/18-54468-FC6D4506; Fri, 19 Mar 2021 12:52:31 -0400 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit Message-ID: <24660.54990.961632.559429@jerusalem.litteratus.org> Date: Fri, 19 Mar 2021 12:52:30 -0400 From: Robert Huff To: Duke Normandin CC: questions@freebsd.org Subject: Re: Partitioning 1T HDD In-Reply-To: <20210319102649.2bace327e17eca8602877618@gmail.com> References: <20210319102649.2bace327e17eca8602877618@gmail.com> X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verdict: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledrudefkedgleehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuufgjpfetvefqtfdptfevpfdpqfgfvfenuceurghilhhouhhtmecufedtudenucenucfjughrpeggtgfgkfffhffvufgjfhfosehtjeertdertddvnecuhfhrohhmpeftohgsvghrthcujfhufhhfuceorhhosggvrhhthhhufhhfsehrtghnrdgtohhmqeenucggtffrrghtthgvrhhnpedttdelkeethfeggefgveelueegvdeludehueeuvdegjeeivdffiefffeethffgueenucfkphepvddtledriedrvdeftddrgeeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledriedrvdeftddrgeeknedpmhgrihhlfhhrohhmpehrohgsvghrthhhuhhffhesrhgtnhdrtghomhenpdhrtghpthhtohepshhiughnvgihrdhrvghilhhlvgihrdhiihesghhmrghilhdrtghomhen X-Vade-Client: RCN X-Rspamd-Queue-Id: 4F291F4wRYz3HnF X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=CTzbd+Q9; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-3.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24]; DKIM_TRACE(0.00)[rcn.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; INTRODUCTION(2.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[69.168.97.78:from]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; MIME_TRACE(0.00)[0:+]; RCVD_IN_DNSWL_LOW(-0.10)[69.168.97.78:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[text/plain]; DWL_DNSWL_LOW(-1.00)[rcn.com:dkim]; SPAMHAUS_ZRD(0.00)[69.168.97.78:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[69.168.97.78:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 16:52:34 -0000 Duke Normandin writes: > Other than being GUI-based, is there any distinct advantage to > using GPT? Um ... I have used GPT for about 10 years. Never have I used it with a GUI. Respectfully, Robert Huff -- Hello ... my name is SARS-CoV-2. You are not wearing a mask? Prepare to die! From owner-freebsd-questions@freebsd.org Fri Mar 19 17:03:09 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 888B857B111 for ; Fri, 19 Mar 2021 17:03:09 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qt1-x82f.google.com (mail-qt1-x82f.google.com [IPv6:2607:f8b0:4864:20::82f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29FS4gVYz3JZx for ; Fri, 19 Mar 2021 17:03:08 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qt1-x82f.google.com with SMTP id c6so7279965qtc.1 for ; Fri, 19 Mar 2021 10:03:08 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=HNG+oo2TjjrfKDX1iP8fPzAtMEtEYjDKoVhNdRtlfDY=; b=Hx/q1hqqgb5Z145H2MiJnB5tOsv9KAk7s5W/z8vskhPMraKUZhWitQLh4sb3jJID/z Qu+EY0qm7zRUIjnUyk5YIH/6W9RUBpmQq60Uyhc+kstnrr0zViNJr2RaWuFBkgB8U1n+ /z0oeROwtj4nSik4Cw0MbK0IpRCw6yzPLrj3k= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=HNG+oo2TjjrfKDX1iP8fPzAtMEtEYjDKoVhNdRtlfDY=; b=LfnxBa5AhqOQ12tlqy5b9DpT6rOusE//vYq8bscp4TIHkSFmTd1/yuaCGoMqZAzxNC bSVTHKmXe211w8Odg3zn0qUPMh2DkcaLKpAcsOY+fysGVzqUiZ1Jem/Stzqg2kuSdwVA 1iLfgCGjPj6eMVfClHWhoPNHsl2RSJKLBjba+KJTvKIU9WnMQbGCWuN4zWtqVR0U17tt xhwohiOrcNPY4RJTnQqoU/ge+7NNqXDrk/LcByFqe4bgeNxmmA4j/e0fcsOYuu7dJ2Y9 lc56/FOuoQlw3jOFFOfssZwg3mRGJR2lhmwr+BxNO5ZaURm2du3HIeCLUgn1p99j/IRB irFg== X-Gm-Message-State: AOAM531hfu1blPopuASYweltx22GPLc9sFYBasmEvnDm9taZju5gRG8/ xGTAkhCMs79CzXtMkFdYONcFKpFXWBiZ/A== X-Google-Smtp-Source: ABdhPJy3P4/7PBYxm29BhrUPyIy/06eleLRGd+jspxAa6R2ASsbTIkTYX63Nsm7i1wqzpFDF7c3ioA== X-Received: by 2002:ac8:a04:: with SMTP id b4mr9216256qti.376.1616173387297; Fri, 19 Mar 2021 10:03:07 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id f186sm4919469qkj.106.2021.03.19.10.03.06 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 10:03:06 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F29FP4CSRz1y47 for ; Fri, 19 Mar 2021 13:03:05 -0400 (EDT) Date: Fri, 19 Mar 2021 13:02:49 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319130249.000042a1@seibercom.net> In-Reply-To: <6054BE1B.50706@gmail.com> References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/oc0mlqvzh52RP9m1Eq6vDL."; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F29FS4gVYz3JZx X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=Hx/q1hqq; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::82f as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.39 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-0.86)[-0.864]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::82f:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::82f:from:127.0.2.255]; NEURAL_SPAM_LONG(0.85)[0.850]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::82f:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:03:09 -0000 --Sig_/oc0mlqvzh52RP9m1Eq6vDL. Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 11:07:07 -0400, Ernie Luzar stated: >Matthias Gamsjager wrote: >> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >> =20 >>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=C3=A2= =E2=82=AC=E2=84=A2s >>> unfortunate inability to squash bug >>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >>> with no choice but to seek out a new OS. I need a bare-bones system >>> that can run a mail server, Postfix with Dovecot, and a few other >>> utilities. >>> =20 > This sounds like only 2 things. 1. Something in your hardware tower > is=20 >falling. 2. The way you updated from one release to another something=20 >went wrong. > >I would start with a clean build of release 12.2 using a disk drive on >a usb stick. See if problem is still there. If so you have hardware=20 >problem and no amount of PR is going to fix that. There was nothing failing; it was a brand new PC. I have done the clean install with both 12.0 and 12.2, with the same results. If you actually read through the bug report, you would see that I am not the only one with this problem. Apparently, someone reported that you could rebuild the kernel and remove USB3 or something like that, but I have neither the time nor inclination to do that, assuming I could do it. Versions 10 & 11 work fine. This is something that FreeBSD did that screwed up the works. Dell is aware of the problem but will do nothing to attempt to create a work around for it. They claim it is working as specified and every other OS, with the exception of FreeBSD works correctly on that system. I am not going to spend more money to get a system that is happy with FreeBSD. I buy what I want and then get an OS that is capable of operating on it, not the other way around. In any case, I am thinking of either Fedora, Debian or Arch Linux. I was just looking for recommendations from anyone who has used those systems. --=20 Jerry --Sig_/oc0mlqvzh52RP9m1Eq6vDL. Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBU2UEACgkQgHBP8gv9 FXfENAv/WW10SF6xm0+PilDtjLHnGoRO9BgXUQfM6uOJ5MfjQcPath4A2+iXdQtl 3RfTXZNU5cmIRuXY8YFxoPSszIe9RkZAw5jqOJXDRKAPL5zHL2rA2Qjd7GBJ84lK abv9yb1GEeTf3DfjTBmgNkITD+Lw02HZLFqx0pbI6abkQkWBgVRHPEJbBi2tbFt6 wR7qTlfIMINHkTqbbTxhFbOcxqwQHEWegPKTlrceDDxxWac0mzr5fWEUs131QRHe lEFZ5wHRLDY5GP2tl4NMrnR5gC+pQA7jXJKjPloUQcYUoGTO/hn+km5kXirkCHgR d6CvESncJdkwJ7cOW65UkY39YB6zzqd6G2/Ryh/8+IzEsJI0K3RlZPF8iBn2Hv27 jpw1KdPZUw+U+sumGZPjS1Ksp8SKmE+y5/zl9Skzt6Lnm9ACFH70t8XDokNxJPCr QSaWqCZDWD2tep38N+NAH20tYJT3FP0vNWhpYkyaz7OLM5eeSFuaV8jRpkPphXlY IQByW5er =eJ2W -----END PGP SIGNATURE----- --Sig_/oc0mlqvzh52RP9m1Eq6vDL.-- From owner-freebsd-questions@freebsd.org Fri Mar 19 17:07:15 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 80BAD57B23A for ; Fri, 19 Mar 2021 17:07:15 +0000 (UTC) (envelope-from freebsd@qeng-ho.org) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F29LC2WhRz3JRv for ; Fri, 19 Mar 2021 17:07:15 +0000 (UTC) (envelope-from freebsd@qeng-ho.org) Received: by mailman.nyi.freebsd.org (Postfix) id 5685057B239; Fri, 19 Mar 2021 17:07:15 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 564D657B31D for ; Fri, 19 Mar 2021 17:07:15 +0000 (UTC) (envelope-from freebsd@qeng-ho.org) Received: from mailout.qeng-ho.org (mailout.qeng-ho.org [217.155.128.244]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29LC1Zb5z3JdQ for ; Fri, 19 Mar 2021 17:07:15 +0000 (UTC) (envelope-from freebsd@qeng-ho.org) Received: from arthur.home.qeng-ho.org (unknown [IPv6:2a02:8010:64c9:1::2]) by mailout.qeng-ho.org (Postfix) with ESMTP id A77B8568C8; Fri, 19 Mar 2021 17:07:07 +0000 (GMT) Subject: Re: Partitioning 1T HDD To: Robert Huff , Duke Normandin Cc: questions@freebsd.org References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> From: Arthur Chance Message-ID: <6520a1d5-6fbc-6049-a265-bad4bbdb4787@qeng-ho.org> Date: Fri, 19 Mar 2021 17:07:05 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.0 MIME-Version: 1.0 In-Reply-To: <24660.54990.961632.559429@jerusalem.litteratus.org> Content-Type: text/plain; charset=utf-8 Content-Language: en-GB Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F29LC1Zb5z3JdQ X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[]; REPLY(-4.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:07:15 -0000 On 19/03/2021 16:52, Robert Huff wrote: > > Duke Normandin writes: > >> Other than being GUI-based, is there any distinct advantage to >> using GPT? > > Um ... I have used GPT for about 10 years. > Never have I used it with a GUI. I think there's confusion between gpart(1), the FreeBSD command line utility, and Gparted, a GUI based program that runs on other OSes. I also have used GPT disks for about a decade, even on old kit with only an old school BIOS. It's not just the far greater number of partitions that makes it superior, it's the ability to use partition labels regardless of what the partition contains. If you're multibooting it's so much easier having device names like /dev/gpt/fbsdroot in your /etc/fstab rather than having to remember which partition number you used. -- The number of people predicting the demise of Moore's Law doubles every 18 months. From owner-freebsd-questions@freebsd.org Fri Mar 19 17:08:33 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C3EB757B2F1 for ; Fri, 19 Mar 2021 17:08:33 +0000 (UTC) (envelope-from pprocacci@gmail.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F29Mj4F2Gz3Jdt for ; Fri, 19 Mar 2021 17:08:33 +0000 (UTC) (envelope-from pprocacci@gmail.com) Received: by mailman.nyi.freebsd.org (Postfix) id 9148C57AED3; Fri, 19 Mar 2021 17:08:33 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9109957B24D for ; Fri, 19 Mar 2021 17:08:33 +0000 (UTC) (envelope-from pprocacci@gmail.com) Received: from mail-pf1-x42d.google.com (mail-pf1-x42d.google.com [IPv6:2607:f8b0:4864:20::42d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29Mj3XSCz3Jkg for ; Fri, 19 Mar 2021 17:08:33 +0000 (UTC) (envelope-from pprocacci@gmail.com) Received: by mail-pf1-x42d.google.com with SMTP id x184so6330797pfd.6 for ; Fri, 19 Mar 2021 10:08:33 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=XwVx7LDb1NRPhSaH/wnldh+m1nof8ppR95J7I+F9tT4=; b=EKXqmjA1PIBOR+DjpdZ4UktL6uqoh2cOcutrM5ikw63gfR5KLjv559Wge9o0dMbEOO WXENlnJvZoWIS1lEjYAbQQJ2fb+971JvdNm3HG7DHtFUH/8p3V4AXj4/vpEPnpj2TA32 vzxogMeVx6DP1DF7MPrwunYdkjTCKcvsUOkFOAb3qiI5Yy7WlqDjIt1QI4heXznBR6Vb tMXxasrYTWuOTLmAh0/87AzLNhPcjuCF3QElonKt1cWdX2pSdbK/Cppk/BmKB/gwAiIv WjHkX2kWFCCwJ1DqUZ1xoWgTLm6cXD3qrKUa5XHffhHeBm62mekhjXQD3lYs4Gk4WJvN rf5A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=XwVx7LDb1NRPhSaH/wnldh+m1nof8ppR95J7I+F9tT4=; b=Wt3sPt8cfip3TbgrFcKHFsh1N0T8qt2+bSvqpPBv+mz48CgcgVp8tDha7YeqqTCZPq /4OPCNUIX5yHnK9L8FgtiqTQxHqF7chH4lV70vry2J8t24YnNiWXAn9YIuNsFWQW2LhJ 89N0Z5kbN2EtAzkTOJNdfxsgAdNY6c5UhQHM/+BJhH9cow7dhMKXfB05oPWPpzhdtA1P Di1TQDKH5KLd3aENUdmeFjAeeq4qxBGsB+H6em9RLWroSeBFP5UWXNY1CR9ZYjDpCp++ dw8OII1P9oSD/U8MjhPLZlv8DzPKIZNcCxtrgsLpteVaJyZnHspmgkpKROqpqkLdqn+Q jqjg== X-Gm-Message-State: AOAM533xOkPcuZhancA2xNFrYb9OMbvDDqfT/tnJ56DLEQ45clSVMMWp BTgWFL/RMaoMtctxxe2+H0UOmeBoIIJWj1zv4A== X-Google-Smtp-Source: ABdhPJw8iyvO5FTqdJU3p2lsC6SMOQUJi8gDJBby05Hjv1Upr0949U4F9QNDEdWKF8xp7LzYw9ZgXibdiKDnJq8X8WM= X-Received: by 2002:a63:1402:: with SMTP id u2mr11553914pgl.417.1616173712131; Fri, 19 Mar 2021 10:08:32 -0700 (PDT) MIME-Version: 1.0 References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> In-Reply-To: <24660.54990.961632.559429@jerusalem.litteratus.org> From: Paul Procacci Date: Fri, 19 Mar 2021 13:08:16 -0400 Message-ID: Subject: Re: Partitioning 1T HDD To: Robert Huff Cc: Duke Normandin , questions@freebsd.org X-Rspamd-Queue-Id: 4F29Mj3XSCz3Jkg X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[]; REPLY(-4.00)[] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:08:33 -0000 I concur with Robert. I've never seen GPT being associated with any kind of GUI. Surely people can design GUI's around gpt, but GPT isn't at all synonymous with a GUI. There are advantages of GPT over MBR. The main benefit in my opinion is that GPT removes the limits of MBR. Describing what those limits are is much too cumbersome to do in an email, but I assure you that information is available online. ~Paul On Fri, Mar 19, 2021 at 12:52 PM Robert Huff wrote: > > Duke Normandin writes: > > > Other than being GUI-based, is there any distinct advantage to > > using GPT? > > Um ... I have used GPT for about 10 years. > Never have I used it with a GUI. > > > Respectfully, > > > Robert Huff > > -- > Hello ... my name is SARS-CoV-2. > You are not wearing a mask? > Prepare to die! > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > -- __________________ :(){ :|:& };: From owner-freebsd-questions@freebsd.org Fri Mar 19 17:14:09 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 069D257B52E for ; Fri, 19 Mar 2021 17:14:09 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from holgerdanske.com (holgerdanske.com [184.105.128.27]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "www.holgerdanske.com", Issuer "www.holgerdanske.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29V76lPhz3KDJ for ; Fri, 19 Mar 2021 17:14:07 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from 99.100.19.101 (99-100-19-101.lightspeed.frokca.sbcglobal.net [99.100.19.101]) by holgerdanske.com with ESMTPSA (TLS_AES_128_GCM_SHA256:TLSv1.3:Kx=any:Au=any:Enc=AESGCM(128):Mac=AEAD) (SMTP-AUTH username dpchrist@holgerdanske.com, mechanism PLAIN) for ; Fri, 19 Mar 2021 10:13:58 -0700 Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> From: David Christensen Message-ID: Date: Fri, 19 Mar 2021 10:13:57 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319101040.00005c35@seibercom.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4F29V76lPhz3KDJ X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of dpchrist@holgerdanske.com has no SPF policy when checking 184.105.128.27) smtp.mailfrom=dpchrist@holgerdanske.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[184.105.128.27:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[184.105.128.27:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[holgerdanske.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6939, ipnet:184.104.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:14:09 -0000 On 3/19/21 7:10 AM, Jerry wrote: > With the soon-to-be release of version 13 of FreeBSD and the EOL of > FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s > unfortunate inability to squash bug > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left > with no choice but to seek out a new OS. I need a bare-bones system > that can run a mail server, Postfix with Dovecot, and a few other > utilities. Looking at that link, I see: ... Gerard Seibert 2021-02-25 21:01:04 UTC ... # dmidecode 3.3 ... Handle 0x0001, DMI type 1, 27 bytes System Information Manufacturer: Dell Inc. Product Name: XPS 8930 Version: 1.1.15 Serial Number: 19WS903 UUID: 4c4c4544-0039-5710-8053-b1c04f393033 Wake-up Type: Power Switch SKU Number: 0859 Family: XPS Dell says: https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-8930-desktop Operating system With Windows 10 Home So, Windows 10 Home is the only operating system supported by Dell on that computer. Windows 10 Home should not exhibit the bug you have encountered. Check if your software is supported on Windows 10 Home. If so, install Windows 10 Home and install your software. Alternatively, get another computer that is known to be compatible with your OS and software of choice. I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: * Dell PowerEdge T30 with Intel Xeon E3-1225 v5 * Intel S1200V3RPL with Intel Xeon E3-1225 v3 David From owner-freebsd-questions@freebsd.org Fri Mar 19 17:20:43 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1F53457B6DD for ; Fri, 19 Mar 2021 17:20:43 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt12.smtp-out.videotron.ca (alt13.smtp-out.videotron.ca [135.19.0.26]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29dk2ZMkz3KfR for ; Fri, 19 Mar 2021 17:20:42 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([169.57.185.94]) by Videotron with SMTP id NIndlOJMshH1BNInfl4HTp; Fri, 19 Mar 2021 13:20:41 -0400 X-Authority-Analysis: v=2.3 cv=NIqrBHyg c=1 sm=1 tr=0 a=vnLmCCwk4Yh8rhog+SbulQ==:117 a=vnLmCCwk4Yh8rhog+SbulQ==:17 a=ZubcGFkXAAAA:8 a=6I5d2MoRAAAA:8 a=iLNU1ar6AAAA:8 a=fOoeVy8-vHUGlgb1fG0A:9 a=QEXdDO2ut3YA:10 a=S0c4MPL_AAAA:8 a=8qSefF8wAAAA:8 a=73T3PqG4-xaWWuNsDjAA:9 a=e4dhswVxHniYy9jh:21 a=_W_S_7VecoQA:10 a=kUx6feENxpTNjkNjdsbW:22 a=IjZwj45LgO3ly-622nXo:22 a=oUyxxj36sYzlk9FXMKpk:22 a=gy0usrHT_YHxg8cEKwfj:22 From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 13:20:34 -0400 Message-Id: <556DBF92-2156-41CD-9DF4-382DF905271D@videotron.ca> References: Cc: freebsd-questions@freebsd.org In-Reply-To: To: David Christensen X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfCE28G17bgwgelbGFgI/Z/nkbpoVlQ17wk5Qio7NZ55BPrwrSonuTqC5zjf+vY+eaXgnzGGDjRczi+amqiZmuHf0OaZVWuwBuw1QO2+9m8eIst5a6XHS G03eA8VHu57g+r0RvJCvPo2cR6i65rBbVqpt3Yz2l3PQrITNdqDBSYEUvpxC8pL+xnEzw8zs5LvaqxCeYsv7fKMo95iwLoJEqBP5v34sI3KUkgyCf62PhBaw X-Rspamd-Queue-Id: 4F29dk2ZMkz3KfR X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 135.19.0.26 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.80 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[135.19.0.26:from]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:135.19.0.24/30:c]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; FREEMAIL_FROM(0.00)[videotron.ca]; DMARC_NA(0.00)[videotron.ca]; SPAMHAUS_ZRD(0.00)[135.19.0.26:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[135.19.0.26:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; ASN(0.00)[asn:5769, ipnet:135.19.0.0/18, country:CA]; MIME_TRACE(0.00)[0:+,1:+,2:~]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:20:43 -0000 Jerry any system that is legal/ legitimate following the law and posix , iee= e 1003 iec/iso/eac etc.. will not be able to do what you want. Refer to the following article: Hardware Trojan Horse Device Based on Unintended USB Channels Year: 2009, Volume: 1, Pages: 1-8 DOI Bookmark: 10.1109/NSS.2009.48 Authors=20 John Clark=20 Sylvain Leblanc=20 Scott Knight You need to implement a virtual USB Host driver as per USB transaction relay= techniques... Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 13:14, David Christensen a =C3=A9crit : >=20 > =EF=BB=BFOn 3/19/21 7:10 AM, Jerry wrote: >> With the soon-to-be release of version 13 of FreeBSD and the EOL of >> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99s= >> unfortunate inability to squash bug >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >> with no choice but to seek out a new OS. I need a bare-bones system >> that can run a mail server, Postfix with Dovecot, and a few other >> utilities. >=20 >=20 > Looking at that link, I see: >=20 > ... > Gerard Seibert 2021-02-25 21:01:04 UTC > ... > # dmidecode 3.3 > ... > Handle 0x0001, DMI type 1, 27 bytes > System Information > Manufacturer: Dell Inc. > Product Name: XPS 8930 > Version: 1.1.15 > Serial Number: 19WS903 > UUID: 4c4c4544-0039-5710-8053-b1c04f393033 > Wake-up Type: Power Switch > SKU Number: 0859 > Family: XPS >=20 >=20 > Dell says: >=20 > https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-8930= -desktop >=20 > Operating system >=20 > With Windows 10 Home >=20 >=20 > So, Windows 10 Home is the only operating system supported by Dell on that= computer. Windows 10 Home should not exhibit the bug you have encountered.= >=20 >=20 > Check if your software is supported on Windows 10 Home. If so, install Wi= ndows 10 Home and install your software. >=20 >=20 > Alternatively, get another computer that is known to be compatible with yo= ur OS and software of choice. >=20 >=20 > I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: >=20 > * Dell PowerEdge T30 with Intel Xeon E3-1225 v5 >=20 > * Intel S1200V3RPL with Intel Xeon E3-1225 v3 >=20 >=20 > David > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.or= g" From owner-freebsd-questions@freebsd.org Fri Mar 19 17:26:48 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 209D557BF02 for ; Fri, 19 Mar 2021 17:26:48 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from h2.pinyon.org (h2.pinyon.org [65.101.20.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29ml0ZNLz3L79 for ; Fri, 19 Mar 2021 17:26:46 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from [10.0.10.15] (unknown [10.0.10.15]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by h2.pinyon.org (Postfix) with ESMTPSA id D4C533A7BA for ; Fri, 19 Mar 2021 10:26:39 -0700 (MST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pinyon.org; s=dkim; t=1616174799; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=FUfSI3Z713ZYS/hSziIVS6oeWXrAao69KxPwg828UCg=; b=FLiFRQygHrOaN1CuHNsmr1R7/n/E0JnDZvsWheRVKSHH8PvNH+15vHgIENPUjNKjIRcCzo BePk76WveVfkvE7gxXbMHM4D9q3F753icMPKL6Pk6zBVq3fofRiowlYctD4oaGOOYk2aY7 zctPN8Bw6lCxQ36RMw/FCzkGd5NVA2w= Subject: Re: Partitioning 1T HDD To: freebsd-questions@freebsd.org References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> From: "Russell L. Carter" Message-ID: Date: Fri, 19 Mar 2021 10:26:39 -0700 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Firefox/78.0 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Spam-Status: No, score=-1.10 X-Rspamd-Server: h2 X-Rspamd-Queue-Id: 4F29ml0ZNLz3L79 X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=pinyon.org header.s=dkim header.b=FLiFRQyg; dmarc=none; spf=pass (mx1.freebsd.org: domain of rcarter@pinyon.org designates 65.101.20.170 as permitted sender) smtp.mailfrom=rcarter@pinyon.org X-Spamd-Result: default: False [-1.50 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_DKIM_ALLOW(-0.20)[pinyon.org:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.101.20.170:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.101.20.170:from:127.0.2.255]; ARC_NA(0.00)[]; DKIM_TRACE(0.00)[pinyon.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[pinyon.org]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; INTRODUCTION(2.00)[]; ASN(0.00)[asn:209, ipnet:65.101.0.0/18, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:26:48 -0000 On 3/19/21 10:08 AM, Paul Procacci wrote: > I concur with Robert. I've never seen GPT being associated with any kind > of GUI. Surely people can design GUI's around gpt, but GPT isn't at all > synonymous with a GUI. > There are advantages of GPT over MBR. The main benefit in my opinion is > that GPT removes the limits of MBR. > Describing what those limits are is much too cumbersome to do in an email, > but I assure you that information is available online. As others have pointed out, don't forget partition labels. It is considerably easier to figure out what each partition is being used for if they have been labeled in an obvious way: $ gpart list | grep label label: gptboot0 label: swap0 label: zfs0 label: ssd1 label: m.2_ssd1 Especially if it has been some time since the last time you looked. Russell > ~Paul > > On Fri, Mar 19, 2021 at 12:52 PM Robert Huff wrote: > >> >> Duke Normandin writes: >> >>> Other than being GUI-based, is there any distinct advantage to >>> using GPT? >> >> Um ... I have used GPT for about 10 years. >> Never have I used it with a GUI. >> >> >> Respectfully, >> >> >> Robert Huff >> >> -- >> Hello ... my name is SARS-CoV-2. >> You are not wearing a mask? >> Prepare to die! >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to " >> freebsd-questions-unsubscribe@freebsd.org" >> > > From owner-freebsd-questions@freebsd.org Fri Mar 19 17:33:57 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3F4AA57C041 for ; Fri, 19 Mar 2021 17:33:57 +0000 (UTC) (envelope-from thor@irk.ru) Received: from mail.irk.ru (relay2.dsi.ru [195.206.40.175]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29wz3Nzmz3LXr for ; Fri, 19 Mar 2021 17:33:55 +0000 (UTC) (envelope-from thor@irk.ru) Received: from [194.176.114.54] (helo=[192.168.1.244]) by mail.irk.ru with esmtpa (Exim 4.86 (FreeBSD)) (envelope-from ) id 1lNJ0N-000ED6-7D for freebsd-questions@freebsd.org; Sat, 20 Mar 2021 01:33:47 +0800 Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> From: Thor Ablestar Message-ID: <74e6cffe-ddf1-dd9a-68a8-f9ebd66761cb@irk.ru> Date: Sat, 20 Mar 2021 01:33:46 +0800 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.7.1 MIME-Version: 1.0 In-Reply-To: <20210319130249.000042a1@seibercom.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-US X-Rspamd-Queue-Id: 4F29wz3Nzmz3LXr X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=pass (policy=none) header.from=irk.ru; spf=pass (mx1.freebsd.org: domain of thor@irk.ru designates 195.206.40.175 as permitted sender) smtp.mailfrom=thor@irk.ru X-Spamd-Result: default: False [-3.80 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[195.206.40.175:from]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[195.206.40.175:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[irk.ru,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:8345, ipnet:195.206.32.0/19, country:RU]; MIME_TRACE(0.00)[0:+]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:33:57 -0000 High! So the specialists state that the problem is somewhere in ACPI. Long time ago (during the KMS hell) I bought me a notebook that had 2 ATI video controllers. I had a good experience with ATI and decided that it will be forever. I was wrong: The second card was not possible to disable under FreeBSD so I tried to find a method to do it with ACPI. I failed and have thrown the book away (donated to the friend) but: As I remember there is a method to download and decompile BIOS ACPI tables, patch them and load a patched version during boot (I have forgot the specifics). And as I remember the tables were somehow understandable. Maybe it's possible to find a m/b with similar USB3 hardware and take the relevant part from it? Hope this helps. Thor On 3/20/21 1:02 AM, Jerry wrote: > On Fri, 19 Mar 2021 11:07:07 -0400, Ernie Luzar stated: >> Matthias Gamsjager wrote: >>> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >>> >>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >>>> unfortunate inability to squash bug >>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >>>> with no choice but to seek out a new OS. I need a bare-bones system >>>> that can run a mail server, Postfix with Dovecot, and a few other >>>> utilities. >>>> >> This sounds like only 2 things. 1. Something in your hardware tower >> is >> falling. 2. The way you updated from one release to another something >> went wrong. >> >> I would start with a clean build of release 12.2 using a disk drive on >> a usb stick. See if problem is still there. If so you have hardware >> problem and no amount of PR is going to fix that. > There was nothing failing; it was a brand new PC. I have done the clean > install with both 12.0 and 12.2, with the same results. If you actually > read through the bug report, you would see that I am not the only one > with this problem. > > Apparently, someone reported that you could rebuild the kernel and > remove USB3 or something like that, but I have neither the time nor > inclination to do that, assuming I could do it. > > Versions 10 & 11 work fine. This is something that FreeBSD did that > screwed up the works. Dell is aware of the problem but will do nothing > to attempt to create a work around for it. They claim it is working as > specified and every other OS, with the exception of FreeBSD works > correctly on that system. > > I am not going to spend more money to get a system that is happy with > FreeBSD. I buy what I want and then get an OS that is capable of > operating on it, not the other way around. In any case, I am thinking > of either Fedora, Debian or Arch Linux. I was just looking for > recommendations from anyone who has used those systems. > From owner-freebsd-questions@freebsd.org Fri Mar 19 17:35:34 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 39BDD57BF4C for ; Fri, 19 Mar 2021 17:35:34 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb29.google.com (mail-yb1-xb29.google.com [IPv6:2607:f8b0:4864:20::b29]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29ys31tMz3LHP for ; Fri, 19 Mar 2021 17:35:33 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb29.google.com with SMTP id h82so7032254ybc.13 for ; Fri, 19 Mar 2021 10:35:33 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=5arEj1HQwPr8cV6+Tfdi6i2lc8043ZsMhH3BRYHm0HY=; b=BqEGK9WV8SEqXqT+7o0WMgp0FwCc3BaU0Lyhl0mCqhNuu9PWNRkzBOdM1o9KurzwTA +AtXMkaaVqZDDDdIrXqSnm6ZQCQOw/PJjmaG2F3t3EAPIDuAn2L0MSrJJpcS1X/b7x7o i2pxWvdFOxkTLj5yT6GxRsLfVdwlEK2UeZeOpLV3PwAv8ryFNASGXSRwkCKK+7d6PYx9 GdiS0vI2es4UeWwCOcM3lVsU5gSCZGx3cGrMUxFv8w5MVjnYxS2ip+467DiBgIvZpdgU 7+PSbTCijBl3Tzyz5aTqw/US39y7G4i/Q1FsnAOlUF0Ue0TrxZ5fjzwc+6lopYAuAV4s vCDQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=5arEj1HQwPr8cV6+Tfdi6i2lc8043ZsMhH3BRYHm0HY=; b=UzoSmxskXE15pNZwUNPllrs0mwHlRZ7BQtP9yRnK8+HyE6Bdl9cfrM6+O+xOWp7bv7 t+o+Y9eAu5R7qD4aKUc+dF9OW7mSCGhrL4PDqxHYSbsMH+2ESRZ45NFAoMzCBl0wbTVk 2g3cIEUJ8Y75EYnkCddRhtPwbd+oB8zXQJELMHw2aQPB5xDHZG8r0AR3GvNAIpWP6MiI a3p/M5ayK2V6xCpFsBBPrS886WQiIGNPTlDVINZZHgOz1u5wQVwy5CirFJ8E13UTs1oW BH8SoGs9Beg0mF42/Q7wUf2iF2KLAX/E0PNZeeF0/hgUWr5R+obPgY51IWkotKTq4MqG HDnA== X-Gm-Message-State: AOAM533b07BEKisKmvyJUqKGO4G7RWAYyNH2np6anr1ZiqQwMz7xRhVg 08qrNlZK+n/SJtfdDSYzO3w2e2MkMLp34FgdsxO4YLeaGbw= X-Google-Smtp-Source: ABdhPJxf5KqC7zSbGWLotkvvrIXKJbvVhqZXePnJDGvaTMICE/KsRUeYVD6qjnqM4IgYO0+asiwOam0P/2BGqPz1Ciw= X-Received: by 2002:a25:40d8:: with SMTP id n207mr7713048yba.3.1616175332196; Fri, 19 Mar 2021 10:35:32 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> In-Reply-To: <20210319130249.000042a1@seibercom.net> From: Aryeh Friedman Date: Fri, 19 Mar 2021 13:35:21 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F29ys31tMz3LHP X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=BqEGK9WV; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b29 as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b29:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b29:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b29:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:35:34 -0000 On Fri, Mar 19, 2021 at 1:03 PM Jerry wrote: > I am not going to spend more money to get a system that is happy with > FreeBSD. I buy what I want and then get an OS that is capable of > operating on it, not the other way around. > 1. Recompiling the kernel is *TRIVIAL* if you refuse to do it then you should not be using any Unix variant 2. So you are going to spend more money complaining about the OS then you would of to get it to work or install something else. Stop with your dog whistles -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Fri Mar 19 17:36:16 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 74A8957C0D4 for ; Fri, 19 Mar 2021 17:36:16 +0000 (UTC) (envelope-from melson.r@att.net) Received: from sonic306-23.consmr.mail.gq1.yahoo.com (sonic306-23.consmr.mail.gq1.yahoo.com [98.137.68.86]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F29zg3VsRz3LTN for ; Fri, 19 Mar 2021 17:36:15 +0000 (UTC) (envelope-from melson.r@att.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=att.net; s=s1024; t=1616175373; bh=PYy69qpuqa1sAcgjg8X2iw1rQsHoba6MuYN6qAkIRoA=; h=Subject:To:References:From:Date:In-Reply-To:From:Subject:Reply-To; b=as+RCWBYSilSQ5r3Elr+Q1JtbZihDebZYz/Xx2WY3LfzoP0zH3SvceXkGOqigYCOoYgFCBOA+gkzojMu3Oldf29twlu1x+e85oh5SOmit1oGcfWqoJXZ2RiBhj6IuE9xUqZpditmTPQja5QBtI9dCwwgN1WHYbDxfgNsrIYPwWM= X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1616175373; bh=kWFL9RyOF90442GuqSz9oaAnvASN3393qYXl2aqKTJD=; h=X-Sonic-MF:Subject:To:From:Date:From:Subject; b=LE8Rh6OSBYuZ+rHNv0USpptAIE57Z/06w/M/HHTgpNHzFkNwpPv25DzaP2xz9X3ryfQbJDiNX5AMJXGUsPgnRfCLMHZ2uVKlhDf+nNDWiZIRELrO12R0nn6VCZ5xtL0fWpt4oLZER0u9eyGSfZ58BH+K6D4at84O/1t9oRdTBeUl/Uj7mwLVtTFTVc+YTsirNkKaAnVsWikbQzvQwRhk+7sB2IEQvIQ0VqVwiNdZrx4o1JeSJo2xXh64DN8RIwSfSC0ySq6Sm4KtlwXGxdhIKm3LWuEfKlmQ3mX1d8LQ0eW/r51whb3uAxDM9R4+uxKq045Ii10e2fXrsLWfern+Cw== X-YMail-OSG: 5D64E4gVM1lbKoYRdZ_lDsSCi01sFuOpmGWjuQrXNqxGKrVtgqUJT.1.HkKYfdY Ng5opuKtgnUELuCd8lh9pNG.oZc6Ooy_PckjowpqmDfbjciOL6iyVkMZ4XHkhJhqj74L692Vo08x tuxGdY4jZlD1S7kXNQ2_b6r_u1EBjdRtAsyAFeK92qBpMqjn8cpE_ueZoP2upJWJiP.cEjVK372S qd0QBMSrd_jKK.ilTISdROi_OJClqeAW06bGDL_1aZ6iKdL5xr.GoxEsmsCWWQtXfgYrwgzjNHWV HaCwdA3iqBpRH9WWWLkDlIU.O5jiEhTIw9Xs0or0SuiG1jlIg89VstpKkzK.uOfkcu6.mlyTj5.N jzafaiPNnfchR1jyzJy3SCpvcSG_aZ17sCztoows9mLVPWY5cyhfQJIEwMrJSBLfq_Hp2JEw49mG 9GPJFwQrqq_Hj9y6Ntj01HE8.O4nwNOKpm.gGgARtu7Lq1i28Kh3fRxG3sAI7y_I.NaAQ2f.VEPr 6a4sFuBDdGKBTxXXUUOfRCzHede7Xkxd7cTbEgCErv12b2AQA9wxM5Qe9J3SZCG6aZlAMjKFvZmX ibklIQHbJz4M5KnoIOGa89V57iIPjR7iRNN7h2GV8jWm94y.9NtDUOSlEZM5q11ABV9UjaeMlH68 8PrZ7xUSCiHKn6ZJh8P.nunaw6q90XNGZeVjgWCGUVZKWGQYTN4gGnaV1JgsZ4NaTPZzBMU9FQqj lzhhtXI6wsisoWjSPu5dUsUILu5kVv9vujy.Ry7LLgQL1u1duhXWDke4q.X6qMBdyk1G8nRuBAvc zZMv.6ftjVCBQA0R5.dzHsVXpiahGob7Cq3XaMlLKCcMstyjHhn6h_CW1Y290jPBzdzZyhJOmtLg LwCj4KFiYImndifFEcZPRcGiuf3TJiuclIaz0nkQBu3NXAQygzDTiGH0Q9o128WQaVNNYS0OMG1T FRQDKn7oST6DcF6lLvbBlAaPerpuAVPCFIZD_XdiKJauftr2DwNsgr9r1Ht4W1PIkecDsIJqib3N zmvS7WSRL5eDrre.sf3ShIjvBmpBg2trTtonDu0RdNtWbou7jhrC7mqjQ7DQXa14jqJf.p2TxA9F XwJgPpVRsv_eNmmloDWh4OHwk3A1QpvB_6Oo07yAHzD4sY1vTrgRMXD7rmqmj7y6pwTGJh7ps0zO KpazIOihkaHIMLU3vY.9qOXv4bnygrZFS.pKIMHdCUWjfshyqQdR2Sw6vp.ah3CCQodQe_v6O6Mo _c1.Zu7PdNpU_qJx2Zq7RWGa0_iBSWoB0Fmqt7q9WRKurpjmSfNvmdHEUKOjzK7ZMu.ZImpMML38 wGwAM_R6sKVnsI8K3wOnuC8z737NFRFsJFenkqPXrBdZ.KqL39GTqpl2lWIH..xpFL8UNKqWl0LH M6NWeVp1.hjd_fdL20hq1srJwFtWEIVA5A7dhzNaze63EnNXui9HA.I3Oq3.2FRDUNfzsvr88JT9 cKtOoWLqNgiCzUK0TObGY3gdHPmXreJBhq0C_UEfT_b.E4DP_oPCIPZKtevwQAFWVFr1.HkV43AG De6vHbVFNnCp99iY.XERMDVnO.RdQtKQ7AFHdaNKlPrQzze_KFdMz4VrkoZIoTtWOsa2qGaNOBqe pNNAGCybXezWv.viCuVuHHGjEfJ4YimG6rVtR6OMutJwfh11gdKqDAg2eCihqnAeUrjHgfcrdtdB CehuxVN2XXrenoa7CrZTF7ztOFyiFg_gUXUlEMi4gMpIP_0o1ApL9RM5WCnkUTU0g9oyTtqORjNp 8fTAtmMDgBSDBZVKgEMhJA3cwZNC0Gr5ahArr.vl1K6ERY5E0uLDOj17oeCoBr6DSNSDeNATs7GC 15x9G5lUmaWQqWqRH_hCDbNb69QZvAlNX62JL8vaJ5rXtvqAo8yh3BT4kvPz5w1rlT6ej04hoZxA MTAIX6Cde2hTNxqdtVrFbp_5xvblVyrLXhmrVvWLmeVgiibhFjilAgfmn2FH2xs4P26QHEXV3Y.X HHAAfYNbm3MZ80yzhdE8s3sIVF4WQ0kmXKVVnbUz6LAv6Qzgip__Gy4aI600z1iCEgBlKnHuq1J1 cPVt4dXQaOwvDmsQjxaz0zqOKihLwiwcEkhUiRNidE0zGcgIwyxuaWoIVQ1kIfHcuD8hNqoSJyUI NdgvuE4wwxfQunsqr3H8Xf96BfSBKHGJTQ5wVQJMAA0dnzLMAUf4qxLGB4rs4uX81hDX2hWPXbzi gv2F9Hwv337BoZIvUcPMmcQFenk_C.g3DOrhVM_eiaGGgqlXH3AsoiEAaBeElTZVpI9SaWwilYip xhpjO7reYxkWzqXSWkWV5acax7KcXCEcHXANYTussSR0MD9QVm8P2IVngJWqKhjSEiJRnrUR3Q95 Qi_LfgkTYgnS971dE32vUNM1knPsq3FSMCfNGkR0eQHMNbjwdyIo0QP4.dtViRkzzITMscJcRega BgIY83K4- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic306.consmr.mail.gq1.yahoo.com with HTTP; Fri, 19 Mar 2021 17:36:13 +0000 Received: by smtp417.mail.gq1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID f8e4288926c678fa1121e55208143b58; Fri, 19 Mar 2021 17:36:11 +0000 (UTC) Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> From: Bob Melson Organization: Department of Paleocomputing, Whatsamatta U. Message-ID: <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> Date: Fri, 19 Mar 2021 11:36:10 -0600 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: <20210319130249.000042a1@seibercom.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Mailer: WebService/1.1.17936 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo Apache-HttpAsyncClient/4.1.4 (Java/11.0.9.1) X-Rspamd-Queue-Id: 4F29zg3VsRz3LTN X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=att.net header.s=s1024 header.b=as+RCWBY; dmarc=none; spf=none (mx1.freebsd.org: domain of melson.r@att.net has no SPF policy when checking 98.137.68.86) smtp.mailfrom=melson.r@att.net X-Spamd-Result: default: False [-3.30 / 15.00]; FREEMAIL_FROM(0.00)[att.net]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; DKIM_TRACE(0.00)[att.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[att.net]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[att.net:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.68.86:from]; R_DKIM_ALLOW(-0.20)[att.net:s=s1024]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[att.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[98.137.68.86:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[98.137.68.86:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.68.86:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:36:16 -0000 On 3/19/21 11:02 AM, Jerry wrote: > On Fri, 19 Mar 2021 11:07:07 -0400, Ernie Luzar stated: >> Matthias Gamsjager wrote: >>> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >>> >>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >>>> unfortunate inability to squash bug >>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >>>> with no choice but to seek out a new OS. I need a bare-bones system >>>> that can run a mail server, Postfix with Dovecot, and a few other >>>> utilities. >>>> >> This sounds like only 2 things. 1. Something in your hardware tower >> is >> falling. 2. The way you updated from one release to another something >> went wrong. >> >> I would start with a clean build of release 12.2 using a disk drive on >> a usb stick. See if problem is still there. If so you have hardware >> problem and no amount of PR is going to fix that. > > There was nothing failing; it was a brand new PC. I have done the clean > install with both 12.0 and 12.2, with the same results. If you actually > read through the bug report, you would see that I am not the only one > with this problem. > > Apparently, someone reported that you could rebuild the kernel and > remove USB3 or something like that, but I have neither the time nor > inclination to do that, assuming I could do it. > > Versions 10 & 11 work fine. This is something that FreeBSD did that > screwed up the works. Dell is aware of the problem but will do nothing > to attempt to create a work around for it. They claim it is working as > specified and every other OS, with the exception of FreeBSD works > correctly on that system. > > I am not going to spend more money to get a system that is happy with > FreeBSD. I buy what I want and then get an OS that is capable of > operating on it, not the other way around. In any case, I am thinking > of either Fedora, Debian or Arch Linux. I was just looking for > recommendations from anyone who has used those systems. > What I'd suggest is that you take a deep breath then ask yourself why you selected FreeBSD in the first place. If the considerations that were important then are still important then, maybe, switching OSes is not the right decision. Sure, there are a lot of alternatives out there, but if the factors that held at the time of your initial choice are still valid ... I'd also suggest that, if BSD in general is what you're most comfortable with, you consider either NetBSD or OpenBSD as a possible replacement. Both share the same roots as FreeBSD but have followed somewhat different paths to reach their current releases. Each has its positive points, each has negatives; how those negatives might affect you is up to you to determine. Me, I'm presently running generic 12.2 on a Lenovo Ryzen box with no problems and have run FreeBSD on various hardware since v2.1. I *was* - once upon a time - a professional user, now I'm just a happily retired geek. Bob Melson El Paso, TX -- Robert G. Melson | Rio Grande Microsolutions | El Paso, TX -- Minds are like parachutes. They only function when they are open. Sir James Dewar From owner-freebsd-questions@freebsd.org Fri Mar 19 17:39:02 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9D17157C34F for ; Fri, 19 Mar 2021 17:39:02 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qk1-x72c.google.com (mail-qk1-x72c.google.com [IPv6:2607:f8b0:4864:20::72c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2B2s4kznz3M55 for ; Fri, 19 Mar 2021 17:39:01 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qk1-x72c.google.com with SMTP id o5so3757645qkb.0 for ; Fri, 19 Mar 2021 10:39:01 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=EFA2tOu2Cxyi5G/YQgBvWGMUTM5yI1RrHH2ug/IjArU=; b=Kf6hWNmGAHGQ4noG37/89RyE1iofcsefTBpADwJyX3Ozek5SxaejilTFXTKLY6rq0L 2mnAlabBRfvc/puPOf8fuX+kVPsBjpugShP8BN6bSNjclPPkdfb7LZXCeDB9CcXgxOpa GaRY0zxfXvRWK6CGzjhPCfHU6A7i6Nq/3DBTw= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=EFA2tOu2Cxyi5G/YQgBvWGMUTM5yI1RrHH2ug/IjArU=; b=HWYP/lfGe8OKVQB3NtOFOCrGf9RTVKWx0/tqgMMkxiStd4N7u6z+63/smljMOHKiyY fiNcuy40r3O6eePfaqsVQvEgESvDpDdHwBGrlFL6oe2SOkKbJQUkK4z8ZrcbJT8ebVQ8 0BO1EWLCB9+kktYPhRkjs+uk5qRBxvZH1mhXn8uVBmhIPsmS964Nyr9ZPfCAiVbCWbi/ hMUNJ78b1Xc+u0rZH4GxYNqvFiN580mcq5x5s6xhAUtGyNrLsCKEb+DtyrFMW1rJk/Ef C9xfCvkW0lrCHF2QG+U/1OhKscWbMVSb+3TUlgkJnNJWpElJEL8guffxdL05DmfrIH7N 5q/w== X-Gm-Message-State: AOAM530lEAGJ/8NrM+QytFowHnxYN/gkpYuY6CiPbEwao8bBLHoRDN6h XYZHssTn9SnH4vOlA9TEBRuuWRjXiF+RgA== X-Google-Smtp-Source: ABdhPJyKid7T0rmbeMExO4gSSU+hn2bkEUP0pmbsRjSuT7SVxdFAtcyGPpexXf1/HyqRvE7DRan+HA== X-Received: by 2002:a05:620a:4445:: with SMTP id w5mr10557346qkp.330.1616175540038; Fri, 19 Mar 2021 10:39:00 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id a10sm4920964qkh.122.2021.03.19.10.38.58 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 10:38:59 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2B2p1DN8z1y5f for ; Fri, 19 Mar 2021 13:38:58 -0400 (EDT) Date: Fri, 19 Mar 2021 13:38:43 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319133843.000045a9@seibercom.net> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/m4qUetPp3Rr_2/7kf68B2=V"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2B2s4kznz3M55 X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=Kf6hWNmG; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::72c as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.25 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::72c:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::72c:from:127.0.2.255]; NEURAL_SPAM_LONG(0.85)[0.846]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::72c:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:39:02 -0000 --Sig_/m4qUetPp3Rr_2/7kf68B2=V Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 10:13:57 -0700, David Christensen stated: >On 3/19/21 7:10 AM, Jerry wrote: >> With the soon-to-be release of version 13 of FreeBSD and the EOL of >> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99s >> unfortunate inability to squash bug >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >> with no choice but to seek out a new OS. I need a bare-bones system >> that can run a mail server, Postfix with Dovecot, and a few other >> utilities. =20 > > >Looking at that link, I see: > > ... > Gerard Seibert 2021-02-25 21:01:04 UTC > ... > # dmidecode 3.3 > ... > Handle 0x0001, DMI type 1, 27 bytes > System Information > Manufacturer: Dell Inc. > Product Name: XPS 8930 > Version: 1.1.15 > Serial Number: 19WS903 > UUID: 4c4c4544-0039-5710-8053-b1c04f393033 > Wake-up Type: Power Switch > SKU Number: 0859 > Family: XPS > > >Dell says: > >=20 >https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-8930= -desktop > > Operating system > > With Windows 10 Home > > >So, Windows 10 Home is the only operating system supported by Dell on=20 >that computer. Windows 10 Home should not exhibit the bug you have=20 >encountered. > > >Check if your software is supported on Windows 10 Home. If so, >install Windows 10 Home and install your software. > > >Alternatively, get another computer that is known to be compatible >with your OS and software of choice. > > >I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: > >* Dell PowerEdge T30 with Intel Xeon E3-1225 v5 > >* Intel S1200V3RPL with Intel Xeon E3-1225 v3 > > >David You are incorrectly interpreting the data. Windows 10 Home is the base system. It also comes with Windows 10 Pro as an upgrade. I have used both and FreeBSD 10 & 11 successfully on this unit. The problem is with FreeBSD's code change between versions 11 and 12. The fact that I am not the only one bitten by this bug, and the inability of FreeBSD to correct it, and it has been over a year, is certainly not encouraging. I will acknowledge that it was a fairly cheap system. I only needed it for a mail server and a few other odds and ends. If I had purchased a top of the line, cutting edge system then I would certainly not have expected FreeBSD to support it. That is one of the reasons I didn't. --=20 Jerry --Sig_/m4qUetPp3Rr_2/7kf68B2=V Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBU4aoACgkQgHBP8gv9 FXev2gwAmupOFacsKblTBpqhbBjk4Bk0usT5fYj3CYz1U8GqXRH08CbYO2/pPMgV JBYcbvJTeHwRlArtMTOXqOkteteuNhbS+4a82GyObKkH0ISN/+eqStvWYsaxXt3n 2pt9s41iIacKZ39qLw7hEFSLkU2W8qy8yWAZO+mWkPUbvey2r7tizmnTPMDPKaoy DUoQXTfUD5LXEihheyefDU1LsIy97W8NjGDX5smjsscg0IZil5U/k1OFXtKBKH38 HhiEIAizEYKNBrkEdeQYOMhKpE+v/i5g48thL+qAs0NMbMnrPKeawPScFCrhyBhw 7U1diQGjCDQzWoLoIlz16K95zGP1pbpAzpGZc9NAyS4Hk/nWSORuqhu22ZmrPqKN zWYUZlaAYRYo9BvPJvNyQWvsRg2s3OmqMk6SCDWKz4om+wLQAINkfc1oLf96nGNa 69l4mRniXaAJAVLglkN/PfXTu6ue2c9MVPCbvA/gQvL2a1YipmmQsTPh4Bd6l5Pl /AiieUcY =Btiz -----END PGP SIGNATURE----- --Sig_/m4qUetPp3Rr_2/7kf68B2=V-- From owner-freebsd-questions@freebsd.org Fri Mar 19 17:51:03 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 9848B57CC33 for ; Fri, 19 Mar 2021 17:51:03 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from holgerdanske.com (holgerdanske.com [184.105.128.27]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "www.holgerdanske.com", Issuer "www.holgerdanske.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2BJk62Jhz3MhG for ; Fri, 19 Mar 2021 17:51:02 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from 99.100.19.101 (99-100-19-101.lightspeed.frokca.sbcglobal.net [99.100.19.101]) by holgerdanske.com with ESMTPSA (TLS_AES_128_GCM_SHA256:TLSv1.3:Kx=any:Au=any:Enc=AESGCM(128):Mac=AEAD) (SMTP-AUTH username dpchrist@holgerdanske.com, mechanism PLAIN) for ; Fri, 19 Mar 2021 10:50:58 -0700 Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <20210319133843.000045a9@seibercom.net> From: David Christensen Message-ID: Date: Fri, 19 Mar 2021 10:50:58 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319133843.000045a9@seibercom.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4F2BJk62Jhz3MhG X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of dpchrist@holgerdanske.com has no SPF policy when checking 184.105.128.27) smtp.mailfrom=dpchrist@holgerdanske.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[184.105.128.27:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[184.105.128.27:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[holgerdanske.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6939, ipnet:184.104.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:51:03 -0000 On 3/19/21 10:38 AM, Jerry wrote: > On Fri, 19 Mar 2021 10:13:57 -0700, David Christensen stated: >> On 3/19/21 7:10 AM, Jerry wrote: >>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD’s >>> unfortunate inability to squash bug >>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666, l am left >>> with no choice but to seek out a new OS. I need a bare-bones system >>> that can run a mail server, Postfix with Dovecot, and a few other >>> utilities. >> >> >> Looking at that link, I see: >> >> ... >> Gerard Seibert 2021-02-25 21:01:04 UTC >> ... >> # dmidecode 3.3 >> ... >> Handle 0x0001, DMI type 1, 27 bytes >> System Information >> Manufacturer: Dell Inc. >> Product Name: XPS 8930 >> Version: 1.1.15 >> Serial Number: 19WS903 >> UUID: 4c4c4544-0039-5710-8053-b1c04f393033 >> Wake-up Type: Power Switch >> SKU Number: 0859 >> Family: XPS >> >> >> Dell says: >> >> >> https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-8930-desktop >> >> Operating system >> >> With Windows 10 Home >> >> >> So, Windows 10 Home is the only operating system supported by Dell on >> that computer. Windows 10 Home should not exhibit the bug you have >> encountered. >> >> >> Check if your software is supported on Windows 10 Home. If so, >> install Windows 10 Home and install your software. >> >> >> Alternatively, get another computer that is known to be compatible >> with your OS and software of choice. >> >> >> I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: >> >> * Dell PowerEdge T30 with Intel Xeon E3-1225 v5 >> >> * Intel S1200V3RPL with Intel Xeon E3-1225 v3 >> >> >> David > > You are incorrectly interpreting the data. Windows 10 Home is the base > system. It also comes with Windows 10 Pro as an upgrade. Blame Dell, not me. > I have used > both and FreeBSD 10 & 11 successfully on this unit. > I will acknowledge that it was a fairly cheap system. I only needed it > for a mail server and a few other odds and ends. You got lucky. > The problem is with FreeBSD's code change between versions 11 and 12. > The fact that I am not the only one bitten by this bug, and the > inability of FreeBSD to correct it, and it has been over a year, is > certainly not encouraging. That is a consequence of closed hardware, not open software. > If I had purchased a > top of the line, cutting edge system then I would certainly not have > expected FreeBSD to support it. That is one of the reasons I didn't. And you would be running an OS with paid support and a SLA. David From owner-freebsd-questions@freebsd.org Fri Mar 19 17:59:53 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7BD2557CDF7 for ; Fri, 19 Mar 2021 17:59:53 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qt1-x82b.google.com (mail-qt1-x82b.google.com [IPv6:2607:f8b0:4864:20::82b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2BVw0X5rz3NJy for ; Fri, 19 Mar 2021 17:59:51 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qt1-x82b.google.com with SMTP id y2so4989015qtw.13 for ; Fri, 19 Mar 2021 10:59:51 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=i5RdWS8Nd8X67dIu0YX2x0XFzM7PZMeI+AbwsQC9ZqI=; b=iyYRai9o15w5ROhwwOn//usVVmwWEIi9UbJHEPpNtQ9roR4MF4JRnMLa9YubTW9j/c eGNMWGV5hPTT+UvJ3ZW6n4PSEPEH9WUTR2lQhw59Ax0lMJNA0lBH/Hlo3ica8yRVVWWZ EMzGwtKkJ8FqRsm8lYboHczEJfwXZeSqMYVoc= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=i5RdWS8Nd8X67dIu0YX2x0XFzM7PZMeI+AbwsQC9ZqI=; b=PwppKwTTLFkK85tpwkk6AGpD43EWqvDADWMo37kcmVqI6TsM9S64oMgCH2OabF9BsA spVo83veODcMCYv4tBvIt2PZIeT6qttiJ+fEUacJsb2kQ0ZhrxcC838WHnFtU/npLMOA YvVx31S5FCRN+0uMwLXNtfNGNUl+EEhbiLGwncSo9uaF7trIKQuUMMd7V7NaZhIR5R99 bdVCOAC+mNjagQZDztkPpDcrNenU0K0WhWJSMh95druiSNJoGRqItRxJcmZrynbTaD/n RpjxVtBpy/QjA5gmY+2V4eOrW5n+m0gLU5btB/ezW8yzRStOYpTv3ZAjcapOAOT97N03 Fmxg== X-Gm-Message-State: AOAM532yJBxlnddxU2zD7HPTZdL2Rvp8w3CJoG6Lc/kVPhLQRFmLFT5l eCzkH2GHHGOmwFKuk/JRM0qZOjfuDvKskA== X-Google-Smtp-Source: ABdhPJw9WHNKjJjRIV/jW1kEsgBNgBS71KVRpnLvA5u0/OdrYAP4CdiqEb7yek91gi4f0IYWV50www== X-Received: by 2002:ac8:6715:: with SMTP id e21mr57699qtp.254.1616176790755; Fri, 19 Mar 2021 10:59:50 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id d14sm4104012qtj.92.2021.03.19.10.59.49 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 10:59:49 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2BVr6sDwz1y5t for ; Fri, 19 Mar 2021 13:59:48 -0400 (EDT) Date: Fri, 19 Mar 2021 13:59:33 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319135933.00005b21@seibercom.net> In-Reply-To: <556DBF92-2156-41CD-9DF4-382DF905271D@videotron.ca> References: <556DBF92-2156-41CD-9DF4-382DF905271D@videotron.ca> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/Gy8G7BF35jFkRvCSukEJ/43"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2BVw0X5rz3NJy X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=iyYRai9o; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::82b as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.35 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::82b:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::82b:from:127.0.2.255]; NEURAL_SPAM_LONG(0.95)[0.951]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::82b:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 17:59:53 -0000 --Sig_/Gy8G7BF35jFkRvCSukEJ/43 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 13:20:34 -0400, Paul stated: >Envoy=C3=A9 de mon iPhone > >> Le 19 mars 2021 =C3=A0 13:14, David Christensen >> a =C3=A9crit : >>=20 >> =EF=BB=BFOn 3/19/21 7:10 AM, Jerry wrote: =20 >>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80= =99s >>> unfortunate inability to squash bug >>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >>> with no choice but to seek out a new OS. I need a bare-bones system >>> that can run a mail server, Postfix with Dovecot, and a few other >>> utilities. =20 >>=20 >>=20 >> Looking at that link, I see: >>=20 >> ... >> Gerard Seibert 2021-02-25 21:01:04 UTC >> ... >> # dmidecode 3.3 >> ... >> Handle 0x0001, DMI type 1, 27 bytes >> System Information >> Manufacturer: Dell Inc. >> Product Name: XPS 8930 >> Version: 1.1.15 >> Serial Number: 19WS903 >> UUID: 4c4c4544-0039-5710-8053-b1c04f393033 >> Wake-up Type: Power Switch >> SKU Number: 0859 >> Family: XPS >>=20 >>=20 >> Dell says: >>=20 >> https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-89= 30-desktop >>=20 >> Operating system >>=20 >> With Windows 10 Home >>=20 >>=20 >> So, Windows 10 Home is the only operating system supported by Dell >> on that computer. Windows 10 Home should not exhibit the bug you >> have encountered. >>=20 >>=20 >> Check if your software is supported on Windows 10 Home. If so, >> install Windows 10 Home and install your software. >>=20 >>=20 >> Alternatively, get another computer that is known to be compatible >> with your OS and software of choice. >>=20 >>=20 >> I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: >>=20 >> * Dell PowerEdge T30 with Intel Xeon E3-1225 v5 >>=20 >> * Intel S1200V3RPL with Intel Xeon E3-1225 v3 >>=20 >>=20 >> David >Jerry any system that is legal/ legitimate following the law and posix >, ieee 1003 iec/iso/eac etc.. will not be able to do what you want. > >Refer to the following article: > >Hardware Trojan Horse Device Based on Unintended USB Channels >Year: 2009, Volume: 1, Pages: 1-8 >DOI Bookmark: 10.1109/NSS.2009.48 >Authors=20 > >John Clark=20 >Sylvain Leblanc=20 >Scott Knight > > >You need to implement a virtual USB Host driver as per USB transaction >relay techniques... Seriously Paul, do you write this dribble to keep yourself amused or is this a language problem? Are you attempting to insinuate that any system that works correctly will not do what I want? What type of gibberish is that? Furthermore, I have no intention of reading an eleven year old publication, even if I could easily find it. Since you obviously have nothing to legitimately add to this thread, there is no need for you to continue. --=20 Jerry --Sig_/Gy8G7BF35jFkRvCSukEJ/43 Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBU5osACgkQgHBP8gv9 FXfjRQv+LE4ly1lU5G4wBXOJ/FFAcF+OVQw/mL3KC1RSCdpBQJmfFSSoD3YFWm8T LxR3G3j8Vi7h5ceWWonoWoWl53VByfRdpJVTRJN9amlke6nW/A2IPe5LDc6Kk63J 89PIUV5Q9i8K31VRyJR7+XpUpcgLBJfm/7QFtlkfXGNvIo8r1zHcKLMV+de1GMxr Fz/YtdGe6KLAp9pCsSvefikd/RgUWlgyqjY/B4TaI99cTyEG+3RuVj2NOb6gvDLC IBWkBTzs5yTTBqkn8jYwxNdlGWsiWKdXC346mD0y+v/HI1YtlJkouo6EiWVPq74D iE5opmtBWVr6qR0/rsMWcOpK0A4QaTFYbMsZHTH/nv2SIxKtM5pFCAn8g4fGnCxX MzSv95IAoZtagh/z00gMGfkg+zME108zZNVPkkp518+zdJO1KZH85ThQjnFxzgiQ xsYwoZSaOx7W5AbJZ8oEdx7elAi2B2+X3zY8/lW7gFtM9EuRZNQAqV+i5kJKhQHk D6YbuIo4 =v3Fo -----END PGP SIGNATURE----- --Sig_/Gy8G7BF35jFkRvCSukEJ/43-- From owner-freebsd-questions@freebsd.org Fri Mar 19 18:04:59 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B688857D482 for ; Fri, 19 Mar 2021 18:04:59 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qv1-xf2d.google.com (mail-qv1-xf2d.google.com [IPv6:2607:f8b0:4864:20::f2d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Bcp60CYz3NhK for ; Fri, 19 Mar 2021 18:04:58 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qv1-xf2d.google.com with SMTP id x27so5486525qvd.2 for ; Fri, 19 Mar 2021 11:04:58 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=FrUWBEV8xeMr3LR3cuRmYx93s8lql1wkfpMEf3jW/T4=; b=PMlLaZQP32v/fq3ybDEKbe+1IBoxTp+SHoAYrdZXjoHFcB1A3a0bi9/JNpP2ofn8yq UeSuHYVY8yVSvaQcF27A2Qk9NCHvdNVFulwyQLM2Eo1EDRq3jhPXoRqkun6c6jny/gJ8 V/xPuZafjYX68KiEEuDKAWSmCbloxk2+LRq8c= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=FrUWBEV8xeMr3LR3cuRmYx93s8lql1wkfpMEf3jW/T4=; b=JaKeiFOs1CV9wv10e5Cj2ISnWoLCyXma8PfUtff8KzSyHivFPz0JZN3F/U1Dm2FsSy yh0u/k/2qWLKLL3y8CMiJsT/tWC0xi/noNrK1CBfET7zJL7sDEySapQ3cgOaiFeVwAdv DtP1OTd43VR1xM0LFeNouC0DJMfFl1bxT+i1Pde/oK8DDyzcCxsyilzrXRIQudLL+ihZ KS84z8+U9FfpIbbjL+BIWSxuT2QjbvNFQV1cgxNK8h4Gh1LN7PXi4Jb228STH8TKdEOE qJ2mPm1EWqP8xSbCD22vg2ekKV+Ehzs/EYJ9qakJErU5T7RRsP1bQSXdlJX1ga1Rlxxr WniA== X-Gm-Message-State: AOAM530naP4emiBVWwzGHHOjWM/O97yLT/UvzD52ojDdZxuNprxltwQ6 Ng3iP0W/ekqtYm2r2vf2JAG6GSOYJdm1Kg== X-Google-Smtp-Source: ABdhPJzue+P7ogvmrjX+NStwZHwAfSI5UPVzNv2tYent1l+mL7UIYTKwprlX8z4QHsJsRJ0ozpJUlg== X-Received: by 2002:a0c:f702:: with SMTP id w2mr10739715qvn.0.1616177096929; Fri, 19 Mar 2021 11:04:56 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id a20sm4967774qkg.61.2021.03.19.11.04.55 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 11:04:56 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2Bcl2NlTz1y5v for ; Fri, 19 Mar 2021 14:04:55 -0400 (EDT) Date: Fri, 19 Mar 2021 14:04:48 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319140448.00007521@seibercom.net> In-Reply-To: <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/6o.7o7vErq45yiXJwyWYtS="; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2Bcp60CYz3NhK X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=PMlLaZQP; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::f2d as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.26 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f2d:from]; REPLYTO_EQ_TO_ADDR(5.00)[]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f2d:from:127.0.2.255]; NEURAL_SPAM_LONG(0.86)[0.865]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f2d:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 18:04:59 -0000 --Sig_/6o.7o7vErq45yiXJwyWYtS= Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 11:36:10 -0600, Bob Melson stated: >On 3/19/21 11:02 AM, Jerry wrote: >> On Fri, 19 Mar 2021 11:07:07 -0400, Ernie Luzar stated: =20 >>> Matthias Gamsjager wrote: =20 >>>> On Fri, 19 Mar 2021 at 15:16, Jerry wrote: >>>> =20 >>>>> With the soon-to-be release of version 13 of FreeBSD and the EOL >>>>> of FreeBSD 11.x, I will need to invest in a new OS. Due to >>>>> FreeBSD=C3=A2=E2=82=AC=E2=84=A2s unfortunate inability to squash bug >>>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am >>>>> left with no choice but to seek out a new OS. I need a bare-bones >>>>> system that can run a mail server, Postfix with Dovecot, and a >>>>> few other utilities. >>>>> =20 >>> This sounds like only 2 things. 1. Something in your hardware >>> tower is >>> falling. 2. The way you updated from one release to another >>> something went wrong. >>> >>> I would start with a clean build of release 12.2 using a disk drive >>> on a usb stick. See if problem is still there. If so you have >>> hardware problem and no amount of PR is going to fix that. =20 >>=20 >> There was nothing failing; it was a brand new PC. I have done the >> clean install with both 12.0 and 12.2, with the same results. If you >> actually read through the bug report, you would see that I am not >> the only one with this problem. >>=20 >> Apparently, someone reported that you could rebuild the kernel and >> remove USB3 or something like that, but I have neither the time nor >> inclination to do that, assuming I could do it. >>=20 >> Versions 10 & 11 work fine. This is something that FreeBSD did that >> screwed up the works. Dell is aware of the problem but will do >> nothing to attempt to create a work around for it. They claim it is >> working as specified and every other OS, with the exception of >> FreeBSD works correctly on that system. >>=20 >> I am not going to spend more money to get a system that is happy with >> FreeBSD. I buy what I want and then get an OS that is capable of >> operating on it, not the other way around. In any case, I am thinking >> of either Fedora, Debian or Arch Linux. I was just looking for >> recommendations from anyone who has used those systems. >> =20 >What I'd suggest is that you take a deep breath then ask yourself why=20 >you selected FreeBSD in the first place. If the considerations that=20 >were important then are still important then, maybe, switching OSes is=20 >not the right decision. Sure, there are a lot of alternatives out=20 >there, but if the factors that held at the time of your initial choice=20 >are still valid ... > >I'd also suggest that, if BSD in general is what you're most >comfortable with, you consider either NetBSD or OpenBSD as a possible >replacement. Both share the same roots as FreeBSD but have followed >somewhat different paths to reach their current releases. Each has >its positive points, each has negatives; how those negatives might >affect you is up to you to determine. > >Me, I'm presently running generic 12.2 on a Lenovo Ryzen box with no=20 >problems and have run FreeBSD on various hardware since v2.1. I *was* >- once upon a time - a professional user, now I'm just a happily >retired geek. > >Bob Melson >El Paso, TX I had considered using a different flavor of BSD. I still might. However, I also happen to have a spare HD that I could plug into the system, install Windows 10 Pro and Hyper V and then see if FreeBSD 12.x or newer works correctly. That would only take a short amount of time. I just need to do it at night so I can take the system offline. It probably won't work, but if FreeBSD is isolated from the hardware, it might be all that is needed in the short run. --=20 Jerry --Sig_/6o.7o7vErq45yiXJwyWYtS= Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBU58YACgkQgHBP8gv9 FXcWrgwAhSkdc8cHxiCHXjw3LO2Fp1eddYuYjf/OVWjzc3pFfKDwerIWU4ZIyATt 9AnzbUkEV7OpHxUp7H2Zo0elIzAl7gBCcLCHwCBNTrauctiFS5wy17/7l2AFe4Ce lw2WVfwDn7WtJZh24gbFAQx9vkmJf+Rs5ugnRQBEJiBoDjI3ToBjYi20zM05HYAE ElUQ+IBuXnwxO0VSBI1QenxZ61Zi1H925kpPU9VlUIb/Zuv2hYr+vCYJ6eDJvz+y 0phEbfJobCj/7OyFi/86uTG4pIjvSSseL7Gmt1xu9oyJeNPHRJPTluZ2dpDJOiqm qwUobMjN9k6L8QklBpyDR9bFKADRNUWAz68/SHIut2aE+uWLHkph7Yi0TfwfwEjl M8THfLEvmY91cd66ITC0wU9bcTkRSmgcBLuAd8r+TDC+Lw/gh8ZHZe/Z0xjWVuxO yEwuGw2P4AVPSzbzz02MuldUttxG0hCNjqDMg8R6/+Uq2BbpLBuv20KAD+3nMfXz GuSuVJaD =zdX0 -----END PGP SIGNATURE----- --Sig_/6o.7o7vErq45yiXJwyWYtS=-- From owner-freebsd-questions@freebsd.org Fri Mar 19 18:16:37 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2E18357D670 for ; Fri, 19 Mar 2021 18:16:37 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from johnea.net (johnea.net [75.60.233.73]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2BtD3Bzzz3PVn for ; Fri, 19 Mar 2021 18:16:36 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from [192.168.100.201] (w520.johnea.net [192.168.100.201]) (using TLSv1 with cipher AES128-SHA (128/128 bits)) (No client certificate requested) by johnea.net (Postfix) with ESMTPSA id 65A455F236F4 for ; Fri, 19 Mar 2021 11:16:34 -0700 (PDT) Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> From: freebsd@johnea.net Message-ID: Date: Fri, 19 Mar 2021 11:16:33 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319140448.00007521@seibercom.net> Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2BtD3Bzzz3PVn X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=pass (policy=none) header.from=johnea.net; spf=pass (mx1.freebsd.org: domain of freebsd@johnea.net designates 75.60.233.73 as permitted sender) smtp.mailfrom=freebsd@johnea.net X-Spamd-Result: default: False [-3.90 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[75.60.233.73:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:75.60.233.73]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[75.60.233.73:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[johnea.net,none]; FROM_NO_DN(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7018, ipnet:75.48.0.0/12, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[75.60.233.73:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 18:16:37 -0000 On 3/19/21 11:04 AM, Jerry wrote: > I had considered using a different flavor of BSD. I still might. > However, I also happen to have a spare HD that I could plug into the > system, install Windows 10 Pro and Hyper V and then see if FreeBSD 12.x > or newer works correctly. That would only take a short amount of time. > I just need to do it at night so I can take the system offline. > > It probably won't work, but if FreeBSD is isolated from the hardware, > it might be all that is needed in the short run. > > -- Jerry You should really consider trying some version of linux as well. Whatever you're most familiar with. Arch is considered "bleeding edge" and you'll get something very close to the latest version of kernel and applications. Void uses a runit init system with no systemd, and an architecture that is more similar than other linux distributions to the BSD way. Any linux distribution will still give you _the_ linux kernel, so which distribution is chosen probably doesn't matter that much. Use whatever is easiest for you. Also, this testing of linux USB3 on this particular problematic hardware could give additional insights into the problem on FreeBSD... johnea From owner-freebsd-questions@freebsd.org Fri Mar 19 18:36:55 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E5CEC57EA79 for ; Fri, 19 Mar 2021 18:36:55 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2CKf6xJsz3gyZ for ; Fri, 19 Mar 2021 18:36:54 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from fews2.riseup.net (fews2-pn.riseup.net [10.0.1.84]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F2CKd1FwDzDq8m for ; Fri, 19 Mar 2021 11:36:53 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616179013; bh=RJsVai/mtlwHFQXKls9S8BqN2+X85+i6shwt/j3ChMM=; h=Date:From:To:Subject:In-Reply-To:References:From; b=iRjHyRFIjQG/eVvUer/i4oRfWSVpFEOtrP6kg90OxdhAnuStYdA+udBX4/Srse7i/ Xsn10DZlIVEteQNgP0cHz5s8uzEcCxwf0VQMpbjTDmPwbbAfNyt8Xrho13BM7O1KTw nyXQp2CZKnmO/Zm/291x2uKmNFim+KjTaBGtoKwM= X-Riseup-User-ID: 4067CA7127D00AFD131C3907561642230AAD0CF5A7AC267F8A4AFC1CBA661777 Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews2.riseup.net (Postfix) with ESMTPSA id 4F2CKc3jD7z1xmR for ; Fri, 19 Mar 2021 11:36:52 -0700 (PDT) Date: Fri, 19 Mar 2021 19:36:39 +0100 From: Ralf Mardorf To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319193639.7afe5ad6@archlinux> In-Reply-To: <20210319130249.000042a1@seibercom.net> References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2CKf6xJsz3gyZ X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=iRjHyRFI; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of ralf-mardorf@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=ralf-mardorf@riseup.net X-Spamd-Result: default: False [-4.60 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-0.997]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 18:36:56 -0000 On Fri, 19 Mar 2021 13:02:49 -0400, Jerry wrote: >In any case, I am thinking of either Fedora, Debian or Arch Linux. I >was just looking for recommendations from anyone who has used those >systems. I'm using Arch Linux for my daily desktop PC usage. While it's the most stable distro I've ever used, the real rolling release approach requires some special manual interventions from time to time. It's useful to join https://lists.archlinux.org/listinfo/arch-announce to get informed of changes that might require manual intervention. I can't comment on using Arch Linux for server usage. A pro might be that auditing installed packages against known vulnerabilities can run automatically when doing updates by using a transaction hook. If you want to test your server's security you might be interested in https://blackarch.org/ in addition to an Arch install. RPM packages used by e.g. Fedora are rocket science to me. I'm a little bit used to DEB packages used by Debian and Ubuntu, but they are kind of rocket science, too. Arch packages are straight shell scripts, let alone that the attitude of Arch Linux is similar to FreeBSD, see https://wiki.archlinux.org/index.php/Arch_Build_System . From owner-freebsd-questions@freebsd.org Fri Mar 19 19:14:58 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7510B57F9E7 for ; Fri, 19 Mar 2021 19:14:58 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from alt42.smtp-out.videotron.ca (alt42.smtp-out.videotron.ca [23.233.128.29]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2D9Y429Dz3kpb for ; Fri, 19 Mar 2021 19:14:57 +0000 (UTC) (envelope-from pkagan@videotron.ca) Received: from [166.98.46.2] ([169.57.185.94]) by Videotron with SMTP id NKaCl0iYCJ2slNKaEltymB; Fri, 19 Mar 2021 15:14:56 -0400 X-Authority-Analysis: v=2.3 cv=UrkdyN4B c=1 sm=1 tr=0 a=vnLmCCwk4Yh8rhog+SbulQ==:117 a=vnLmCCwk4Yh8rhog+SbulQ==:17 a=IkcTkHD0fZMA:10 a=AfEfcmvjAAAA:8 a=ZubcGFkXAAAA:8 a=6I5d2MoRAAAA:8 a=iLNU1ar6AAAA:8 a=CB_7X13l3gF87t3cWOMA:9 a=QEXdDO2ut3YA:10 a=xIDnvljIO3wZ5qv32AfX:22 a=kUx6feENxpTNjkNjdsbW:22 a=IjZwj45LgO3ly-622nXo:22 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Paul Mime-Version: 1.0 (1.0) Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 15:14:49 -0400 Message-Id: References: In-Reply-To: To: freebsd-questions@freebsd.org X-Mailer: iPhone Mail (18D52) X-CMAE-Envelope: MS4wfCbL0qSqcRFS5lGBoVuN0O7h2OD0AwuhU6MrFbvR/2vGp5dGNBaeP7HOeQIL3DlS7HdAueHLgJ/lEVuwwFgY+TH1edA92xXP8cyT1ifbF/CvgI9cEWSy 7jt/djst4diUnjo7xVJo5BYO4C55O3xbpF64smhWDwgUFbixcdDR7YjWYwI6egct1zA5PwgNIZLMDw== X-Rspamd-Queue-Id: 4F2D9Y429Dz3kpb X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of pkagan@videotron.ca designates 23.233.128.29 as permitted sender) smtp.mailfrom=pkagan@videotron.ca X-Spamd-Result: default: False [-2.90 / 15.00]; ARC_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[videotron.ca]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[23.233.128.29:from]; R_SPF_ALLOW(-0.20)[+ip4:23.233.128.28/30:c]; FREEMAIL_FROM(0.00)[videotron.ca]; MIME_GOOD(-0.10)[text/plain]; MV_CASE(0.50)[]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[23.233.128.29:from:127.0.2.255]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[videotron.ca]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:5769, ipnet:23.233.128.0/18, country:CA]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[23.233.128.29:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 19:14:58 -0000 Jerry you are projecting and being inherently offensive. All the insults you= have put towards me are a deflection of yourself.=20 Freebsd is incorporated into the largest systems out there and is of the mos= t reputed and highest quality computer operating systems in existence in the= world. Your comments that negate our efforts whether it is myself, my compa= triots , members of the Computer Society or BSD community. We are trying to h= elp you and you insult us. We don=E2=80=99t accept your insults but we simpl= y respond by trying to help you. It seems you are destined to get lost but I= ask that you refrain from trying to take us down with you. Thank you for yo= ur understanding. I don=E2=80=99t use Dell Computers, it=E2=80=99s against o= ur companies policy. I have to build the computers with components. You shou= ld be able to take it up with Dell but it sounds like they want you to inves= t more money to get the SLA that supports the use of your intentions. For ex= ample they would sell you a computer specific to server purposes, etc.. My c= ompany allows LeNovo ie. for laptops, etc.. Nevertheless there is a compatib= ility of components list. Freebsd does not work on assembled systems compati= bility but on a component basis. If you want to determine what is compatible= with your system talk to Dell and ask them to give you a factory installati= on or restore for the opera system that they intended to be used with your s= ystem. Solves the problem right there. And take your insults with you. Envoy=C3=A9 de mon iPhone > Le 19 mars 2021 =C3=A0 13:59, Jerry a =C3=A9crit : >=20 > =EF=BB=BFOn Fri, 19 Mar 2021 13:20:34 -0400, Paul stated: >> Envoy=C3=A9 de mon iPhone >>=20 >>> Le 19 mars 2021 =C3=A0 13:14, David Christensen >>> a =C3=A9crit : >>>=20 >>> =EF=BB=BFOn 3/19/21 7:10 AM, Jerry wrote: =20 >>>> With the soon-to-be release of version 13 of FreeBSD and the EOL of >>>> FreeBSD 11.x, I will need to invest in a new OS. Due to FreeBSD=E2=80=99= s >>>> unfortunate inability to squash bug >>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am left >>>> with no choice but to seek out a new OS. I need a bare-bones system >>>> that can run a mail server, Postfix with Dovecot, and a few other >>>> utilities. =20 >>>=20 >>>=20 >>> Looking at that link, I see: >>>=20 >>> ... >>> Gerard Seibert 2021-02-25 21:01:04 UTC >>> ... >>> # dmidecode 3.3 >>> ... >>> Handle 0x0001, DMI type 1, 27 bytes >>> System Information >>> Manufacturer: Dell Inc. >>> Product Name: XPS 8930 >>> Version: 1.1.15 >>> Serial Number: 19WS903 >>> UUID: 4c4c4544-0039-5710-8053-b1c04f393033 >>> Wake-up Type: Power Switch >>> SKU Number: 0859 >>> Family: XPS >>>=20 >>>=20 >>> Dell says: >>>=20 >>> https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-89= 30-desktop >>>=20 >>> Operating system >>>=20 >>> With Windows 10 Home >>>=20 >>>=20 >>> So, Windows 10 Home is the only operating system supported by Dell >>> on that computer. Windows 10 Home should not exhibit the bug you >>> have encountered. >>>=20 >>>=20 >>> Check if your software is supported on Windows 10 Home. If so, >>> install Windows 10 Home and install your software. >>>=20 >>>=20 >>> Alternatively, get another computer that is known to be compatible >>> with your OS and software of choice. >>>=20 >>>=20 >>> I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: >>>=20 >>> * Dell PowerEdge T30 with Intel Xeon E3-1225 v5 >>>=20 >>> * Intel S1200V3RPL with Intel Xeon E3-1225 v3 >>>=20 >>>=20 >>> David >=20 >> Jerry any system that is legal/ legitimate following the law and posix >> , ieee 1003 iec/iso/eac etc.. will not be able to do what you want. >>=20 >> Refer to the following article: >>=20 >> Hardware Trojan Horse Device Based on Unintended USB Channels >> Year: 2009, Volume: 1, Pages: 1-8 >> DOI Bookmark: 10.1109/NSS.2009.48 >> Authors=20 >>=20 >> John Clark=20 >> Sylvain Leblanc=20 >> Scott Knight >>=20 >>=20 >> You need to implement a virtual USB Host driver as per USB transaction >> relay techniques... >=20 > Seriously Paul, do you write this dribble to keep yourself amused or is > this a language problem? Are you attempting to insinuate that any > system that works correctly will not do what I want? What type of > gibberish is that? Furthermore, I have no intention of reading an > eleven year old publication, even if I could easily find it. >=20 > Since you obviously have nothing to legitimately add to this thread, > there is no need for you to continue. >=20 > --=20 > Jerry >=20 From owner-freebsd-questions@freebsd.org Fri Mar 19 19:47:27 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 877C95A879F for ; Fri, 19 Mar 2021 19:47:27 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2Dv31Zqsz3mhH for ; Fri, 19 Mar 2021 19:47:27 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mailman.nyi.freebsd.org (Postfix) id 344585A8728; Fri, 19 Mar 2021 19:47:27 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 340DF5A8727 for ; Fri, 19 Mar 2021 19:47:27 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pf1-x42d.google.com (mail-pf1-x42d.google.com [IPv6:2607:f8b0:4864:20::42d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Dv30pHrz3mdh for ; Fri, 19 Mar 2021 19:47:26 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pf1-x42d.google.com with SMTP id j25so6622992pfe.2 for ; Fri, 19 Mar 2021 12:47:26 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:cc:subject:message-id:in-reply-to:references :mime-version:content-transfer-encoding; bh=wkzsebqyoSGZcGIcVdtzuirB8GC+eaKcnsqn80g7l0A=; b=qEhxCkuyz71aeTTnQ5txtSYZmqV4+nDyTpbx6jGaX/dTvuBmfZBv3ygkb7hwY7hFmu XUE8oYTS2AYMmz4XQiGjVHe9dq+tcePB+sU9dqC1FeYRfE6Rz46uuHrse+DqZh7PvKZb 4GHanea+r3b3GA4CEjKpUgWHPSgp3t/BVKUKuFmupzT+Xm6Wcb995DFNnFa0iq6ABbDN xrDNhO1F10dgscW/PFshfsrKKCkKTMPvcjzz1qoBvFJ2jgdp2TvROu3do9rtvtINRwjI UrGs/cZfqQQSNaZzJJV31iCFFatjZ5Ovg21n0l9vgzCpjDIW79DmRMQoqHHHNITeQLGy RzdA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:cc:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=wkzsebqyoSGZcGIcVdtzuirB8GC+eaKcnsqn80g7l0A=; b=uWCRUhCY055UI+F9qBWH2VacEy3PsmdD/qDjMyh6gYHyrwJ/kmjAEJxQAmCkchvgYP 2RHPxBNpov2S2ksK3Hqqvo9AslNWlaAfkAVMIvkJKwwYgANJywPeWScmRQdIE9wiLebK mgZdBu2sW8b0Ozm/QpzC2UndCcHMv+qyfExZ32+bvcQmOe70nWcjC5DeZHRe+PZrb27t 2NaAN4w4OZwJGp10EpeVcfcNx2v6T5l2ZERc58y1mDR5pE/0tzI4Dp+Iknld/FwWj4Pk yPrUefZcZHeLeX8F8Sl08vfQu5lPdfc4gRp4R25T99yJd+KKrR9YWhQxxA3CyDPrBdHL FzAg== X-Gm-Message-State: AOAM533h1gLV/Anp8c/5FcRjOxgCZ6f5UgVtBQoedpb6i2zLU/U3oNzC qUeAEyFqodKTNcifDtaaams= X-Google-Smtp-Source: ABdhPJxtFtp66lTeVuoJwPDol1LQcioLI41HvaNuvxBO2zSEpJV47X0D0TTpMYwdC3aknq+sfdNHYA== X-Received: by 2002:a63:505d:: with SMTP id q29mr12722766pgl.218.1616183245327; Fri, 19 Mar 2021 12:47:25 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id e1sm6334302pfi.175.2021.03.19.12.47.24 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 12:47:24 -0700 (PDT) Date: Fri, 19 Mar 2021 13:47:23 -0600 From: Duke Normandin To: Robert Huff Cc: questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210319134723.f57186844e27c9a099cf8606@gmail.com> In-Reply-To: <24660.54990.961632.559429@jerusalem.litteratus.org> References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2Dv30pHrz3mdh X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; TAGGED_FROM(0.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 19:47:27 -0000 On Fri, 19 Mar 2021 12:52:30 -0400 Robert Huff wrote: > > Duke Normandin writes: > > > Other than being GUI-based, is there any distinct advantage to > > using GPT? > > Um ... I have used GPT for about 10 years. > Never have I used it with a GUI. I was refering to for example: gparted-common/buster,now 1.2.0-1.0antix1 all [installed,automatic] GNOME partition editor -- common data Isn't GPT and acronym for gparted? -- Duke From owner-freebsd-questions@freebsd.org Fri Mar 19 19:49:14 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 60FF75A884B for ; Fri, 19 Mar 2021 19:49:14 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qk1-x72f.google.com (mail-qk1-x72f.google.com [IPv6:2607:f8b0:4864:20::72f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Dx53C3Nz3mjh for ; Fri, 19 Mar 2021 19:49:13 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qk1-x72f.google.com with SMTP id o5so4179661qkb.0 for ; Fri, 19 Mar 2021 12:49:13 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=65xgaD1ei8jM5qahTGrf2dhq0b9eGeJUxkjp9B73oEI=; b=Xx4voy5C83+iqQ19uOZLoeEo5shDvNMPLQdlpKpbnumMF+K7M0IEemEq6Uc1561+lx CyOm4/0J6bzQEtHmbEfQKVoRkFP7ngPTucQUHOn5imgWJon4U7xOoN0H6EdOtl+h3OuH ivJrikmWZW8/xePDYy0tZ7U7UmeUxqW2qiH/Y= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=65xgaD1ei8jM5qahTGrf2dhq0b9eGeJUxkjp9B73oEI=; b=fCJMtgrI5nDdl84NIWMGyyK9ckZ9Q9ZFr0Ysa8iz8H/RZWkmGvArb2grD7kXpOm+o9 kvciF/aFhwQAaVZoyUz91XugfNjq9r4fkYl/mnYqpFZeZHE0WS7J7BFvjPi7+XJjdKpp YRI0pf/9TF65UXoG4neM8JfHt3nlxrSetPG7TuAY6BFHr7WApI4qbd51Legb263Tj+T6 Ozvya3sWpaQ17RwjW1xTMcB6HoGB5Rm+HqQBsPikfNHQinDXBdizXbTM6HKM/h7PuxE5 CgRBD+rjmCTaccRNxJ8FEq9UE8imwbjNoQJUk2n9wWWlSSlAo3MZ4TKN88+HhOIMznim cCKg== X-Gm-Message-State: AOAM531EsgrO2xLkSeNJs1tIXFV1Cl8OC5sVUZptXHXhee/50GletPq8 GqQ5QkSlMnOA4UsZS9V6pNuZU/WRrxAuNw== X-Google-Smtp-Source: ABdhPJxxil9i7ZT5p950NVAcGvKjiBcqEIYbsWKbtEy8IN+DNScR9RCk0Uj9TT2AqzM4sg0hrut2fA== X-Received: by 2002:a37:a282:: with SMTP id l124mr239571qke.37.1616183351502; Fri, 19 Mar 2021 12:49:11 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id a14sm5202381qkc.47.2021.03.19.12.49.10 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 12:49:10 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2Dx142lnz1y97 for ; Fri, 19 Mar 2021 15:49:09 -0400 (EDT) Date: Fri, 19 Mar 2021 15:48:53 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319154853.0000546b@seibercom.net> In-Reply-To: References: Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/.xU4Lr2rsd3Dwuz2H07Z9GB"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2Dx53C3Nz3mjh X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=Xx4voy5C; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::72f as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.38 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::72f:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::72f:from:127.0.2.255]; NEURAL_SPAM_LONG(0.98)[0.983]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::72f:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 19:49:14 -0000 --Sig_/.xU4Lr2rsd3Dwuz2H07Z9GB Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 15:14:49 -0400, Paul stated: > >> Le 19 mars 2021 =C3=A0 13:59, Jerry a =C3=A9crit : >>=20 >> =EF=BB=BFOn Fri, 19 Mar 2021 13:20:34 -0400, Paul stated: =20 >>> Envoy=C3=A9 de mon iPhone >>> =20 >>>> Le 19 mars 2021 =C3=A0 13:14, David Christensen >>>> a =C3=A9crit : >>>>=20 >>>> =EF=BB=BFOn 3/19/21 7:10 AM, Jerry wrote: =20 >>>>> With the soon-to-be release of version 13 of FreeBSD and the EOL >>>>> of FreeBSD 11.x, I will need to invest in a new OS. Due to >>>>> FreeBSD=E2=80=99s unfortunate inability to squash bug >>>>> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D237666, l am >>>>> left with no choice but to seek out a new OS. I need a bare-bones >>>>> system that can run a mail server, Postfix with Dovecot, and a >>>>> few other utilities. =20 >>>>=20 >>>>=20 >>>> Looking at that link, I see: >>>>=20 >>>> ... >>>> Gerard Seibert 2021-02-25 21:01:04 UTC >>>> ... >>>> # dmidecode 3.3 >>>> ... >>>> Handle 0x0001, DMI type 1, 27 bytes >>>> System Information >>>> Manufacturer: Dell Inc. >>>> Product Name: XPS 8930 >>>> Version: 1.1.15 >>>> Serial Number: 19WS903 >>>> UUID: 4c4c4544-0039-5710-8053-b1c04f393033 >>>> Wake-up Type: Power Switch >>>> SKU Number: 0859 >>>> Family: XPS >>>>=20 >>>>=20 >>>> Dell says: >>>>=20 >>>> https://www.dell.com/en-us/shop/desktop-computers/xps-desktop/spd/xps-= 8930-desktop >>>>=20 >>>> Operating system >>>>=20 >>>> With Windows 10 Home >>>>=20 >>>>=20 >>>> So, Windows 10 Home is the only operating system supported by Dell >>>> on that computer. Windows 10 Home should not exhibit the bug you >>>> have encountered. >>>>=20 >>>>=20 >>>> Check if your software is supported on Windows 10 Home. If so, >>>> install Windows 10 Home and install your software. >>>>=20 >>>>=20 >>>> Alternatively, get another computer that is known to be compatible >>>> with your OS and software of choice. >>>>=20 >>>>=20 >>>> I am running 12.2-RELEASE-p4 GENERIC amd64 without any problems on: >>>>=20 >>>> * Dell PowerEdge T30 with Intel Xeon E3-1225 v5 >>>>=20 >>>> * Intel S1200V3RPL with Intel Xeon E3-1225 v3 >>>>=20 >>>>=20 >>>> David =20 >> =20 >>> Jerry any system that is legal/ legitimate following the law and >>> posix , ieee 1003 iec/iso/eac etc.. will not be able to do what you >>> want. >>>=20 >>> Refer to the following article: >>>=20 >>> Hardware Trojan Horse Device Based on Unintended USB Channels >>> Year: 2009, Volume: 1, Pages: 1-8 >>> DOI Bookmark: 10.1109/NSS.2009.48 >>> Authors=20 >>>=20 >>> John Clark=20 >>> Sylvain Leblanc=20 >>> Scott Knight >>>=20 >>>=20 >>> You need to implement a virtual USB Host driver as per USB >>> transaction relay techniques... =20 >>=20 >> Seriously Paul, do you write this dribble to keep yourself amused or >> is this a language problem? Are you attempting to insinuate that any >> system that works correctly will not do what I want? What type of >> gibberish is that? Furthermore, I have no intention of reading an >> eleven year old publication, even if I could easily find it. >>=20 >> Since you obviously have nothing to legitimately add to this thread, >> there is no need for you to continue. >>=20 >> --=20 >> Jerry >Jerry you are projecting and being inherently offensive. All the >insults you have put towards me are a deflection of yourself.=20 > >Freebsd is incorporated into the largest systems out there and is of >the most reputed and highest quality computer operating systems in >existence in the world. Your comments that negate our efforts whether >it is myself, my compatriots , members of the Computer Society or BSD >community. We are trying to help you and you insult us. We don=E2=80=99t >accept your insults but we simply respond by trying to help you. It >seems you are destined to get lost but I ask that you refrain from >trying to take us down with you. Thank you for your understanding. I >don=E2=80=99t use Dell Computers, it=E2=80=99s against our companies polic= y. I have to >build the computers with components. You should be able to take it up >with Dell but it sounds like they want you to invest more money to get >the SLA that supports the use of your intentions. For example they >would sell you a computer specific to server purposes, etc.. My >company allows LeNovo ie. for laptops, etc.. Nevertheless there is a >compatibility of components list. Freebsd does not work on assembled >systems compatibility but on a component basis. If you want to >determine what is compatible with your system talk to Dell and ask >them to give you a factory installation or restore for the opera >system that they intended to be used with your system. Solves the >problem right there. And take your insults with you. Do you understand the concept of "Top Posting", "Bottom Posting" and "Inline Posting"? If not, look it up. The relative installed base of any system is just a statistic. In reality, the only installation that matters is the one you are responsible for. In other words, the Russian =E2=80=9CTsar Bomba,=E2=80=9D = was the largest bomb ever tested. However, if it had failed to detonate, all it would have been in reality was a very large paper weight. --=20 Jerry --Sig_/.xU4Lr2rsd3Dwuz2H07Z9GB Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBVACwACgkQgHBP8gv9 FXcG1gv/Q+0Q0vlCDdoNPNOSf9O1L99Sm0Hv6ar169xFmaAtzbqafAhg47AOcEZ/ lOjUG84kIKB21OJfQFKbX3U97t9cDdoizeKmXVNdjBFP01nbYJmwnydcjiMo3xZo +lNVfXfOu6HK8reS+W5Ia9HYY+AX4CEdTzKY3d6BVvylOmt+E757KCPSndrzTDpv OpblxDhbHF7wSmen3XZ/NpWqNfKV3IwCIRVsALBn6amlsg6ZFhG1jDi1W7baPJjV hh7l2EXcPoCAEdGNC0KYiHjnDv4NCCmvPb3sj7UD+a3cbEUh/ZOUJtqilydzksso FiIzUU532ZNRHm0BWjoaDAIvj6iVL3VBk+xe1hCu/tnQQpttlDtBL3CCQOjfXII8 Ia/wYiHc/qYTqhtPsgGVRP8w948C6HzGLXsFsM3O0/zt18M9C9+O6A0dPGN90YA6 ul8MlAvzfi5ghsPENuu2oOLpwkLef4Jmn+cIC+xA/HcyjTi1HScnB4HqCiSTnhef gUbXbLe9 =mKHs -----END PGP SIGNATURE----- --Sig_/.xU4Lr2rsd3Dwuz2H07Z9GB-- From owner-freebsd-questions@freebsd.org Fri Mar 19 19:51:12 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5C5875A8D87 for ; Fri, 19 Mar 2021 19:51:12 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pg1-x52f.google.com (mail-pg1-x52f.google.com [IPv6:2607:f8b0:4864:20::52f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2DzM4b9qz3mnv for ; Fri, 19 Mar 2021 19:51:11 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pg1-x52f.google.com with SMTP id n11so4392967pgm.12 for ; Fri, 19 Mar 2021 12:51:11 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:in-reply-to:references:mime-version :content-transfer-encoding; bh=c9WsEBrFZ4v4wWk4UUiEBLbqRL4zEFmVtxBlDcuNsE8=; b=VwqZUB7OdsCm3L3iw7ilnaDhL/KgZWZgovImEx844mAMdRNqa1MdskWYbO7B7sjnqm XCb+9471027UXaU/9kPP5hXmXT1ngX4sWSPrhT1p7Bcvudci58iQDDUYjy/ScRqVOeOZ gDjsOwqVzDXu96a/oD1ZG4JIDJ0aamASWlnlD/d907Zi9+EureKZ4KoaVdYCIW+pZJg9 DX9KzXBW1iUEg/qoIeKdzQmKyjrojj8YhWmbXV7zDpRpkKDpjqKzkmt+Hu3IVmEm2L10 Z9CVA8iarOxmgWg2JlWuUsGZs/BTUS/5rSt+ZZPviGtnNWABxaVYGxTH0X3OBKmoeRwz RYHw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=c9WsEBrFZ4v4wWk4UUiEBLbqRL4zEFmVtxBlDcuNsE8=; b=aV78Pf3khrA0JlpkwbI+ew/SOjp4fbDeXGs7AjvEOsUeBhJMl0AK1M42qVOh4oaFaF tObR0nskwXg18mJSkO9F/feN8R2pfyiN81fgiqBSltA+zRW+XFrEuG87MibYHPctT8gv if7NL2mrMcHB/ETOvybDdLrKeYmCiQ8eL83HY6hK31TLY8QYTR56BGTzyysht5pAtJyS KkZmrm5qY8jaUBCKzEwTS9A1myqlZ91wM+7ewAXPPr83/x/pN3axXmwSlf76UfLg7xEz 5W4Hkzy+EnVzJxahhdag92+pUdrvRQu1qCRX6ZmB9NZt6lD1lJ1KQYNw7DNBqCXhwq9X NUwQ== X-Gm-Message-State: AOAM531ZS4CTCvFYCHg8ojhW4ti461kAva3lNRrOVXF1m/1+IkCDU5cr UFJ4TkMmzkPMAukEqlMLv5f5ce6+NUzWhGYF X-Google-Smtp-Source: ABdhPJzdclYA/leKr2OwxzZHlcPl1nOYlCkZFP6GMVFuwhnD+LHZdNIRAqECZIkePulxBlALCHo3mg== X-Received: by 2002:a62:78d4:0:b029:1f1:595b:dfdf with SMTP id t203-20020a6278d40000b02901f1595bdfdfmr10848581pfc.81.1616183469940; Fri, 19 Mar 2021 12:51:09 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id 3sm6138898pfh.13.2021.03.19.12.51.09 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 12:51:09 -0700 (PDT) Date: Fri, 19 Mar 2021 13:51:08 -0600 From: Duke Normandin To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210319135108.89059e13704f13ec551f2de0@gmail.com> In-Reply-To: References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2DzM4b9qz3mnv X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=VwqZUB7O; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::52f as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; MV_CASE(0.50)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::52f:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::52f:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::52f:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 19:51:12 -0000 On Fri, 19 Mar 2021 10:26:39 -0700 "Russell L. Carter" wrote: [snip] > As others have pointed out, don't forget partition labels. It is > considerably easier to figure out what each partition is being used > for if they have been labeled in an obvious way: > > $ gpart list | grep label > label: gptboot0 > label: swap0 > label: zfs0 > label: ssd1 > label: m.2_ssd1 > > > Especially if it has been some time since the last time you looked. Thanks for the tip!! -- Duke Normandin From owner-freebsd-questions@freebsd.org Fri Mar 19 20:01:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 23FA85A8D51 for ; Fri, 19 Mar 2021 20:01:06 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from holgerdanske.com (holgerdanske.com [184.105.128.27]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "www.holgerdanske.com", Issuer "www.holgerdanske.com" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2FBm4JjKz3nCv for ; Fri, 19 Mar 2021 20:01:04 +0000 (UTC) (envelope-from dpchrist@holgerdanske.com) Received: from 99.100.19.101 (99-100-19-101.lightspeed.frokca.sbcglobal.net [99.100.19.101]) by holgerdanske.com with ESMTPSA (TLS_AES_128_GCM_SHA256:TLSv1.3:Kx=any:Au=any:Enc=AESGCM(128):Mac=AEAD) (SMTP-AUTH username dpchrist@holgerdanske.com, mechanism PLAIN) for ; Fri, 19 Mar 2021 13:01:00 -0700 Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> From: David Christensen Message-ID: <76c40e90-cf10-fe69-d60a-89428c4be5e8@holgerdanske.com> Date: Fri, 19 Mar 2021 13:00:59 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319140448.00007521@seibercom.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2FBm4JjKz3nCv X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of dpchrist@holgerdanske.com has no SPF policy when checking 184.105.128.27) smtp.mailfrom=dpchrist@holgerdanske.com X-Spamd-Result: default: False [-2.10 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[184.105.128.27:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[184.105.128.27:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_NA(0.00)[holgerdanske.com]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6939, ipnet:184.104.0.0/15, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:01:06 -0000 On 3/19/21 11:04 AM, Jerry wrote: > I had considered using a different flavor of BSD. I still might. > However, I also happen to have a spare HD that I could plug into the > system, install Windows 10 Pro and Hyper V and then see if FreeBSD 12.x > or newer works correctly. That would only take a short amount of time. > I just need to do it at night so I can take the system offline. > > It probably won't work, but if FreeBSD is isolated from the hardware, > it might be all that is needed in the short run. FreeBSD on Hyper V on Windows 10 should work: https://docs.microsoft.com/en-us/windows-server/virtualization/hyper-v/supported-freebsd-virtual-machines-on-hyper-v If not, alternatives include VirtualBox, VMware, and Qemu. David From owner-freebsd-questions@freebsd.org Fri Mar 19 20:03:55 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4EF0B5A8E0F for ; Fri, 19 Mar 2021 20:03:55 +0000 (UTC) (envelope-from 4250.82.1d4ce0003842bce.d1d3cf1925335a57dc8d798f44d64bc9@email-od.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2FG30hBwz3ns4 for ; Fri, 19 Mar 2021 20:03:55 +0000 (UTC) (envelope-from 4250.82.1d4ce0003842bce.d1d3cf1925335a57dc8d798f44d64bc9@email-od.com) Received: by mailman.nyi.freebsd.org (Postfix) id 176EB5A9402; Fri, 19 Mar 2021 20:03:55 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1736C5A9401 for ; Fri, 19 Mar 2021 20:03:55 +0000 (UTC) (envelope-from 4250.82.1d4ce0003842bce.d1d3cf1925335a57dc8d798f44d64bc9@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2FG300zZz3nmq for ; Fri, 19 Mar 2021 20:03:54 +0000 (UTC) (envelope-from 4250.82.1d4ce0003842bce.d1d3cf1925335a57dc8d798f44d64bc9@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616184235; x=1618776235; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=GpXf2qu1N3JaLEeu+9QQ2JHmlf08qhW2y1aKSeT/iRQ=; b=XzG1gb2JmFui9v0M68I1cgA+vWxmLSYU9+88rMjbmEEO1Ya3NAXxwbZ1tUNwx8ekzi6Q2QOIOaiwykKmX7crYN/loGc+IaGjgGhN9LT8RJsMtWrymNVo2Bw9ZeBigSvre6TNV+FUsyUknc5pOEZ0/FdXgM2UO5J/zXC73GmTcyQ= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDM4NDJiY2UucXVlc3Rpb25zPWZyZWVic2Qub3Jn Received: from r3.us-east-2.aws.in.socketlabs.com (r3.us-east-2.aws.in.socketlabs.com [142.0.189.3]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Fri, 19 Mar 2021 16:03:48 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Fri, 19 Mar 2021 16:03:41 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lNLLO-000LJw-QG; Fri, 19 Mar 2021 20:03:38 +0000 Date: Fri, 19 Mar 2021 20:03:38 +0000 From: Steve O'Hara-Smith To: Duke Normandin Cc: Robert Huff , questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210319200338.e9000fd3e177bb4f0300ce3c@sohara.org> In-Reply-To: <20210319134723.f57186844e27c9a099cf8606@gmail.com> References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> <20210319134723.f57186844e27c9a099cf8606@gmail.com> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2FG300zZz3nmq X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; TAGGED_RCPT(0.00)[]; REPLY(-4.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:03:55 -0000 On Fri, 19 Mar 2021 13:47:23 -0600 Duke Normandin wrote: > Isn't GPT and acronym for gparted? No GPT is an abbreviation for Guid Partition Table which is a standard (part of the UEFI standard) that defines the layout of partition data on a disc or similar block structured store. Gparted is a tool (one of many) for editing partition tables - the FreeBSD command line tool gpart is another. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Fri Mar 19 20:08:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3E3EB5A9737 for ; Fri, 19 Mar 2021 20:08:23 +0000 (UTC) (envelope-from "") Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2FM90DpYz3pCM for ; Fri, 19 Mar 2021 20:08:21 +0000 (UTC) (envelope-from "") Received: by mailman.nyi.freebsd.org (Postfix) id 076725A9917; Fri, 19 Mar 2021 20:08:21 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 06EAA5A9832 for ; Fri, 19 Mar 2021 20:08:21 +0000 (UTC) (envelope-from "") Received: from securemail-y4.synaq.com (securemail-y4.synaq.com [196.35.198.161]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.synaq.com", Issuer "GeoTrust TLS DV RSA Mixed SHA256 2020 CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2FM64mQpz3pMh for ; Fri, 19 Mar 2021 20:08:18 +0000 (UTC) (envelope-from "") Received: from [172.245.162.177] by securemail-pl-omx5.synaq.com with esmtpsa (TLS1) tls TLS_DHE_RSA_WITH_AES_256_CBC_SHA (Exim 4.93.0.4-30-5edf9c7) id 1lNLKj-00007T-Cb for questions@FreeBSD.ORG; Fri, 19 Mar 2021 22:02:57 +0200 MIME-Version: 1.0 Subject: Important Message questions@FreeBSD.ORG To: questions@FreeBSD.ORG From: "ANZ Internet Banking" <> Date: Fri, 19 Mar 2021 13:02:47 -0700 X-UNKNOWN-NULL: Yes X-Red-Router: yes X-SYNAQ-Pinpoint-Information: Please contact SYNAQ for more information X-SYNAQ-Pinpoint-ID: 1lNLKj-00007T-Cb X-SYNAQ-Pinpoint: No virus infections found X-SYNAQ-Pinpoint-SpamCheck: not spam, SpamAssassin (not cached, score=6.109, required 9, autolearn=disabled, ALL_TRUSTED -1.00, FROM_NO_USER 2.60, HTML_IMAGE_RATIO_06 0.00, HTML_MESSAGE 0.00, MISSING_MID 0.14, NULLSENDER 0.01, TVD_PH_BODY_ACCOUNTS_PRE 0.00, URI_GOOGLE_PROXY 1.63, WIKI_IMG 2.72) X-SYNAQ-Pinpoint-SpamScore: ssssss X-Pinpoint-From: X-Rspamd-Queue-Id: 4F2FM64mQpz3pMh X-Spamd-Bar: +++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of securemail-y4.synaq.com has no SPF policy when checking 196.35.198.161) smtp.helo=securemail-y4.synaq.com X-Spamd-Result: default: False [5.55 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ZERO_FONT(0.10)[1]; TO_DN_NONE(0.00)[]; URI_COUNT_ODD(1.00)[1]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[196.35.198.161:from]; ASN(0.00)[asn:3741, ipnet:196.34.0.0/15, country:ZA]; R_DKIM_NA(0.00)[]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; DMARC_NA(0.00)[No domain in From header]; AUTH_NA(1.00)[]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[196.35.198.161:from:127.0.2.255]; MANY_INVISIBLE_PARTS(0.05)[1]; MISSING_MID(2.50)[]; NEURAL_SPAM_LONG(1.00)[1.000]; RCVD_IN_DNSWL_NONE(0.00)[196.35.198.161:from]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; GREYLIST(0.00)[pass,body]; MAILMAN_DEST(0.00)[questions] Content-Type: text/plain; charset="iso-8859-1" Content-Transfer-Encoding: quoted-printable Content-Description: Mail message body X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:08:23 -0000 = = = = = = = = Dear ANZ customer = = Your ANZ Internet Banking access has been violated. We suspected someone o= ther than you with IP 178.210.92*** trying to access your information's. = = Please verify your banking information with us to show that you are not= currently away. You have to verify this as soon as possible to prevent you= r online bank account from getting suspended. = Restore your Access = =A9 Australia and New Zealand Banking Group Limited (ANZ) ABN 11 005 35= 7 522. ACLN and AFSL Number 234527. = = = = = = = =20 From owner-freebsd-questions@freebsd.org Fri Mar 19 20:09:04 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 7BEB55A9D8B for ; Fri, 19 Mar 2021 20:09:04 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from h2.pinyon.org (h2.pinyon.org [65.101.20.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2FMz3ykwz3pgx for ; Fri, 19 Mar 2021 20:09:03 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from [10.0.10.15] (unknown [10.0.10.15]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by h2.pinyon.org (Postfix) with ESMTPSA id A527D3AE8B for ; Fri, 19 Mar 2021 13:09:01 -0700 (MST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pinyon.org; s=dkim; t=1616184541; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=my7ICEmW2VTbJP4RevYJDESPUKx5TvHTjCI9zaLA2hg=; b=LSOjSLjbPL1ulhZYm2FQNOunXedt3dVenMwpIflliydgEESyLZAqwZwO/evKyFHg3cKQIp 6vsd2IQe0qe6IWk4FEvBjNPYTp+tqc9c2CN/DogvvYlzdLyg5+O6lyMXVxBPMc/yL34Pho JLJdS7laoj7r7ihPKqlvQTcbAsiAHvg= Subject: Re: Partitioning 1T HDD To: freebsd-questions@freebsd.org References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> <20210319134723.f57186844e27c9a099cf8606@gmail.com> From: "Russell L. Carter" Message-ID: <759c6bb9-b619-c369-ba61-4814da98eae4@pinyon.org> Date: Fri, 19 Mar 2021 13:09:01 -0700 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Firefox/78.0 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: <20210319134723.f57186844e27c9a099cf8606@gmail.com> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Spam-Status: No, score=-1.57 X-Rspamd-Server: h2 X-Rspamd-Queue-Id: 4F2FMz3ykwz3pgx X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=pinyon.org header.s=dkim header.b=LSOjSLjb; dmarc=none; spf=pass (mx1.freebsd.org: domain of rcarter@pinyon.org designates 65.101.20.170 as permitted sender) smtp.mailfrom=rcarter@pinyon.org X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[pinyon.org:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.101.20.170:from:127.0.2.255]; DMARC_NA(0.00)[pinyon.org]; DKIM_TRACE(0.00)[pinyon.org:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.101.20.170:from]; ASN(0.00)[asn:209, ipnet:65.101.0.0/18, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:09:04 -0000 On 3/19/21 12:47 PM, Duke Normandin wrote: > On Fri, 19 Mar 2021 12:52:30 -0400 > Robert Huff wrote: > >> >> Duke Normandin writes: >> >>> Other than being GUI-based, is there any distinct advantage to >>> using GPT? >> >> Um ... I have used GPT for about 10 years. >> Never have I used it with a GUI. > > I was refering to for example: > > gparted-common/buster,now 1.2.0-1.0antix1 all [installed,automatic] > GNOME partition editor -- common data > > Isn't GPT and acronym for gparted? > $ man gpart(8) Here's another of my systems with their labels: $ gpart list | grep label label: systemb0 label: systems0 label: systemd0 label: systemb1 label: systems1 label: systemd1 label: raidd4 label: raidd3.1 label: raidd1.1 label: raidd5.1 label: raidd2.1 label: raidd0.1 I have a gpt zfs root mirror, and that pair is 'system', 'b' is gptboot, 's' is swap, 'd' is data, '0' and '1' are the drives. Also I have a raidz2, d0-d5 are the disks, .n is the number of times that drive slot been replaced (zero based). I'd probably be even clearer in the labels in the future, but you get the idea. Cheers, Russell From owner-freebsd-questions@freebsd.org Fri Mar 19 20:32:20 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3A1CE5AADE3 for ; Fri, 19 Mar 2021 20:32:20 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Ftq3F1Bz3rQg for ; Fri, 19 Mar 2021 20:32:19 +0000 (UTC) (envelope-from ralf-mardorf@riseup.net) Received: from fews2.riseup.net (fews2-pn.riseup.net [10.0.1.84]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F2Ftn47ctzDqhJ for ; Fri, 19 Mar 2021 13:32:17 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616185937; bh=OPr6Jhqrp0Ra03tyHnm6AFo3lHXPTvErYuvKTFMOR58=; h=Date:From:To:Subject:In-Reply-To:References:From; b=hquPfBupfFfoveuTNSyuAKw6oXZRxB0G5KDONEtlQv0D/MSLL36RI063EwFBC1Jt0 2Wi0pekxrco+aFGdu+FDggzRi/O+gqn8M7beoQD/iO4du+41MEIDRyfHFeDgvdW1ez tmBl+ycLMBsVlTxbp+AAU03lOhiYFBNj6pu4snIo= X-Riseup-User-ID: C4F75E10AC9A6E04594F2FED04BCDB0A3654278286E7B389E6E041AB3AE4D6B5 Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews2.riseup.net (Postfix) with ESMTPSA id 4F2Ftm6mNTz1ySR for ; Fri, 19 Mar 2021 13:32:16 -0700 (PDT) Date: Fri, 19 Mar 2021 21:32:14 +0100 From: Ralf Mardorf To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210319213214.4f8ddf55@archlinux> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2Ftq3F1Bz3rQg X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=hquPfBup; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of ralf-mardorf@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=ralf-mardorf@riseup.net X-Spamd-Result: default: False [-4.60 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; MID_RHS_NOT_FQDN(0.50)[]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:32:20 -0000 On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: >Void uses a runit init system with no systemd Hi, I suspect it's not a good idea to use Linux without systemd. For example, by upstream udev is part of systemd. Maintaining Linux without systemd is a bottomless pit. On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: >Recompiling the kernel is *TRIVIAL* if you refuse to do it then you >should not be using any Unix variant I dislike this tone of voice. However, I agree that compiling the kernel might be less effort, than migrating to another operating system. If you would e.g. migrate to Arch Linux, you need to get used to systemd. Getting used to systemd isn't pleasant. If you chose a Linux distro that doesn't use systemd, you likely will experience all kinds of trouble, if you want to customize your install. Regards, Ralf From owner-freebsd-questions@freebsd.org Fri Mar 19 20:55:57 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 601A55AB545 for ; Fri, 19 Mar 2021 20:55:57 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2GQ44Vm0z3sdC for ; Fri, 19 Mar 2021 20:55:56 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from fews1.riseup.net (fews1-pn.riseup.net [10.0.1.83]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F2GQ25KnjzDq8y for ; Fri, 19 Mar 2021 13:55:54 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616187354; bh=SLdiy5kyM6VlYKlouiuBtTAARvIN5bN5uzI5dYilcFQ=; h=Date:From:To:Subject:In-Reply-To:References:From; b=ft4oM7w0ymAUn7O5MJ3UOMuSQ+z+bN43TJfj3FCm9rM6hVjA8j0/IyiSkav93wOPf gpcvWDT/A8n3lNCA8+zGjgIL3w7bkjUpSjLFMSZrpgmAQIguBnvzKoW1zp+IxMZjhE gq366CVENoWAHPOrVjlLI/xJqr7mIOKDPbLzW/Ck= X-Riseup-User-ID: F4E540F6B0C8C51016FD0AE6FDBFB5309BCFF695AAB5614A132E0B53A77CA3D4 Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews1.riseup.net (Postfix) with ESMTPSA id 4F2GQ24Q9Dz5vNM for ; Fri, 19 Mar 2021 13:55:54 -0700 (PDT) MIME-Version: 1.0 Date: Fri, 19 Mar 2021 13:55:54 -0700 From: Weaver To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD In-Reply-To: <20210319134723.f57186844e27c9a099cf8606@gmail.com> References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> <20210319134723.f57186844e27c9a099cf8606@gmail.com> Message-ID: Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2GQ44Vm0z3sdC X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=ft4oM7w0; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of weaver@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=weaver@riseup.net X-Spamd-Result: default: False [-5.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:55:57 -0000 On 20-03-2021 05:47, Duke Normandin wrote: > On Fri, 19 Mar 2021 12:52:30 -0400 > Robert Huff wrote: > >> >> Duke Normandin writes: >> >> > Other than being GUI-based, is there any distinct advantage to >> > using GPT? >> >> Um ... I have used GPT for about 10 years. >> Never have I used it with a GUI. > > I was refering to for example: > > gparted-common/buster,now 1.2.0-1.0antix1 all [installed,automatic] > GNOME partition editor -- common data > > Isn't GPT and acronym for gparted? Nope! https://www.easeus.com/partition-master/mbr-vs-gpt.html Cheers! Harry. -- `The World is not dangerous because of those who do harm but because of those who look on without doing anything'. -- Albert Einstein From owner-freebsd-questions@freebsd.org Fri Mar 19 21:02:00 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3A13D5ABC08 for ; Fri, 19 Mar 2021 21:02:00 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from mailman.nyi.freebsd.org (mailman.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:13]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2GY403zTz3syx for ; Fri, 19 Mar 2021 21:02:00 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: by mailman.nyi.freebsd.org (Postfix) id 022225ABCD5; Fri, 19 Mar 2021 21:02:00 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 01E825ABC07 for ; Fri, 19 Mar 2021 21:02:00 +0000 (UTC) (envelope-from roberthuff@rcn.com) Received: from smtp.rcn.com (smtp.rcn.com [69.168.97.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2GY313Lbz3syw for ; Fri, 19 Mar 2021 21:01:58 +0000 (UTC) (envelope-from roberthuff@rcn.com) DKIM-Signature: v=1; a=rsa-sha1; d=rcn.com; s=20180516; c=relaxed/simple; q=dns/txt; i=@rcn.com; t=1616187718; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=AYRKb57ytxB2kxgmLVBvC/P4Y88=; b=c/n4P3Uy6R/3cA3yslCnXRMO7leXY8ATfrqmnzH9HtVfdg9i2pAgbOO5rYPI4aUz +gFtFlx7VE0p31g13tFmF1ctiYSa156Ho5ELtFi2oUfLJUDDbB+1B6X6o2MAeyFh J2Sd0L/rZ5xHFfOlhUPQx8jbYooaeTU5SoM0SyGsT+KDZWH+9N9PjtTZ39HzuWz9 1t2q2skVr3cXM1lvXr88yXE73pamtTO4+Bg0HuqS14ogE8yrKePUMM04AMGbGTbB mZJyQYGwcKXi2SMOIlHL1JS4hw37ryDlabbHxEVms8HUSUyjxn/WySLTstNKqPnw vf8Xv0COF29V8y/DZvaswg==; X-Authed-Username: cm9iZXJ0aHVmZkByY24uY29t Received: from [209.6.230.48] ([209.6.230.48:39395] helo=jerusalem.litteratus.org.litteratus.org) by smtp.rcn.com (envelope-from ) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTPSA (cipher=AES256-GCM-SHA384) id FE/19-54468-54115506; Fri, 19 Mar 2021 17:01:58 -0400 Message-ID: <24661.4421.382772.880149@jerusalem.litteratus.org> Date: Fri, 19 Mar 2021 17:01:57 -0400 MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Transfer-Encoding: 7bit From: Robert Huff To: "Russell L. Carter" CC: questions@freebsd.org Subject: Re: Partitioning 1T HDD In-Reply-To: References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> X-Mailer: VM 8.2.0b under 27.1 (amd64-portbld-freebsd13.0) X-Vade-Verdict: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledrudefledgtdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuufgjpfetvefqtfdptfevpfdpqfgfvfenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepkfffgggtgffhvffujghfofesthejredtredtvdenucfhrhhomheptfhosggvrhhtucfjuhhffhcuoehrohgsvghrthhhuhhffhesrhgtnhdrtghomheqnecuggftrfgrthhtvghrnhephefgteegtedthfeuudeikeevjefgteevveffteekleefjefhjedvffefhefgvedtnecukfhppedvtdelrdeirddvfedtrdegkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdeirddvfedtrdegkeenpdhmrghilhhfrhhomheprhhosggvrhhthhhufhhfsehrtghnrdgtohhmnedprhgtphhtthhopehrtggrrhhtvghrsehpihhnhihonhdrohhrghen X-Vade-Client: RCN X-Rspamd-Queue-Id: 4F2GY313Lbz3syw X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rcn.com header.s=20180516 header.b=c/n4P3Uy; dmarc=pass (policy=none) header.from=rcn.com; spf=pass (mx1.freebsd.org: domain of roberthuff@rcn.com designates 69.168.97.78 as permitted sender) smtp.mailfrom=roberthuff@rcn.com X-Spamd-Result: default: False [-5.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[rcn.com:s=20180516]; RCVD_IN_DNSWL_LOW(-0.10)[69.168.97.78:from]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:69.168.97.0/24]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[rcn.com:dkim]; RWL_MAILSPIKE_POSSIBLE(0.00)[69.168.97.78:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; SPAMHAUS_ZRD(0.00)[69.168.97.78:from:127.0.2.255]; DKIM_TRACE(0.00)[rcn.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[rcn.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[69.168.97.78:from]; ASN(0.00)[asn:36271, ipnet:69.168.97.0/24, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[questions]; RCVD_COUNT_TWO(0.00)[2] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 21:02:00 -0000 "Russell L. Carter" writes: > $ gpart list | grep label > label: gptboot0 > label: swap0 > label: zfs0 > label: ssd1 > label: m.2_ssd1 On one system: label: (null) label: root label: (null) label: usr label: (null) label: (null) label: data label: backup label: (null) label: var label: backup Not quite sure why there are two "backup". The "(null)"s are swap space. Respectfully, Robert Huff From owner-freebsd-questions@freebsd.org Fri Mar 19 21:10:18 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5B7875ABF20 for ; Fri, 19 Mar 2021 21:10:18 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from johnea.net (johnea.net [75.60.233.73]) (using TLSv1 with cipher DHE-RSA-CAMELLIA256-SHA (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Gkd3h2Hz3tKs for ; Fri, 19 Mar 2021 21:10:17 +0000 (UTC) (envelope-from freebsd@johnea.net) Received: from [192.168.100.201] (w520.johnea.net [192.168.100.201]) (using TLSv1 with cipher AES128-SHA (128/128 bits)) (No client certificate requested) by johnea.net (Postfix) with ESMTPSA id AE0785F2370B for ; Fri, 19 Mar 2021 14:10:15 -0700 (PDT) Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> From: freebsd@johnea.net Message-ID: Date: Fri, 19 Mar 2021 14:10:14 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:78.0) Gecko/20100101 Thunderbird/78.7.0 MIME-Version: 1.0 In-Reply-To: <20210319213214.4f8ddf55@archlinux> Content-Type: text/plain; charset=utf-8 Content-Language: en-US Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2Gkd3h2Hz3tKs X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=pass (policy=none) header.from=johnea.net; spf=pass (mx1.freebsd.org: domain of freebsd@johnea.net designates 75.60.233.73 as permitted sender) smtp.mailfrom=freebsd@johnea.net X-Spamd-Result: default: False [-3.90 / 15.00]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[75.60.233.73:from]; TO_MATCH_ENVRCPT_ALL(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:75.60.233.73]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_DN_NONE(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[75.60.233.73:from:127.0.2.255]; ARC_NA(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[johnea.net,none]; FROM_NO_DN(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7018, ipnet:75.48.0.0/12, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[75.60.233.73:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 21:10:18 -0000 Wow! An amazing amount of distraction from the primary topic on this thread. On 3/19/21 1:32 PM, Ralf Mardorf wrote: > On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: >> Void uses a runit init system with no systemd > > Hi, > > I suspect it's not a good idea to use Linux without systemd. For > example, by upstream udev is part of systemd. Maintaining Linux without > systemd is a bottomless pit. > Linux existed for many years prior to systemd. Even after systemd became common, a number of highly used distributions have chosen not to use it. Alternatives to udev, without the rest of systemd, are readily available and highly reliable. Although as stated in the unquoted portion of the post: use the linux distro that's easiest for you. The primary point being, confirming if this bug exists, or does not exist, on the exact same motherboard, for the linux kernel, as opposed to the FreeBSD kernel, would be a very valuable data point. Arguing over linux distro benefits, or what's the best SMTP server s/w, or starting a systemd rant, are all off topic. > On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: >> Recompiling the kernel is *TRIVIAL* if you refuse to do it then you >> should not be using any Unix variant > > I dislike this tone of voice. However, I agree that compiling the kernel > might be less effort, than migrating to another operating system. If you > would e.g. migrate to Arch Linux, you need to get used to systemd. > Getting used to systemd isn't pleasant. If you chose a Linux distro > that doesn't use systemd, you likely will experience all kinds of > trouble, if you want to customize your install. > I have to agree Ralf, it seems to be blaming the problem on the person experiencing it. However, if you check the original bug report sited: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=237666 You'll see that: 1) quite a few kernels have been built in the effort to track down the cause of this issue. 2) numerous user's experienced this bug on different manufacturer's motherboards 3) this issue did not occur in the 11.x series, but it does occur in both 12.x and 13.x, on affected platforms Jerry, I would still advocate trying _any_ linux OS on that motherboard just to see if it works. Windows is not as much of a test, as Microsoft does work with h/w vendors to make sure windows works on their upcoming hardware releases. However, if FreeBSD works in a virtual machine on the same hardware, that is also a valuable data point. johnea From owner-freebsd-questions@freebsd.org Fri Mar 19 21:16:04 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E8B395AC5A1 for ; Fri, 19 Mar 2021 21:16:04 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from mailman.nyi.freebsd.org (unknown [127.0.1.3]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2GsJ2Sv8z3vJ4 for ; Fri, 19 Mar 2021 21:16:04 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: by mailman.nyi.freebsd.org (Postfix) id 3B8AF5AC519; Fri, 19 Mar 2021 21:16:04 +0000 (UTC) Delivered-To: questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 01DBA5AC3CF for ; Fri, 19 Mar 2021 21:16:03 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from h2.pinyon.org (h2.pinyon.org [65.101.20.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2GsH48bCz3vL9 for ; Fri, 19 Mar 2021 21:16:03 +0000 (UTC) (envelope-from rcarter@pinyon.org) Received: from [10.0.10.15] (unknown [10.0.10.15]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by h2.pinyon.org (Postfix) with ESMTPSA id 59B2E3AED1; Fri, 19 Mar 2021 14:16:01 -0700 (MST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=pinyon.org; s=dkim; t=1616188561; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=pOLcUAzZ2byOFpejtivuoDpqz9+j+UCUFXL4QgU1DyA=; b=CWD/ayOROopCr6ntktaJQVWerWyVwbadxD3xj+WHpYLz9hO59dDUPxtV9/H6DxGBVg+M/M YvgkPORDM6A4E73LIIoTdFM9Y0Nh4yGjERo2S4zTqPghEOepQAEpkxxeqNtefLuxNP3kLR s4zb648dq8An6gKySOGrpg55rQefIOA= Subject: Re: Partitioning 1T HDD To: Robert Huff Cc: questions@freebsd.org References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> <24661.4421.382772.880149@jerusalem.litteratus.org> From: "Russell L. Carter" Message-ID: Date: Fri, 19 Mar 2021 14:16:01 -0700 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Firefox/78.0 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: <24661.4421.382772.880149@jerusalem.litteratus.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Spam-Status: No, score=-3.06 X-Rspamd-Server: h2 X-Rspamd-Queue-Id: 4F2GsH48bCz3vL9 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; none X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 21:16:05 -0000 On 3/19/21 2:01 PM, Robert Huff wrote: > > "Russell L. Carter" writes: > >> $ gpart list | grep label >> label: gptboot0 >> label: swap0 >> label: zfs0 >> label: ssd1 >> label: m.2_ssd1 > > On one system: > > label: (null) > label: root > label: (null) > label: usr > label: (null) > label: (null) > label: data > label: backup > label: (null) > label: var > label: backup You have to set the labels yourself using gpart(8). Maybe this is how the installer configured them? It's certainly valid to have no label, which is what (null) is. I have to confess that when I ran away from systemd about 7 years ago I had little to no interest in gpart partition labels. But in the last year or two I finally groked the underlying idea and now I am pretty careful to make them and keep them up-to-date. I guess I was default highly allergic to messing around with partition tables, but gpart has been really smooth. Warren Block's disk setup page helped me see the light: http://wonkity.com/~wblock/docs/html/disksetup.html Russell > Not quite sure why there are two "backup". > The "(null)"s are swap space. > > > Respectfully, > > > Robert Huff > From owner-freebsd-questions@freebsd.org Fri Mar 19 22:30:13 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 86F7F5AED97 for ; Fri, 19 Mar 2021 22:30:13 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb2c.google.com (mail-yb1-xb2c.google.com [IPv6:2607:f8b0:4864:20::b2c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2JVr3ysFz4VQd for ; Fri, 19 Mar 2021 22:30:12 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb2c.google.com with SMTP id p193so7835266yba.4 for ; Fri, 19 Mar 2021 15:30:12 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=QtxVhJavGwNFsOsZjxbm0IQIdIGCNUmbxX8wVUe2e3w=; b=WxkX7sfK5xv/T9YoOt7iVRw+i4Qx6vm/thJ09DJbKejoG88UTbJiB50pmb5M07ZO7n pNt46ickNc2D9OVefkzsdHOpdvmlC4r3rpcD65/3uLNSEZcGYGLh/npihEmkaYDe9hvY 58yBQFFRAl/R/kDuiJiNDJVEDkNnDNcp4xFWO3KmfDDdIPTa0BEjV30ZSZj2EomIhT2h SDDqKUvYQMVVTd5v7HPiTPi8WRFNM8tzRzVHTpjy4LLUQlxSdnzIqHnW0ed61N4RYFdX JxNK48IB/dtCACC7qxBdAkLa+2rrGP7oK+SgW4C6+drmMkk6tCad+1chxEsDWNfI+m/N 64yg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=QtxVhJavGwNFsOsZjxbm0IQIdIGCNUmbxX8wVUe2e3w=; b=pvQ8QzWwsKFm0yw+7zPAs7NclhlweNADl4jcgUUCYyZAxi+OxGH/GDen3zgRntyXVI C+ju6ov+lhxP7utcbLb6JMhh+n01MjoIvHyH3Dtt7rFgQTuF09TZgV/yBl1X4wEanIZR PbJ+0CByqtLD8v4dI58cOSf2jmwVjjiz8wc07z26XcQq95kS7CCOZNBOh+Iqcj6uWKw6 3ScHLtcuQZKkRs/5jZGc8Im1e4t/mP2b6EZh6fRfC8u6h2m6wVqH7XkGqg3rUMSoRYwg oi74Jhmm8HWzLPbRVO/Yk3JPoVmw98w6ZhNfV55pcfXuGcUSEJdCmYouqqTw4WcstlLa vDkA== X-Gm-Message-State: AOAM5322b/XeDHT/Z7/R6yjKlhv+QWUy5K97tkAjX2CxVVS2JyuAwQLi nehij5di5Z1Mo6IkA4RYA0NpyC4PItLrxq3LIAjtQLwmzI8= X-Google-Smtp-Source: ABdhPJyL95K+MNcz0gArZ6ab9ExPzKuUR9NIFBkYCp0dTfXQrPIb1V86ULblelIbY9iAnDovEMWsQcICpwkw030UnKI= X-Received: by 2002:a25:e4c4:: with SMTP id b187mr9891394ybh.92.1616193011354; Fri, 19 Mar 2021 15:30:11 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> In-Reply-To: <20210319213214.4f8ddf55@archlinux> From: Aryeh Friedman Date: Fri, 19 Mar 2021 18:30:00 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: Ralf Mardorf Cc: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2JVr3ysFz4VQd X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=WxkX7sfK; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b2c as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b2c:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b2c:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b2c:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 22:30:13 -0000 On Fri, Mar 19, 2021 at 4:32 PM Ralf Mardorf wrote: > On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: > >Void uses a runit init system with no systemd > > Hi, > > I suspect it's not a good idea to use Linux without systemd. For > example, by upstream udev is part of systemd. Maintaining Linux without > systemd is a bottomless pit. > > On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: > >Recompiling the kernel is *TRIVIAL* if you refuse to do it then you > >should not be using any Unix variant > > I dislike this tone of voice. However, I agree that compiling the kernel > might be less effort, than migrating to another operating system. If you > would e.g. migrate to Arch Linux, you need to get used to systemd. > Getting used to systemd isn't pleasant. If you chose a Linux distro > that doesn't use systemd, you likely will experience all kinds of > trouble, if you want to customize your install. > I used that tone because it really is simple and if you can't/won't recompile the kernel before throwing the baby out despite with the bath water then you really don't have the skills/desire needed to use Unix effectively... Just to show how trivial it really is 1. Edit /usr/src/sys/amd64/conf/GENERIC (or i386 instead of amd64 if your still using it) to comment out the xhci line (line 327 in 12.2-RELASE-pl3) to remove USB 3.0 support 2. cd /usr/src 3. make kernel 4. etcupdate 5. reboot Done.... how hard is that? -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Fri Mar 19 23:06:13 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0D8E65AFBEA for ; Fri, 19 Mar 2021 23:06:13 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2KJM6RSbz4XPS for ; Fri, 19 Mar 2021 23:06:11 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from fews2.riseup.net (fews2-pn.riseup.net [10.0.1.84]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F2KJK5p1YzDy18 for ; Fri, 19 Mar 2021 16:06:09 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616195169; bh=GNbW3WFupYosQWgyKWFqa3kr1piJozgtkmlC1GMnBMk=; h=Date:From:To:Subject:In-Reply-To:References:From; b=AJidht8u+Fw3BSoLSU4bqyM/8JaN7RDx9+NiMwySHIZyHlQqDPFa0GW1WaLeY56rL Is6CmUhnfLkldhTPulM7oksQoxcZwyOLQS56MtfqCXIZdQaBNxD6I7hhghp3HlCiue LUE9vQb7/Y8IZfMcGish7BiLCTsrUob2J2d7cNbk= X-Riseup-User-ID: C0D29D5F87E65C7778B4A3D5447703A7BE0DEFC66D1D50FE3104683A57B3DB6A Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews2.riseup.net (Postfix) with ESMTPSA id 4F2KJK4cVYz1yST for ; Fri, 19 Mar 2021 16:06:09 -0700 (PDT) MIME-Version: 1.0 Date: Fri, 19 Mar 2021 16:06:09 -0700 From: Weaver To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> Message-ID: <259fba3aa7665be79a056fb9f5bc1825@riseup.net> Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2KJM6RSbz4XPS X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=AJidht8u; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of weaver@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=weaver@riseup.net X-Spamd-Result: default: False [-5.07 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-0.97)[-0.969]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 23:06:13 -0000 On 20-03-2021 08:30, Aryeh Friedman wrote: > On Fri, Mar 19, 2021 at 4:32 PM Ralf Mardorf > wrote: >> I dislike this tone of voice. However, I agree that compiling the kernel >> might be less effort, than migrating to another operating system. If you >> would e.g. migrate to Arch Linux, you need to get used to systemd. >> Getting used to systemd isn't pleasant. If you chose a Linux distro >> that doesn't use systemd, you likely will experience all kinds of >> trouble, if you want to customize your install. >> > > I used that tone because it really is simple and if you can't/won't > recompile the kernel before throwing the baby out despite with the bath > water then you really don't have the skills/desire needed to use Unix > effectively... Just to show how trivial it really is > > 1. Edit /usr/src/sys/amd64/conf/GENERIC (or i386 instead of amd64 if your > still using it) to comment out the xhci line (line 327 in 12.2-RELASE-pl3) > to remove USB 3.0 support > 2. cd /usr/src > 3. make kernel > 4. etcupdate > 5. reboot > > Done.... how hard is that? Who said it was hard? I've been using Unix for over 20 years, and I wouldn't know how to recompile a kernel and, at present, anyway, have no desire to know. I use it for my business - technical writing and instructional design - and, literally have no time to dig beneath the surface. I've learnt one or two things along the way, and will probably learn more as time goes on, but the direction your knowledge takes is as variable as the individual and their needs and inclination. Ralf has it spot on. You're arrogant. Cheers! Harry -- `The World is not dangerous because of those who do harm but because of those who look on without doing anything'. -- Albert Einstein From owner-freebsd-questions@freebsd.org Fri Mar 19 23:06:14 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DE9FB5AFCC5 for ; Fri, 19 Mar 2021 23:06:14 +0000 (UTC) (envelope-from walterp@gmail.com) Received: from mail-pj1-x1030.google.com (mail-pj1-x1030.google.com [IPv6:2607:f8b0:4864:20::1030]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2KJQ0bSVz4Xfp for ; Fri, 19 Mar 2021 23:06:13 +0000 (UTC) (envelope-from walterp@gmail.com) Received: by mail-pj1-x1030.google.com with SMTP id cl21-20020a17090af695b02900c61ac0f0e9so9085522pjb.1 for ; Fri, 19 Mar 2021 16:06:13 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=W1cyjSP8EY+xp/d+Qxfkgf2Uuq0j+nt6TDzQkTFlDf0=; b=tl2fGI995i+EXJcIrn78EdqRmt9N1PoDOUOObBBLcB5JLRf7BswDO/oxv72FUY50We 2XG/7Sroy6+pM6Qcw/ARVj7Lbrdt4KG4nOk/m6hYi74LDl+E1ObSfOIwVjeBPIbNT7u0 +ZNoO4ne6X5QbCXlNlJ4RZ9Cjsygxp62ItFrYGgLvdvQnfuoYgxweyDbifA0lyZuY5CD vyGZFP79ttr6U4H1/siXqaxMldfGPJuOui4K68ax93zWfGzjbLbD83o7sHXT6D1lViK+ /YLLMvkyTrZ5STOLyG8eYrJTqWbm+t75iM9B+lqwK2SIzhuPP2csssGcvQP49HRjB1jb e3Yg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=W1cyjSP8EY+xp/d+Qxfkgf2Uuq0j+nt6TDzQkTFlDf0=; b=o99K2eMKDA5Rr82IqKtsEgqHX6CRfHL0e03XLedU7z5jwUERUEc/JfGg63HhjdM208 JM7iA8Gy+y3pqs9UXIjIwjzpFfeYq7PkSzrROI1Np+oAKhxkSz3pfiUp0C/33x/HUxD2 MYHZmYafQkoLsf1z0O3RBDo5TCZz7cF0VdxIyGa8sKSIbkA7yFRqdQc1aBxDpMT2vcf3 3XclOtpaCrwEUtarWP0vN4a+2BtFwoeBK6VItRowaXgmmwj9Mxr/4CAoIeo4rZqq09ys hJ4LVhDt1rAHQvMtfpqsBIYplEZJ0d30+4X+kkR/x3FSh3TojsxMQLiThYhLBzgcm90z Zt1w== X-Gm-Message-State: AOAM530qeTh41/SU9Xt27UgN+Gpsxuy3uNNXaUZhAq5jrveF0WHAyhDM 5k5yEycIXrewStDcocu6Zr8gN348DjLlk17xGRkiyhvsc78= X-Google-Smtp-Source: ABdhPJyXTcCu/E/ohmrd47qZzLB1Y30yOu3Jo1bViDZf2UbD0Phy4JFuwHTzgSwqs0ckJ2eYdgtBETjfyUiizJVOGSU= X-Received: by 2002:a17:902:b182:b029:e6:5e:f2ce with SMTP id s2-20020a170902b182b02900e6005ef2cemr16537286plr.50.1616195172223; Fri, 19 Mar 2021 16:06:12 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Walter Parker Date: Fri, 19 Mar 2021 16:06:01 -0700 Message-ID: Subject: Re: freebsd-questions Digest, Vol 875, Issue 7 To: freebsd-questions@freebsd.org Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4F2KJQ0bSVz4Xfp X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=tl2fGI99; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of walterp@gmail.com designates 2607:f8b0:4864:20::1030 as permitted sender) smtp.mailfrom=walterp@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::1030:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::1030:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::1030:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 23:06:15 -0000 >On Fri, 19 Mar 2021 12:52:30 -0400 >Robert Huff wrote: >> >> Duke Normandin writes: >> >> > Other than being GUI-based, is there any distinct advantage to >> > using GPT? >> >> Um ... I have used GPT for about 10 years. >> Never have I used it with a GUI. >| was refering to for example: >gparted-common/buster,now 1.2.0-1.0antix1 all [installed,automatic] > GNOME partition editor -- common data >Isn't GPT and acronym for gparted? Not GPT is not an acronym of gparted. It is for GUID Partition Table. Seee https://en.wikipedia.org/wiki/GUID_Partition_Table In has been in FreeBSD since version 7 It also works with MacOS (x86 and Apple Silicon), Linux, NetBSD< OpenBSD, Solaris, HP-UX, and Windows x86 (2003 SP1,and Windows Vista or new) Windows x64 (2003 or newer). It has basically replaced MBR on most systems made in the past 10-15 years. In FreeBSD, the CLI command is gpart. It solves the 2TB problem that MBR has. It allows for more than 4 primary partitions (logical partitions are a hack best left to the MS-DOS days). I have multiple systems that are 10 years old,. use BIOS to boot and use GPT partitions. In my experience, lots of older systems support booting using GPT & BIOS. There appear to a few laptops that don't (based on comments in last several years). If you need to read data from a GPT based system, all you need is another system that supports GPT (such as FreeBSD 7 or newer) and a second drive bay. I know people that still use MBR, but those fall into two groups: Embedded systems and people that have not updated tools chains in 10-15 years. As far as EFI/UEFI systems go, most of those use GPT. Some may support MBR and others may not. Gparted is a GUI based Disk partition editor that supports editing GPT type partitions. Walter -- The greatest dangers to liberty lurk in insidious encroachment by men of zeal, well-meaning but without understanding. -- Justice Louis D. Brandeis From owner-freebsd-questions@freebsd.org Fri Mar 19 23:41:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id C914B5B0803 for ; Fri, 19 Mar 2021 23:41:23 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb2d.google.com (mail-yb1-xb2d.google.com [IPv6:2607:f8b0:4864:20::b2d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2L4y0YWmz4ZL9 for ; Fri, 19 Mar 2021 23:41:21 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb2d.google.com with SMTP id b10so7981909ybn.3 for ; Fri, 19 Mar 2021 16:41:21 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=UP3FuW8BZoHFFjcTKjmLhT6kUQeEAYmdlZ7HfBKtrb8=; b=t0gn0YrW7tXMzfz87yEqHqFM8ftrAdW10K78qYxatJ6V7RCJB3NfVgj6jqX2RRaTge Y8L2ihSgbVj4WyI6zbeyxWHIcmBoFAT4mwAMImzr4s0VmZKRgQ6lftVRqRwssIRo5gxF KDW/PX03ZHxyjr4CrkzrfoeSIZboqSH1kLHiVD9sGX0/jIdY3sxuPHmIGwGCf2Dvy6ci wytRo1mCalaCHHAHSg1eXHoBzNyf2UtEp2p60LJfyykaXoaRQiiTLAvYwOyEQJvQSEjw bG8ThSRcnseN/b67hXFTWfTK/w9KAJk3aAB0l4TFnokK+7OU4C/XeHgsLuATKlz6Uvs2 DUuA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=UP3FuW8BZoHFFjcTKjmLhT6kUQeEAYmdlZ7HfBKtrb8=; b=W1PbPQabXHt+oQslhBbtMky4D5EjX3DpJR5+cHYCufIwOQJdkzNPtyZ+gN+z2QoWKF iYLBXfRv1jJKhPAHXpNfL/hhDz3Z1yiDviT2GR+TRLQ/a16bslJ/aTUYFkKE9svzoDKo cLRypX3BbHp7SdByS8GPZFNGuEnvG7mvRYEDAjwon0xrPcRFlvj7Vd4DMUXxp82GNInK nfGz6In9dJFOpnJ5Kw+2ABAnRZymdMPkBviqQqLiCmjGQnniHFXZwURNnu5ons7Xec8z 1+IvR6PpRkEXtRCykUsf3Kpjcrg4Fb308YRX0sSsDPQPs+imwzoFFDMCGX1o5dBeV9WP wkCw== X-Gm-Message-State: AOAM531A+p1EYeMiHWXTK4bRAR8bnHJXG/BU6I3hxlEL//ahDrr8/iCL ulnkRzC/crc0IUnU7gDMk0PN8dLVT5dsaCraxPS0VIMkeVM= X-Google-Smtp-Source: ABdhPJwrlIAoEMrf/xwy9PHK4ihR1jidzF759IKnJgAOOKUcPdxCYxKm3rNC5XYTKiwI+e9bhdMVeQVy0vMSZWHVMqQ= X-Received: by 2002:a25:e4c4:: with SMTP id b187mr10192675ybh.92.1616197280467; Fri, 19 Mar 2021 16:41:20 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> In-Reply-To: <259fba3aa7665be79a056fb9f5bc1825@riseup.net> From: Aryeh Friedman Date: Fri, 19 Mar 2021 19:41:09 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: Weaver Cc: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2L4y0YWmz4ZL9 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=t0gn0YrW; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b2d as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b2d:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b2d:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b2d:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 23:41:23 -0000 On Fri, Mar 19, 2021 at 7:06 PM Weaver wrote: > > I've been using Unix for over 20 years, and I wouldn't know how to > recompile a kernel and, at present, anyway, have no desire to know. > I use it for my business - technical writing and instructional design - > and, literally have no time to dig beneath the surface. > I've learnt one or two things along the way, and will probably learn > more as time goes on, but the direction your knowledge takes is as > variable as the individual and their needs and inclination. > Ralf has it spot on. > You're arrogant. > Unix was not designed for end users, it was designed by technical people for other technical people doing technical work (development and other infrastructure related tasks). If you want to do word processing or other tasks then use an OS designed for it like Windows or Apple's GUI on-top of MacOSX. If you can't handle the command line (and anyone that can do basic command line stuff can also recompile a kernel with very little research) then you shouldn't us Unix directly (for the purposes of this discussion the GUI on-top of MacOSX is not Unix per se -- disclaimer I am not denigrating MacOSX in anyway since have been a Apple shareholder since 1982) because none of the open source GUI's are good enough to completely avoid the command line even for some basic tasks like global search are replace through a series of text documents. So if you call using an OS the way it was designed to be used arrogant then go ahead call me that. But if you mean something else then your off base because I am only describing how the OS was designed to be used. Also note I do use GUI's on FreeBSD (my primary desktop machine is 12.2-Release-pl3 with Xfce4 on it and I use it for all my work and other uses [except some games]... but I am in the target audience of what Unix was originally designed for -- back end/infrastructure software development) -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 00:04:00 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DF7BA5B13F5 for ; Sat, 20 Mar 2021 00:04:00 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Lb371Wnz4bhr for ; Sat, 20 Mar 2021 00:03:59 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from fews1.riseup.net (fews1-pn.riseup.net [10.0.1.83]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F2Lb22kJzzDsb4 for ; Fri, 19 Mar 2021 17:03:58 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616198638; bh=2GK3rnsHmKGr++vjGyHjErK4239a3oaZDCHEm3YJauo=; h=Date:From:To:Subject:In-Reply-To:References:From; b=WVoTqrS53JafLEyyNkCZdjS6UWT3ZsK7v4jg3rLBqvLmcQhn0nAFKm1fy/d/0K+cj 4Iuw3/eTJ1L6IaMYgxscxExiE4/+gs7Oba2kfAAV8iLvYFFGkifT5EhQvX9tcFuRii MLCfyHzUt1eUpARShGEIi0FecuroTVzExNHy6a2I= X-Riseup-User-ID: C544D293C814398A6A587F631CCA37DAEB45C72893D2F1A4804476DB61A21D5F Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews1.riseup.net (Postfix) with ESMTPSA id 4F2Lb21jxhz5wGf for ; Fri, 19 Mar 2021 17:03:58 -0700 (PDT) MIME-Version: 1.0 Date: Fri, 19 Mar 2021 17:03:58 -0700 From: Weaver To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> Message-ID: Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2Lb371Wnz4bhr X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=WVoTqrS5; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of weaver@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=weaver@riseup.net X-Spamd-Result: default: False [-5.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 00:04:00 -0000 On 20-03-2021 09:41, Aryeh Friedman wrote: > On Fri, Mar 19, 2021 at 7:06 PM Weaver wrote: > >> >> I've been using Unix for over 20 years, and I wouldn't know how to >> recompile a kernel and, at present, anyway, have no desire to know. >> I use it for my business - technical writing and instructional design - >> and, literally have no time to dig beneath the surface. >> I've learnt one or two things along the way, and will probably learn >> more as time goes on, but the direction your knowledge takes is as >> variable as the individual and their needs and inclination. >> Ralf has it spot on. >> You're arrogant. >> On 20-03-2021 09:41, Aryeh Friedman wrote: On Fri, Mar 19, 2021 at 7:06 PM Weaver wrote:Show For what purpose? If you want to do word processing or other tasks then use an OS designed for it like Windows or Apple's GUI on-top of MacOSX. Then, in your opinion, why are these applications included in the package? If you can't handle the command lineShow What a load of rubbish! So if you call using an OS the way it was designed to be used arrogant then go ahead call me that. Unix has gone way past standard C programming between a couple of terminals, a la the initial days of Dennis Ritchie. I'm sure, if he was still with us he would agree with that. Perhaps you need to become familiar with the term `evolution'. You're quite entitled to restrict yourself to the command-line only environment. You have no right to dictate standards for others, especially when you are happy to make a profit from exactly that. But if you mean something else then your off base because I am only describing how the OS was designed to be used. Originally. Also note I do use GUI's on FreeBSD (my primary desktop machine is 12.2-Release-pl3 with Xfce4 on it and I use it for all my work and other uses [except some games]... Well, that's not exactly kosher, is it? but I am in the target audience of what Unix was originally designed for -- back end/infrastructure software development) Then get rid of the GUI and dwell in your personal definition of heaven, and leave the rest of us hell-dwellers alone. Some things I deal with on the commandline. Some applications are designed specifically for that, but note, they are still applications! Some I deal with through the minimal NCurses interface. But, I believe in an open world and do not feel qualified to dictate standards to others. But I'll jump on that level of arrogance and ignorance, every time. Cheers! Harry. -- `The World is not dangerous because of those who do harm but because of those who look on without doing anything'. -- Albert Einstein From owner-freebsd-questions@freebsd.org Sat Mar 20 00:14:38 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 32B2D5B1A5B for ; Sat, 20 Mar 2021 00:14:38 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pj1-x102f.google.com (mail-pj1-x102f.google.com [IPv6:2607:f8b0:4864:20::102f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2LqK14WCz4cF9 for ; Sat, 20 Mar 2021 00:14:36 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pj1-x102f.google.com with SMTP id mz6-20020a17090b3786b02900c16cb41d63so5627987pjb.2 for ; Fri, 19 Mar 2021 17:14:36 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:in-reply-to:references:mime-version :content-transfer-encoding; bh=yteQHp44o4poe7PjqEmJeXE/St/nF2bHKAOCLZBHHcg=; b=E9x5qJe0W7rNAFZkjYPtVkbAhu2o42iN6WsKPmvOnCrOjj04aWvqUH8zbKhxzv/NGY +QpE7R4Ih+CYhuH1oR7gDFLB1ALCxxnDw18iEC5jKOA5umE9wV+WvsLlDkXNqwjvgrEI M/webH79Xce+GNJgQ/QeOD/guiUp+YW0s2zi+O9AoAC2MommTCA7OlgFJH8D6iLSq+aJ Sptkz93XP3Ju6bGDaAtu/0d4e+8p9jyBW+nVDgnO67YvivNWCyW+T/HaDF6r98Bt0X5E e/3R0J0ca4uXh90qkeOK43vVnVCJ7tYhhS44uO1gbBL0BhABvecX3gKlo3TwRqCho0yv 7h8A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=yteQHp44o4poe7PjqEmJeXE/St/nF2bHKAOCLZBHHcg=; b=pq1Bow8mzHPrZP+I6Qvd5RJbfuo7CKpdpm0AeBN/jhJu02YarARnaNDD8zFpagcbpc dLjqLtuvm9o51juzjC7wMAKkO8Ow4gXvl4XFmluafIU9zUyMjMmngJOZHGsGzOy6zMzL 28L2FVCvVw9v5igJjmIONBNv8Xu2vO93dIho3hVHdBp0tLa7u0lF+Q8NfqFwhkFkBmL5 x8fELIpnspUPY5vKoOUMVyZdyfLdbFcMOgdbSyhQJBxm/imMapiBbNByr83pCqx9hLsF LLV2mlXJahigOavQBHHxt5eaICQN/ARapBTPUgdbVpQAqD0LNaHWM3HMy2GVmLGO4zs0 x07Q== X-Gm-Message-State: AOAM530f9OWYJcv8YItbrujmOP80cK6kCTEmtOn17+LvVHQR+hxw4qEb Fs4E05TiEFXiTDOLjaSBo2jkjj+cN+5gr6Qo X-Google-Smtp-Source: ABdhPJw9A0EAZ6OI25R4hlkhCkPx8Vg9exhMPQ4KQ+GG5FcjeqYGcW55Pj7QTcRE3BcDIG05JvBcIQ== X-Received: by 2002:a17:90a:c201:: with SMTP id e1mr1054720pjt.30.1616199275329; Fri, 19 Mar 2021 17:14:35 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id u12sm6372462pfn.123.2021.03.19.17.14.34 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 17:14:34 -0700 (PDT) Date: Fri, 19 Mar 2021 18:14:33 -0600 From: Duke Normandin To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210319181433.40e4ddca018f8578bcfe57a5@gmail.com> In-Reply-To: References: <20210319102649.2bace327e17eca8602877618@gmail.com> <24660.54990.961632.559429@jerusalem.litteratus.org> <20210319134723.f57186844e27c9a099cf8606@gmail.com> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2LqK14WCz4cF9 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=E9x5qJe0; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::102f as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-3.50 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; MV_CASE(0.50)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::102f:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::102f:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::102f:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 00:14:38 -0000 On Fri, 19 Mar 2021 13:55:54 -0700 Weaver wrote: > On 20-03-2021 05:47, Duke Normandin wrote: > > On Fri, 19 Mar 2021 12:52:30 -0400 > > Robert Huff wrote: > > > >> > >> Duke Normandin writes: > >> > >> > Other than being GUI-based, is there any distinct advantage to > >> > using GPT? > >> > >> Um ... I have used GPT for about 10 years. > >> Never have I used it with a GUI. > > > > I was refering to for example: > > > > gparted-common/buster,now 1.2.0-1.0antix1 all [installed,automatic] > > GNOME partition editor -- common data > > > > Isn't GPT and acronym for gparted? > > Nope! > > https://www.easeus.com/partition-master/mbr-vs-gpt.html Very helpful article. Thx! -- Duke From owner-freebsd-questions@freebsd.org Sat Mar 20 00:33:26 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 09F5B5B2C7E for ; Sat, 20 Mar 2021 00:33:26 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb30.google.com (mail-yb1-xb30.google.com [IPv6:2607:f8b0:4864:20::b30]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2MF11FdYz4dy5 for ; Sat, 20 Mar 2021 00:33:24 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb30.google.com with SMTP id m3so62909ybt.0 for ; Fri, 19 Mar 2021 17:33:24 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=EH15/dVj0pptj+dmqsDzZK2rZI4SMOzs7yjRM673ykY=; b=c+zJHmJlR2dBhZdTkHDuetJatMQNAfwbAkp455aDNU3xUm/W5W1amSOUZiJ4isjR4w WnUx/uXZggKPKlPU2ZHyNgZYUQwkS96tpMD+e5dR35N5x+EQEdtR8eTmseKFDKvaP890 1hIoSOVruszrWZwqNdxxkWybXRjjghGxcXWYAecun4Jxt13PRSJQWJ6xFSKH/bUmvBKg iqbmJtNIB+v2SUWVI+KaIXsAFW3ysFwN+ZS+X2VxlLh/oTXrZL2S8E/0tDvz3kthmdt7 Dl5JWaQGSJSZipAJr8q6YR3RetggSXa17odn2iaVzy+SutS1CJOx4wkMGfYM9EJxO0UL sasQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=EH15/dVj0pptj+dmqsDzZK2rZI4SMOzs7yjRM673ykY=; b=rZM8+sI58zslDcSDZGXkmd06mo53hee2iTtXoFXIM/vDXFBNXUZ+LhCzDgeMRqYNXP guHzJT8i/ZD/kYx/cB+Sj4i0wmS//lJv9UabvpOKnC78wFuZo2fhx0JFY+U/BnH13BgP O6irhzVMWjrmWfkS8kFe/XTRMZ8+tXJ4eUV7RleOmWWLYKh7ExIPu4Ce/0zOoHaClF6o d7tqK6hoAHjma2YPtjvL4D2zMQPw95g4Q6uwwkkT5GwoQAwRa7zZWIzyaFS2i0HWaQed 96TAbxfIupJS/L3cXDf5r7FTItTDkyNGYv8eHrrZ7sPaxaMLroj6eVT5d77f0SJCI86B rnHQ== X-Gm-Message-State: AOAM530f2liu4J7xMKJk5FptTIBnICqxhxFqfXeDDVIUcBqdvo4fhUmA xk02BeohgeX4wIdTu1m5ZBjYE0OEsBEDlzfW088= X-Google-Smtp-Source: ABdhPJybMdFyCK2CgxdO8qDG2SoexNfw8iB6C1AHlky06waVR4KXc3hLmI8JzgmmCsENfY4wVJztxKJkAZ+1Kj2AR1I= X-Received: by 2002:a25:e4c4:: with SMTP id b187mr10402188ybh.92.1616200403950; Fri, 19 Mar 2021 17:33:23 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> In-Reply-To: From: Aryeh Friedman Date: Fri, 19 Mar 2021 20:33:12 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: Weaver Cc: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2MF11FdYz4dy5 X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=c+zJHmJl; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b30 as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b30:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b30:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b30:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 00:33:26 -0000 On Fri, Mar 19, 2021 at 8:04 PM Weaver wrote: > On 20-03-2021 09:41, Aryeh Friedman wrote: > > On Fri, Mar 19, 2021 at 7:06 PM Weaver wrote: > > > >> > >> I've been using Unix for over 20 years, and I wouldn't know how to > >> recompile a kernel and, at present, anyway, have no desire to know. > >> I use it for my business - technical writing and instructional design - > >> and, literally have no time to dig beneath the surface. > >> I've learnt one or two things along the way, and will probably learn > >> more as time goes on, but the direction your knowledge takes is as > >> variable as the individual and their needs and inclination. > >> Ralf has it spot on. > >> You're arrogant. > >> > On 20-03-2021 09:41, Aryeh Friedman wrote: > > On Fri, Mar 19, 2021 at 7:06 PM Weaver > wrote:Show > > > For what purpose? > If you're asking what I (primarily) use FreeBSD for: a) Developing web app front ends to medical IoT devices and the related record keeping, b) Developing a FreeBSD/bhyve centric IaaS framework with a web frontend, c) personal use (web, on-line games, watching TV/Movies), d) the paperwork associated with being a freelance software developer (yes word processing/spreadsheets/etc. but note this is not my primary use of the OS and if it was my only use I would not be using Unix except for the next item) and e) I grew up using the command line and Unix is the only OS family that can still be used completely from the command line > If you want to do word > processing or other tasks then use an OS designed for it like > Windows > or Apple's GUI on-top of MacOSX. > > > Then, in your opinion, why are these applications included in the > package? > There are some very good pieces of software in the ports collection and there are some awful ones, most are somewhere in between and all the open source fall into that middle category: very helpful if you know what you are doing already with the OS but a real burden if you don't > If you can't handle the command lineShow > > > What a load of rubbish! > Ok then explain using a GUI alone (*ANY* GUI on *ANY* OS) do the following given a directory of 100 related text files (say chapter sections of a book you are writing) to find and replace every occurrence of "foo" with "ack bar" without having to open 100 different files and repeating the same menu item and form fill in on each one. With the command line it is trivial though (I will assume tcsh here): foreach i (*) sed 's/foo/ack bar/g' $i>foo mv foo $i end Wow in 30 seconds I just did something that would have taken at least an hour without the command line. > So if you call using an OS the way it was designed to be used > arrogant > then go ahead call me that. > > > Unix has gone way past standard C programming between a couple of > terminals, a la the initial days of Dennis Ritchie. > I'm sure, if he was still with us he would agree with that. > Perhaps you need to become familiar with the term `evolution'. > I am quite familiar with the term and throughout my career have been responsible for helping to create a number of the so called evolutions you say I should be aware of. You're quite entitled to restrict yourself to the command-line only > environment. > I am not sure if I am the one that should be called arrogant because you just showed the height of it by assuming anyone who says it is useful uses it exclusively. About 90% of the tasks I do are not command line but the 10% that are command line really can't easily be done any other way. BTW that is not 90% of my time (which is spent writing code for the above webapps) and except for looking at the tip of the iceberg in a browser all other aspects of the work is 10 times easier with a command line then with a GUI (even with IDE's). > You have no right to dictate standards for others, especially when you > are happy to make a profit from exactly that. > I am not dictating anything I am just saying that the OS was not designed for office use and despite the wishes of a lot of people (including me -- I use libreoffice on FreeBSD for almost everything that most people would use M$ Office) almost certainly will never be well suited to standard office computing tasks being performed by non-technical people. > But if you mean something else then your > off base because I am only describing how the OS was designed to be > used. > > > Originally. > > Also note I do use GUI's on FreeBSD (my primary desktop > machine is 12.2-Release-pl3 with Xfce4 on it and I use it for all my > work and other uses [except some games]... > > > Well, that's not exactly kosher, is it? > > but I am in the target > audience of what Unix was originally designed for -- back > end/infrastructure software development) > > > Then get rid of the GUI and dwell in your personal definition of heaven, > and leave the rest of us hell-dwellers alone. > Due to the nature of my work I need the GUI but I also know it is not a substitute for knowing the command line also. But I'll jump on that level of arrogance and ignorance, every time. > For someone who claims to be a fighter of arrogance you sure make a lot of assumptions about people that are just not right (that is almost the definition of arrogance). -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 00:53:51 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id BF94B5B3653 for ; Sat, 20 Mar 2021 00:53:51 +0000 (UTC) (envelope-from 4250.82.1d4ce0003911bf1.044f7afd5e66303d7391e6fd80981777@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2MhZ6hFCz4g5c for ; Sat, 20 Mar 2021 00:53:50 +0000 (UTC) (envelope-from 4250.82.1d4ce0003911bf1.044f7afd5e66303d7391e6fd80981777@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616201631; x=1618793631; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=QZ+mQRLN3CAkVS3YewEholHOEZ7m4Zt2Q01qAtxcDnw=; b=qHLGkHNQDmS9SXUxLt9Gxd+2KZ0aBZEQGiTL+5x8ultDDIcb2hKDiUcnrVP/nc/xwehxbPtoUYT+wkfGOTgjcWhpsl73VS6bThVfYk8TRl/VisNTVyT3O50LH8/ZnuwEW7zdIc9LNfFSUC3kl3flV3qiMC+ojYQ3tf3SIHod/+w= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDM5MTFiZjEuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.us-east-2.aws.in.socketlabs.com (r3.us-east-2.aws.in.socketlabs.com [142.0.189.3]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Fri, 19 Mar 2021 20:53:43 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Fri, 19 Mar 2021 20:53:43 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lNPs5-000M8m-MG for freebsd-questions@freebsd.org; Sat, 20 Mar 2021 00:53:41 +0000 Date: Sat, 20 Mar 2021 00:53:41 +0000 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-Id: <20210320005341.19ae7728abc9ebf1eb48b895@sohara.org> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2MhZ6hFCz4g5c X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=qHLGkHNQ; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce0003911bf1.044f7afd5e66303d7391e6fd80981777@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce0003911bf1.044f7afd5e66303d7391e6fd80981777@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; MV_CASE(0.50)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[sohara.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; DKIM_TRACE(0.00)[email-od.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce0003911bf1.044f7afd5e66303d7391e6fd80981777@email-od.com]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce0003911bf1.044f7afd5e66303d7391e6fd80981777@email-od.com]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 00:53:51 -0000 On Fri, 19 Mar 2021 19:41:09 -0400 Aryeh Friedman wrote: > Unix was not designed for end users, it was designed by technical people > for other technical people doing technical work (development and other > infrastructure related tasks). The first major role for Unix was a document preparation system at AT&T which is the reason for troff, eqn et al which are what remains of "Documenter's Workbench". So you are incorrect, unix was originally designed for end users - it's just that end users have become less sophisticated over the decades. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Sat Mar 20 01:00:52 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 26A7F5B37FC for ; Sat, 20 Mar 2021 01:00:52 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-ej1-x62e.google.com (mail-ej1-x62e.google.com [IPv6:2a00:1450:4864:20::62e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Mrf61FWz4gpB for ; Sat, 20 Mar 2021 01:00:50 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-ej1-x62e.google.com with SMTP id hq27so12432163ejc.9 for ; Fri, 19 Mar 2021 18:00:50 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=ItrzfcqtyjjLE2ArQ2otm6f5WIWqjFgmPd2YZRNR/u0=; b=AiZLz6UTsNuwI22j7ZWn34o0uLYrLmbmNlTLgcOsL3Nc01iFv7u319udWlZ5eaQ/EQ HKQb61pOM5Jfuai9053YxEk9ljOmzhT2bxvz8YjdBWO7hANpSPcY2vheskpimWCFjHLf clGgzBZb0RwnHl7yec58ksyi3p+151kV5wBZGt1plXUHzkKO2KNVNo70zc8AGqbzDifZ z0G96MlOlXchmqbted73WcDjrFuwtHHhF6TwNnwUooD+F1FGWpmXXMyuPxVmeKBsex/3 yTHaU2KK1SqudEZF4pjXjF3l/PUKT80c5yDzEjTymk8ewUlVGpwKDbO3XzK7eTHXCZ89 VjxA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=ItrzfcqtyjjLE2ArQ2otm6f5WIWqjFgmPd2YZRNR/u0=; b=p9UNByQluRjkXG2eYx/pTw2cUm+5A0Hk3iDq9n4h6fErk5i3HczbXJeHYFWeAkzgkJ /4aa5iB/GK/EWJIR8q2PR4nJHyAxmaFV021tLEaehFvy1Qql4nk4UxOGtVdpD/OOTZff UEcQ03mwi0XVTZ2PxUhSmqq3I/Jdn0Op1GUQNcnyApf35CSTzY6coq+JpvcWBpKvIuFo P2QqAjPp9uMMmIPPoE68Dfkq9nOydUT+q0n/F8+naQQ8Vzh/tR87fIhDNZp/yGBLVuAN 4bm6VEJIpp8X1kynNNRNAxz1hGZDkikveZJzkRBO1j1ht5PJFkAXDz+Dl3GfYv7bfohP BF0w== X-Gm-Message-State: AOAM531F4DKb23eNIoMu3U7vjerJcpxdY19tTWThrR5NAdmGMhvrIPSZ 1szwPLT/vSByb3TjXKdnsx0a57ONXzzE7w== X-Google-Smtp-Source: ABdhPJyu1Q/nKg99Ev6DB+xCquJS78hfhGd8KKd27qjF67LWs7J/x5khGPdbl/VDdc//3VMs7ad3/w== X-Received: by 2002:a17:906:b884:: with SMTP id hb4mr7210160ejb.536.1616202049024; Fri, 19 Mar 2021 18:00:49 -0700 (PDT) Received: from [192.168.1.13] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id h17sm5029110eds.26.2021.03.19.18.00.48 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Fri, 19 Mar 2021 18:00:48 -0700 (PDT) Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> From: Graham Perrin Message-ID: <0d46b27f-dcdb-41cf-8780-5636d39c07ef@gmail.com> Date: Sat, 20 Mar 2021 01:00:47 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-GB X-Rspamd-Queue-Id: 4F2Mrf61FWz4gpB X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=AiZLz6UT; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::62e as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::62e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::62e:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::62e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 01:00:52 -0000 On 19/03/2021 23:41, Aryeh Friedman wrote: > Unix was not designed for end users, – is not an excuse to marginalise or denigrate end users. From owner-freebsd-questions@freebsd.org Sat Mar 20 02:22:57 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1A6BE5B6CA5 for ; Sat, 20 Mar 2021 02:22:57 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: from mail-pg1-x536.google.com (mail-pg1-x536.google.com [IPv6:2607:f8b0:4864:20::536]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2PgN2Wchz4n2Y for ; Sat, 20 Mar 2021 02:22:56 +0000 (UTC) (envelope-from sidney.reilley.ii@gmail.com) Received: by mail-pg1-x536.google.com with SMTP id e33so4893872pgm.13 for ; Fri, 19 Mar 2021 19:22:56 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=date:from:to:subject:message-id:in-reply-to:references:mime-version :content-transfer-encoding; bh=s7W95aiK5C3nvOOOu4sAIAy5Pb6eFENV+KCFwjAKLFg=; b=bAD8yCheUOZ4msWSBNtY4vYGe0N2hP+moyQfPxn/8Iv1ZFnaCvofjoVS6Hvz3kmY1b A9VP7/1ZEijA+MQIk8pRndIgpwyKpCZoGDUJ902bGN4Tgt+RNwUfROV798tmQjJd2Nq+ jGsW/9afJP6WTiOvasORXVpNKB+VVbqnbVK2gotxKgL4CPpufvTmF3f1xSAg7dkkprju Cru922QhWjiGAW0AP8TW4kDL61uic9T3fgj2oY0whnxyaizrzybk08QPgsRR40Mf6lJn c79kuxhojFVSKPG3TsGz7/RkvvheaZ24IkrrDP51O+jrLU+TRu5A6SQYeEfTgecuLu/z xSzA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:mime-version:content-transfer-encoding; bh=s7W95aiK5C3nvOOOu4sAIAy5Pb6eFENV+KCFwjAKLFg=; b=ThIh8/A4IqiVyxNND4i+jlGz/BWujnYF4mmOZP06WEpziqhFAazQ2m8TRuSiiUxKzV K+LxTQTWNfbk2+3B7Qp3pJFcXDtxMGq9eAIQshcX9TRxxEUVrtkFk6N7bECaRFRaVQ+x wuIxlE9IqwM2xTnUIwhkMwdAs9IBAjjcfvBJppBgvodaGn8ZVPkP07Zo8d8xW+QoKdB9 tKNn+ldV8vySfomRmruWEmBU4WVuAPXKGG0AvBtqmsxAl05oFpojABxg6lNjEmMeGOsC gTS5vZC4W9yhg7/PcvZ0I0iJL3WAJFOSOxbJ/yz4eSBYLysHBsKsrsOanyfy5IBD96pq cObw== X-Gm-Message-State: AOAM533U+oV2MbnAYRjnYNMHw/evsSiy2EMvTV0KqbRoqkEcYtHpVXRS 9wZlZEmtPDGE4y6qjoB6kygn09ajZbAPk1A3 X-Google-Smtp-Source: ABdhPJzveBhsCIwkVi0mjE50byTysKQveW46P7skYnZwkAy6lhn/Ls4EBnuBOFf5lKBKO8SpIoBdrw== X-Received: by 2002:aa7:92c7:0:b029:1ee:75b2:2dab with SMTP id k7-20020aa792c70000b02901ee75b22dabmr12050303pfa.61.1616206974852; Fri, 19 Mar 2021 19:22:54 -0700 (PDT) Received: from antix1 (node-1w7jr9ydqpxqblsm62c2zjhms.ipv6.telus.net. [2001:56a:7862:e400:16da:e9ff:fe13:6b04]) by smtp.gmail.com with ESMTPSA id 138sm6686267pfv.192.2021.03.19.19.22.54 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 19 Mar 2021 19:22:54 -0700 (PDT) Date: Fri, 19 Mar 2021 20:22:53 -0600 From: Duke Normandin To: freebsd-questions@freebsd.org Subject: Re: Partitioning 1T HDD Message-Id: <20210319202253.3b7271ed8e53a2500ce36988@gmail.com> In-Reply-To: References: X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.32; i686-pc-linux-gnu) Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2PgN2Wchz4n2Y X-Spamd-Bar: - Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=bAD8yChe; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of sidneyreilleyii@gmail.com designates 2607:f8b0:4864:20::536 as permitted sender) smtp.mailfrom=sidneyreilleyii@gmail.com X-Spamd-Result: default: False [-1.52 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; MV_CASE(0.50)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MID_RHS_MATCH_FROM(0.00)[]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::536:from]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::536:from:127.0.2.255]; NEURAL_SPAM_SHORT(0.98)[0.983]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::536:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 02:22:57 -0000 On Fri, 19 Mar 2021 16:06:01 -0700 Walter Parker wrote: [snip] > >Isn't GPT and acronym for gparted? > > Not GPT is not an acronym of gparted. It is for GUID Partition Table. > Seee https://en.wikipedia.org/wiki/GUID_Partition_Table Got it! Much obliged for the clarification. [snip] -- Duke From owner-freebsd-questions@freebsd.org Sat Mar 20 03:13:19 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1DB64570073 for ; Sat, 20 Mar 2021 03:13:19 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2QnV1crWz4r5x for ; Sat, 20 Mar 2021 03:13:17 +0000 (UTC) (envelope-from weaver@riseup.net) Received: from fews2.riseup.net (fews2-pn.riseup.net [10.0.1.84]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "*.riseup.net", Issuer "Sectigo RSA Domain Validation Secure Server CA" (not verified)) by mx1.riseup.net (Postfix) with ESMTPS id 4F2QnS11sRzDxyJ for ; Fri, 19 Mar 2021 20:13:16 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1616209996; bh=H3ac6wMCxbSoAibr+BVtUwwkN/emFC/a3XDxO7RI16A=; h=Date:From:To:Subject:In-Reply-To:References:From; b=dinFf7oFVKIpCR+3L1dScoxnwRqFIaHASfxr2F3gbQQUYRZnTAKdYNFk1634Cx0O8 SHyEYO833IaefQDAROUkGOhKpPhJXwL6U3hXZ9kFn1qO3QQ/QIH45UlKcfPp8Hx6Cn ltJaShIi3K7AZ3QwFQxDuXfLEjiGiuqYdObGbqwA= X-Riseup-User-ID: 4E839760A1DF3AB10F98C5D7DAE9617E82199264C289E6DF340CB3A2E64830C7 Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews2.riseup.net (Postfix) with ESMTPSA id 4F2QnR6Thsz1xmR for ; Fri, 19 Mar 2021 20:13:15 -0700 (PDT) MIME-Version: 1.0 Date: Fri, 19 Mar 2021 20:13:15 -0700 From: Weaver To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> <06d8d9ae876bbdaf11fe7691fd2d4fad@riseup.net> Message-ID: <445edf2bbcb1e7e24071b89ce830927f@riseup.net> Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2QnV1crWz4r5x X-Spamd-Bar: ----- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=dinFf7oF; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of weaver@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=weaver@riseup.net X-Spamd-Result: default: False [-5.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; RWL_MAILSPIKE_GOOD(0.00)[198.252.153.129:from]; R_SPF_ALLOW(-0.20)[+mx]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[riseup.net:+]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[198.252.153.129:from]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[198.252.153.129:from:127.0.2.255]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 03:13:19 -0000 On 20-03-2021 12:31, Aryeh Friedman wrote: > On Fri, Mar 19, 2021 at 10:06 PM Weaver wrote: > >> On 20-03-2021 11:20, Aryeh Friedman wrote: >>> I am convinced you don't know how to read or don't read what you >> quote >>> because nothing in what I said was setting standards.... For >> example I >>> never said that you couldn't use Unix for simple stuff like word >>> processing (or latex in your case).... If anything you're the one >> who >>> assumes it the only OS that can do that stuff.... But there are >> plenty >>> of technical/math editors for all OS's now you saying that >> "latex/xml" >>> is the only way to do it (you're own words btw) just doesn't know >> what >>> options are available and on what platforms.... If you don't >> believe >>> me about libreoffice for math editing for example I went back to >>> school (100% online course work) about 15 years ago and did all my >>> math homework (including some pretty hairy matrix math and >>> differential equations) using the equation editor in libreoffice >> (it >>> has only gotten better since then)... Am I forcing you to use it >> or >>> anything else no but you are saying that latex/xml is the only >> way... >>> so who is setting standards? (not me) >> >> No I didn't say anything like that. >> Now you're distinctly bending reality. > > Yes you did say just that when you implied that you use Unix for latex > only and that no other OS was suitable. No, I didn't. I neither said nor implied. >>> For your purposes modern Windows systems are just as fast/solid > > First what part of "your purposes" is not clear?!?! You are not doing > high-end client-server, embedded systems or anything else that Unix is > uniquely well suite for your doing glorified word processing.... so > for your purposes (not some other purpose) Windows is just as fast and > solid as any OS. > >> If that were right, it would be employed by the New York and London >> stock exchanges and the International Space Station, but it isn't. >> I can't even begin to imagine what a frozen screen would mean up >> there. > > 1. The ISS *DOES* use Windows for end user applications (which is what > it good at) and uses Unix for the control systems (which it is good > at): > https://www.forbes.com/sites/quora/2016/03/15/why-does-the-iss-use-windows-os/?sh=20fa6b3e6926 > 2. Like the ISS the NYSE uses both Windows and Unix with Unix doing > the *INFRASTRUCTURE* and Windows being the most common UI traders and > other staff use to interface to the trading system > https://www.quora.com/Why-do-traders-all-use-PCs-besides-the-fact-that-there%E2%80%99s-a-ton-of-software-that-is-PC-only > (it should be noted that the super fast high speed trading machines > usually have *NO* OS on them since that would add a few microseconds > of overhead which is completely unacceptable for HFT) > >>> (security is still the one area Unix is still better)... But for >> stuff >>> like webapps there really is no real alternative then Unix because >> of >>> it's infrastructure/backend origins and focus.... So yes the only >>> place where I might be setting standards is in areas where there >> are >>> no real alternatives except the "standard" way of doing things... >>> >>> That is not to say that Unix is the "right" way to do those things >> and >>> for most non-development work it is not the "right" way due to not >>> having "no assembly required" pre-canned solutions for said tasks >>> while Windows does. >> >> If that were true, I wouldn't be doing things the way I do. >> I have yet to see a LaTeX presentation level produced by Word, and >> doubt >> I ever will. > > I never said word I said Libreoffice (the fact you said word is one > reason why I say you don't read). Libreoffice does support LaTex. You're more convoluted in a conversation than a corkscrew. >> It's also better for presentation of math equations, one of the >> reasons >> it was created in the first place. > > Latex was actually created by Knuth originally because he used a very > unorthodox notation in "The Art of Computer Programming" that no > existing equation editor at the time (or even now) supports and thus > instead us using standard CS notation he went down a 10 year rabbit > hole making LaTex. I think you're capable of creating any alternate reality in order to endorse your philosophies of convenience. There's nothing further to discuss, here. Cheers! Harry -- `The World is not dangerous because of those who do harm but because of those who look on without doing anything'. -- Albert Einstein From owner-freebsd-questions@freebsd.org Sat Mar 20 03:30:38 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 09EFB5707C3 for ; Sat, 20 Mar 2021 03:30:38 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2R9T0tyyz4rFc for ; Sat, 20 Mar 2021 03:30:36 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [IPv6:2607:fb90:f05f:6697:b698:527e:b81e:f37a] (unknown [172.58.141.140]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 35D0C4E67C; Fri, 19 Mar 2021 22:30:36 -0500 (CDT) Date: Fri, 19 Mar 2021 22:30:33 -0500 User-Agent: K-9 Mail for Android In-Reply-To: <0d46b27f-dcdb-41cf-8780-5636d39c07ef@gmail.com> References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> <0d46b27f-dcdb-41cf-8780-5636d39c07ef@gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org,Graham Perrin From: Valeri Galtsev Message-ID: X-Rspamd-Queue-Id: 4F2R9T0tyyz4rFc X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [-2.90 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; RECEIVED_SPAMHAUS_PBL(0.00)[172.58.141.140:received]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[freebsd.org,gmail.com]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 03:30:38 -0000 On March 19, 2021 8:00:47 PM CDT, Graham Perrin = wrote: >On 19/03/2021 23:41, Aryeh Friedman wrote: >> Unix was not designed for end users,=20 >=E2=80=93 is not an excuse to marginalise or denigrate end users=2E +1 Valeri >_______________________________________________ >freebsd-questions@freebsd=2Eorg mailing list >https://lists=2Efreebsd=2Eorg/mailman/listinfo/freebsd-questions >To unsubscribe, send any mail to >"freebsd-questions-unsubscribe@freebsd=2Eorg" ++++++++++++++++++++++++++++++++++++++++ Valeri Galtsev Sr System Administrator Department of Astronomy and Astrophysics Kavli Institute for Cosmological Physics University of Chicago Phone: 773-702-4247 ++++++++++++++++++++++++++++++++++++++++ From owner-freebsd-questions@freebsd.org Sat Mar 20 03:31:03 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id B5CF65707D6 for ; Sat, 20 Mar 2021 03:31:03 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb2b.google.com (mail-yb1-xb2b.google.com [IPv6:2607:f8b0:4864:20::b2b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2R9z01vpz4rNl for ; Sat, 20 Mar 2021 03:31:02 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb2b.google.com with SMTP id g12so301432ybh.9 for ; Fri, 19 Mar 2021 20:31:02 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=Nz0VuVUdnaZU1zENqXdLhWZ1yUbl9OvzLOxadwGnfPU=; b=tBVZuECLoy0xKYpFrPQRfStNamGQh5eHaADdDbzBoF7H0m2HGEE8lqNbj+Q0QU9Uo/ L3AQQq3X/sQxBQoOYppoir/VLnOjDCz/Ka5OPc9yHxLz5NqCsbexIWv9Jd8tgKNDMu9X 0ijyAIZzGyPbEXvSUPHFnO8aarHOHgw7PHJqbnMki9I3LFIfSdKFXNtUzgF52MvxLFO6 r08pFXid3jMZrunQw+GAKnjoBicDIhfqQAFn8JLG3aLOtDl76UFqNIS/z4e1+TIKveaG BCa/8o5+LfAHk8RP0m2mqwnUvuYgYGv1R9NCi9i6DLaWXmQLaKDmGVHEp9Vwhmj6bYj7 oRIA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=Nz0VuVUdnaZU1zENqXdLhWZ1yUbl9OvzLOxadwGnfPU=; b=keZH14dtb/ZubtIHwVUYIaE3wTpjYA5hU40OIrT/PpFD1NGHF1SskSEPkENE03CvaX tMPMdqBPs7OM643+zTCpMptSdgMurZmiiHuNZhYo2swRxt/hyCZmiRP5pchhF9JbL7k5 y7zZFYzfYUZzKLt1NDVl890DyBk4C5S0vfBzAntn8ZOjKTJrwKxdFwkZOropkHHqt6R2 ECKvAZ/KOIbtsw6o32bASYDCC228XCF03+HfcUAaYd+xkcuxjSjOZHtmd9ur/zHSbjvg S+z+T4B5VsGlM0Xo6SGx0l/XN+GnMPLttEXXRfwZ6XJAm9KVpDJA4vhRbkWslQgBhUuB u7TA== X-Gm-Message-State: AOAM532qUITEV8okT7Y4ECYYGg+5WDvsSblzHUsdPFCGpzL/MPyABoY4 FJDhXXKJszt8fcIMW/NPklt7ye3tfkzzBWRO8hk= X-Google-Smtp-Source: ABdhPJyAuJyKonuxfyDW+XGAcKYeIj8hF0B8UMOMxdVS6AL7QY57LdYA4XzaHZGEX47f29IntLKWuJAGBmovBZISzF4= X-Received: by 2002:a25:5146:: with SMTP id f67mr10903717ybb.332.1616211062060; Fri, 19 Mar 2021 20:31:02 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> <06d8d9ae876bbdaf11fe7691fd2d4fad@riseup.net> <445edf2bbcb1e7e24071b89ce830927f@riseup.net> In-Reply-To: <445edf2bbcb1e7e24071b89ce830927f@riseup.net> From: Aryeh Friedman Date: Fri, 19 Mar 2021 23:30:50 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: Weaver Cc: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2R9z01vpz4rNl X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=tBVZuECL; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b2b as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b2b:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b2b:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b2b:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 03:31:03 -0000 On Fri, Mar 19, 2021 at 11:13 PM Weaver wrote: > On 20-03-2021 12:31, Aryeh Friedman wrote: > > On Fri, Mar 19, 2021 at 10:06 PM Weaver wrote: > > > >> On 20-03-2021 11:20, Aryeh Friedman wrote: > >>> I am convinced you don't know how to read or don't read what you > >> quote > >>> because nothing in what I said was setting standards.... For > >> example I > >>> never said that you couldn't use Unix for simple stuff like word > >>> processing (or latex in your case).... If anything you're the one > >> who > >>> assumes it the only OS that can do that stuff.... But there are > >> plenty > >>> of technical/math editors for all OS's now you saying that > >> "latex/xml" > >>> is the only way to do it (you're own words btw) just doesn't know > >> what > >>> options are available and on what platforms.... If you don't > >> believe > >>> me about libreoffice for math editing for example I went back to > >>> school (100% online course work) about 15 years ago and did all my > >>> math homework (including some pretty hairy matrix math and > >>> differential equations) using the equation editor in libreoffice > >> (it > >>> has only gotten better since then)... Am I forcing you to use it > >> or > >>> anything else no but you are saying that latex/xml is the only > >> way... > >>> so who is setting standards? (not me) > >> > >> No I didn't say anything like that. > >> Now you're distinctly bending reality. > > > > Yes you did say just that when you implied that you use Unix for latex > > only and that no other OS was suitable. > > No, I didn't. > I neither said nor implied. > "If you don't use latex/xml then you should not do technical writing" sure sounds like you said it! > > > >>> For your purposes modern Windows systems are just as fast/solid > > > > First what part of "your purposes" is not clear?!?! You are not doing > > high-end client-server, embedded systems or anything else that Unix is > > uniquely well suite for your doing glorified word processing.... so > > for your purposes (not some other purpose) Windows is just as fast and > > solid as any OS. > > > >> If that were right, it would be employed by the New York and London > >> stock exchanges and the International Space Station, but it isn't. > >> I can't even begin to imagine what a frozen screen would mean up > >> there. > > > > 1. The ISS *DOES* use Windows for end user applications (which is what > > it good at) and uses Unix for the control systems (which it is good > > at): > > > https://www.forbes.com/sites/quora/2016/03/15/why-does-the-iss-use-windows-os/?sh=20fa6b3e6926 > > 2. Like the ISS the NYSE uses both Windows and Unix with Unix doing > > the *INFRASTRUCTURE* and Windows being the most common UI traders and > > other staff use to interface to the trading system > > > https://www.quora.com/Why-do-traders-all-use-PCs-besides-the-fact-that-there%E2%80%99s-a-ton-of-software-that-is-PC-only > > (it should be noted that the super fast high speed trading machines > > usually have *NO* OS on them since that would add a few microseconds > > of overhead which is completely unacceptable for HFT) > > > >>> (security is still the one area Unix is still better)... But for > >> stuff > >>> like webapps there really is no real alternative then Unix because > >> of > >>> it's infrastructure/backend origins and focus.... So yes the only > >>> place where I might be setting standards is in areas where there > >> are > >>> no real alternatives except the "standard" way of doing things... > >>> > >>> That is not to say that Unix is the "right" way to do those things > >> and > >>> for most non-development work it is not the "right" way due to not > >>> having "no assembly required" pre-canned solutions for said tasks > >>> while Windows does. > >> > >> If that were true, I wouldn't be doing things the way I do. > >> I have yet to see a LaTeX presentation level produced by Word, and > >> doubt > >> I ever will. > > > > I never said word I said Libreoffice (the fact you said word is one > > reason why I say you don't read). Libreoffice does support LaTex. > > You're more convoluted in a conversation than a corkscrew. > What is so convoluted? you claimed that Word didn't have X when I never said it did.... I then pointed out that another word processor on Windows (and Unix) *DOES* have that capability.... please explain what is convoluted about that? ... Are you purposely misreading everything? > > >> It's also better for presentation of math equations, one of the > >> reasons > >> it was created in the first place. > > > > Latex was actually created by Knuth originally because he used a very > > unorthodox notation in "The Art of Computer Programming" that no > > existing equation editor at the time (or even now) supports and thus > > instead us using standard CS notation he went down a 10 year rabbit > > hole making LaTex. > > I think you're capable of creating any alternate reality in order to > endorse your philosophies of convenience. > There's nothing further to discuss, here. > You are the one who is making a alternate reality.... direct quote from the wikipedia article on TeX: When the first paper volume of Donald Knuth's The Art of Computer Programming was published in 1968,[5] it was typeset using hot metal typesetting set by a Monotype machine. This method, dating back to the 19th century, produced a "classic style" appreciated by Knuth.[6] When the second edition was published, in 1976, the whole book had to be typeset again because the Monotype technology had been largely replaced by phototypesetting, and the original fonts were no longer available. When Knuth received the galley proofs of the new book on 30 March 1977, he found them inferior. Disappointed by the galley proofs of the second edition of the second volume, he was motivated to design his own typesetting system. Knuth saw for the first time the output of a high-quality digital typesetting system, and became interested in digital typography. On 13 May 1977, he wrote a memo to himself describing the basic features of TeX.[7] He planned to finish it on his sabbatical in 1978, but as it happened, the language was not "frozen" (ready to use) until 1989, more than ten years later. Guy Steele happened to be at Stanford during the summer of 1978, when Knuth was developing his first version of TeX. When Steele returned to the Massachusetts Institute of Technology that autumn, he rewrote TeX's input/output (I/O) to run under the Incompatible Timesharing System (ITS) operating system. The first version of TeX, called TeX78, was written in the SAIL programming language to run on a PDP-10 under Stanford's WAITS operating system. -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 03:35:50 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 87161570A7B for ; Sat, 20 Mar 2021 03:35:50 +0000 (UTC) (envelope-from melson.r@att.net) Received: from sonic305-24.consmr.mail.gq1.yahoo.com (sonic305-24.consmr.mail.gq1.yahoo.com [98.137.64.87]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2RHT2v29z4rmr for ; Sat, 20 Mar 2021 03:35:48 +0000 (UTC) (envelope-from melson.r@att.net) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=att.net; s=s1024; t=1616211346; bh=YZ3nn/bSkw3Q+mBgPb5Y8j+HqNEOkW/HSnAlaF6HnXc=; h=Subject:To:References:From:Date:In-Reply-To:From:Subject:Reply-To; b=C5l3OAkZ0YU85Br6lYFZYm2h6ksZe1Zm/gjd9mW7yKxcPZ/Zz91iGht4kPwgEFNvNMZX2VqC0OSeX7G2sQ5Ve9goOg6HI6cprK/twgTXOWRutWbTvtOS0DR9qEBo+HE6a9uajGva0+JMoya+hTPdLk/X3nueVlYZvceeVbU7dBw= X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1616211346; bh=46ox35Dvn7aWnqYJSsYAmdIexrrLqzhuxsTUWC+rxKB=; h=X-Sonic-MF:Subject:To:From:Date:From:Subject; b=DmYrOXyMdhyDImORPfp4vVQr6dp+a/8hvt1J+kx0d1NthxCiymkZ7Kmjv7YNo4z6ek9Q+VDPA5ugIdJhvGwiX31pHM/5waMq4zQQk1TvFtSDkCaLBr1zICv6VCHNOIjHTCGu3ucKpQd5N488MeF7EV6bYEinzSggst5s50g1yRKFP2fjksICI66CCwhO6ISVjr0qxcOA6xHK0kMY7r1w1YMT17q2lyRTty/UV4rQsmb2x58phlbpQ5qKiCXb9Bpv2bqrSU5cJgDK4deOLoaoKkLpV/5sriysQCq7DbnW/yFRrryBlD0UnQCrKG00luEuhp3BfMjZb6AkO6SizTZHug== X-YMail-OSG: e9Vlr6kVM1kOC_ggA2UnGwgsms2AK4a9r0naKa9c.F6d6UVZSfK45wNxdBsJDCI I7.Zopsn2EXbG9RewLsmuU8eBnF5broQumol6z6WrhDYe6S4CjzR8KlKEZCsaSlhcV.Ex3nSSq2M d5Qrv2juPQ8.mQedZMf3mc2gqyVYGXyaEJ.iWot4znmzt1bUlWumpBoVUge1yeD5KXQwpuvL3QSI BcIECdTLDiHmE2BqAyncSgpFNDTGC1P8V_UgY0it7.qb_HY5_cP0LSYMQbwPExbY5SMcVGmNuPmA rWtp7k_8wJbkh.CpeibVwZbyk1k6ll8wTUni2MenePnoNtEkyKmCuB2.5i2o0WyFvhiQKgBG1g1x MZ8vB7lUow65OLuiTthz_0pm_GT5bqNO6pQOXXGdhIBYTh8p9y.DPk0hEkYocJBPFGVLm0onG80B yFavp5zcPL1gLrB1er6wEH_4var408hUehl3VeanA5axKAOIs088O2HS5vWRB5MP03rGFbhSE4J5 ZZTBdI3NYLH.BJd6RQIsEqGG6O_bY2K_jY2LD98iH1IX305o10w47NCKNJY0Ay9gzgUEYJ_gbby9 BV5MXVjQIWkh8IF.CiyhVa1vrgR3KRhdzOd8hs9JAZ.d1vk0dRzmd0nBfl8hoVjad.jXTf7nm1sC HQOo88Cga2v6JnSxgc1BJ_kOYaNcsf3UTvJHKtp7CF0Qj8wwqOAIIB36HWsKzPwnij6RIgmY0TBF 1EIYmxVeMRnFWkYft1GOkQN5..koclf2C3waaMYceoZGNS6g2VowrWQHl0EO6oWrlIBmieZ8DBPW yIwNyMlyz8C0cr590tn6M..JMAkAXCOegPPqM7zgGX4yxBYOVFH9OaEB3_vsHswD4W_HGIkOkkaL hRajN0PB1bWuR._.aj0Adl8EKxxG9luSX5vzwMXv4OzUcXnZ.0UT4hXa6bdx32AyFVNgCCjXXpzd 5srjJT1e9UeXFlDY.aNj59PRnCl.6r2WY6Kpyku5nEqQUcSqvDUHPZ._Fs7XXZVc_kUE1yE3BVqx 5ga_BYD1m_2CMb4.Z3qlJtLCyj.20kU75duWiP5L8iipmAmPGBGkA5ulrk0Wp39RBI_wqw835Uc3 ETmzW_.Vb.odzIbgYGnxSRfseISuVzjdzA5ncTMHDmj.veG3XlwAhRHjryHxvCUQsVlbEFgYP.QV Joks76WBHHY7CR59cvuHpgcs6GJLQxJVuD1iqewLJlR6hPnov4xp6tVUV3nT7RBr8kgLuYmfAC4M eNDcnjl9btCDRF_X3RcD.gTR7EMvVn1eTAdJ_Fw6QdZQoIfBYTf4tuScbY2RLW1TcXZSW6ixqit8 D5f3MGAMZH55SVBRlC81gxeXyZINHoExzWxIbIQ4yD5UWiSoL5ssJ6s3pgCimxNrDmB3msRmCBHn KX8v4Eloqr7t8.S7QSv4laeUZIHqMfhNjifKoTxKklP_ouvE9TQQNurYtvoIGCGkEUrQtr5htu9r Ek.NCYmGo81ADBTu03hGG6a23D5tdHNCJl0ibkgeloxxj.baDLvQW3JgFypqhVWt8oJK0HKx2GXi 35TXg6l2IhuB6m_I4m6t0H2b7G.R5LI9xoYcuMTJ.JBla_MYrLiVyGkKdAQe8._chGvjfYIwUM.8 GLNfcPP6T7CTfWctdzUj9iqQx4md9R6Vq2vzalNlqHKRrg31.DZd8Fzp7XMWRm1YiKcfoTVy20Rx RXY4Pfy4MpCIfdut7.9WLQAOoTuEEobyq0gz1XVCeSB.Q3D42pWgNMdRs27Pu4HnJw8z.Q3RtU4r Kwo7EpMrjCsrjw7sM8Uy5TPFIv4ousadStNB94gvgcxZf8BG69v0__5Lz0nBzZ_rSW3OQcv2ls5K HsWcMRCcBSS.549Yyvt0Ozx6AEdvwZHerPdb37GGsMwKPwwEQcUplbROrM5ogk1jNbZQjmOlk2YI wb7IU_ZsCML4c9.CUnt_5bYcjDpeEb6QTgMGQJxXsaTwJwhVzMZXr3oKCy0irogqfSeOD4iNss0e EqaphCqILO4mSCzbdIFHtrneDq1fDy_lIZbYL3lWOKtSxUeEvfmyKPkmPaTHTI4foFl7kSy_I5Lm ixm1ncs03z0_fBHUfoFOCEbeRabWso308VBmHAAEpsQeIbFzdIiSC_aLP2oXERwUu7bgZE7z.6cB 2yjW2QmuvLLfsTkVSLzedx4.9B1Q1IP2zASCIcZGAMjCaisQ4GCg_hUT6QzZajPIAGWyU7JaPiqr 0viDx.rPr.pQUe1RvvnPMuYg9YGIITw7Y_gPsJiM9uPhu8yq28SGGfJexAqttieurEsrJgVfKGXD ZGh5E3lYzIeShcRBV8kIIlvBBvdSE.01bqCFTePEUElhIRCflvtN65GYds5srEplcHBToi1tkqRO rR_Omp4byAR83ouwbWwVZkkzpd3XLSldb5SoLukpx6kcgZGqAWVMcfYzvvItC3qt8APIh5z95egD A0jNIJA-- X-Sonic-MF: Received: from sonic.gate.mail.ne1.yahoo.com by sonic305.consmr.mail.gq1.yahoo.com with HTTP; Sat, 20 Mar 2021 03:35:46 +0000 Received: by smtp402.mail.gq1.yahoo.com (VZM Hermes SMTP Server) with ESMTPA ID 36d69cd45dba3480e1b297fb2b0944fc; Sat, 20 Mar 2021 03:35:41 +0000 (UTC) Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <259fba3aa7665be79a056fb9f5bc1825@riseup.net> <20210320005341.19ae7728abc9ebf1eb48b895@sohara.org> From: Bob Melson Organization: Department of Paleocomputing, Whatsamatta U. Message-ID: <645921e7-a119-3a8d-9679-31441c33ddab@att.net> Date: Fri, 19 Mar 2021 21:35:40 -0600 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: <20210320005341.19ae7728abc9ebf1eb48b895@sohara.org> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.17936 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo Apache-HttpAsyncClient/4.1.4 (Java/11.0.9.1) X-Rspamd-Queue-Id: 4F2RHT2v29z4rmr X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=att.net header.s=s1024 header.b=C5l3OAkZ; dmarc=none; spf=none (mx1.freebsd.org: domain of melson.r@att.net has no SPF policy when checking 98.137.64.87) smtp.mailfrom=melson.r@att.net X-Spamd-Result: default: False [-3.30 / 15.00]; FREEMAIL_FROM(0.00)[att.net]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; DKIM_TRACE(0.00)[att.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[att.net]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[att.net:dkim]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[98.137.64.87:from]; R_DKIM_ALLOW(-0.20)[att.net:s=s1024]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[att.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[98.137.64.87:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[98.137.64.87:from]; R_SPF_NA(0.00)[no SPF record]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.64.87:from]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 03:35:50 -0000 On 3/19/21 6:53 PM, Steve O'Hara-Smith wrote: > On Fri, 19 Mar 2021 19:41:09 -0400 > Aryeh Friedman wrote: > >> Unix was not designed for end users, it was designed by technical people >> for other technical people doing technical work (development and other >> infrastructure related tasks). > > The first major role for Unix was a document preparation system at > AT&T which is the reason for troff, eqn et al which are what remains of > "Documenter's Workbench". So you are incorrect, unix was originally > designed for end users - it's just that end users have become less > sophisticated over the decades. > I've forgotten the guy's name, but one of the researchers at AT&T wrote a couple of books about "tiny" languages/tools and made the point that Unix was designed to make use of them, usually in a pipeline - the output of one tool feeds into the input of the next, whose output feeds the input of next+1, etc., each tool in the pipeline being designed to do one thing well Still, granted that the technology of the time was limited to black and white character only terminals, it's unsurprising that Unix began as a command-line oriented OS - it was the only game in town until DEC, Xerox and Silicon Graphics introduced (independently?) usable GUIs and the X Consortium was formed - I want to say this occurred in the late 70s/early 80s, but won't bet the farm. But a funny thing happened on the way to today: the GUIs matured and spawned imitators and competitors and X11/X86 matured to the the point that there's scarcely an OS out there that doesn't sport a GUI of greater or lesser sophistication. As well, from within the graphical desktop, you can call a terminal emulator that provides access to the command line without requiring that you leave the graphical environment and while also running graphics heavy applications like LibreOffice or cad/cam software or a web-browser in separate windows/workspaces. So, just because Unix began as a command-line oriented OS, with a plethora of useful single task tools, doesn't mean it has remained static or mired in its command-line beginnings. This whole conversation has become a big-endian vs little-endian contest that serves no useful purpose beyond the airing of personal animosities. Neither side is absolutely correct or absolutely wrong. The OP - Jerry - is concerned about a possibly fatal bug in FBSD12 that has gone uncorrected for - maybe - too long and is considering dumping FreeBSD for something else that may or may not solve his problem. Personally, I think his reasoning is suspect but it's his decision to make. Others, not unreasonably, have suggested that he attempt to work around the problem, though I find their language condescending and abrasive in the extreme. -- Robert G. Melson | Dept of Paleocomputing, Whatsamatta U | El Paso, TX -- Minds are like parachutes. They only function when they are open. Sir James Dewar From owner-freebsd-questions@freebsd.org Sat Mar 20 08:38:54 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4468A5776DE for ; Sat, 20 Mar 2021 08:38:54 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2Z1947bvz3Pg6 for ; Sat, 20 Mar 2021 08:38:52 +0000 (UTC) (envelope-from kremels@kreme.com) Content-Type: text/plain; charset=utf-8 Subject: Re: OS to replace FreeBSD From: "@lbutlr" In-Reply-To: <20210319130249.000042a1@seibercom.net> Date: Sat, 20 Mar 2021 02:38:49 -0600 Content-Transfer-Encoding: quoted-printable Message-Id: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> To: FreeBSD X-Mailer: Apple Mail (2.3654.80.0.2.43) X-Rspamd-Queue-Id: 4F2Z1947bvz3Pg6 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [-0.97 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.121.55.42:from]; NEURAL_HAM_MEDIUM(-0.99)[-0.986]; FROM_HAS_DN(0.00)[]; MISSING_MIME_VERSION(2.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.10)[text/plain]; R_SPF_ALLOW(-0.20)[+mx]; DMARC_NA(0.00)[kreme.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.121.55.42:from:127.0.2.255]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.58)[-0.584]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[65.121.55.42:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 08:38:54 -0000 On 19 Mar 2021, at 11:02, Jerry wrote: > Versions 10 & 11 work fine. This is something that FreeBSD did that > screwed up the works. As I understand it, the controller was always broken (returning an = invalid and illegal ID?) it's just that FreeBSD tried to properly parse = that ID and fails. Who know, there are probably security considerations. = I know I do not want my system rusting a errant USB port considering the = security disater that USB is. Anyway, this is an issue with the controller and you have been told how = to work around it. At this point, it's up to you if you want to apply = the knife to cut out the controller causing the error or apply it to = your nose instead. Neither of these is really a great option, at least not if you are using = USB3 devices for some reason, but there it is. > Dell is aware of the problem but will do nothing That matches every experience I've ever had with Dell, yes. but the = issue appears to be the on board controller which is not theirs. The = manufacturer of the on board controller could fix this, probably, but = they have no motivation to. > I am not going to spend more money to get a system that is happy with > FreeBSD. I buy what I want and then get an OS that is capable of > operating on it, not the other way around. In any case, I am thinking > of either Fedora, Debian or Arch Linux. I was just looking for > recommendations from anyone who has used those systems. I find Linux to be annoyingly different in myriad ways, some of which = are objectively inferior, so=E2=80=A6 Every time I need to do stuff on = my Pi4 I feel like I am living on a. System that is almost, but not = quite, entirely unlike Unix. YMMV, of course. If you are a desktop Unix = person you may even prefer linux. --=20 The brain is an amazing organ, it works every second of every day from before we're even born right up until the instant we fall = in love. From owner-freebsd-questions@freebsd.org Sat Mar 20 08:57:41 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 1340E5782D5 for ; Sat, 20 Mar 2021 08:57:41 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2ZQr3qHdz3Qtw for ; Sat, 20 Mar 2021 08:57:40 +0000 (UTC) (envelope-from kremels@kreme.com) Content-Type: text/plain; charset=us-ascii Subject: Re: OS to replace FreeBSD From: "@lbutlr" In-Reply-To: <8b67da35-29e2-4930-ff86-f6af0814a019@kicp.uchicago.edu> Date: Sat, 20 Mar 2021 02:57:39 -0600 Content-Transfer-Encoding: quoted-printable Message-Id: <9DE6D685-2F6F-4CA2-A8E3-BD0F56FEAD26@kreme.com> References: <8b67da35-29e2-4930-ff86-f6af0814a019@kicp.uchicago.edu> To: FreeBSD X-Mailer: Apple Mail (2.3654.80.0.2.43) X-Rspamd-Queue-Id: 4F2ZQr3qHdz3Qtw X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [0.61 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.121.55.42:from]; NEURAL_HAM_MEDIUM(-0.99)[-0.985]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx:c]; MISSING_MIME_VERSION(2.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DMARC_NA(0.00)[kreme.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.121.55.42:from:127.0.2.255]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_SPAM_SHORT(0.99)[0.994]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[65.121.55.42:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 08:57:41 -0000 On 19 Mar 2021, at 09:50, Valeri Galtsev = wrote: > And, BTW, as all sysadmins I did not miss a chapter: "configuring and = running sendmail". And I can (to an extent) edit sendmail's "low level" = config files directly (not only config file from which these are = "compiled"), which loosely compares to editing assembly code vs high = level programming language code ;-) Yet, I still prefer postfix's plain = ASCII config files. Hear hear! Everyday is one more day further away from having to configure sendmail. I have gone to a great deal of effort to forget everything I ever knew = about sendmail in the last 26 years. I went through several mail servers and finally settled on postfix and = never looked back. --=20 Is it my imagination, or do buffalo wings taste like chicken? From owner-freebsd-questions@freebsd.org Sat Mar 20 08:59:59 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AE8ED578354 for ; Sat, 20 Mar 2021 08:59:59 +0000 (UTC) (envelope-from kremels@kreme.com) Received: from mail.covisp.net (mail.covisp.net [65.121.55.42]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2ZTV6qgtz3Qnd for ; Sat, 20 Mar 2021 08:59:58 +0000 (UTC) (envelope-from kremels@kreme.com) Content-Type: text/plain; charset=us-ascii Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD From: "@lbutlr" In-Reply-To: <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> Date: Sat, 20 Mar 2021 02:59:57 -0600 Content-Transfer-Encoding: quoted-printable Message-Id: <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> To: FreeBSD X-Mailer: Apple Mail (2.3654.80.0.2.43) X-Rspamd-Queue-Id: 4F2ZTV6qgtz3Qnd X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of kremels@kreme.com designates 65.121.55.42 as permitted sender) smtp.mailfrom=kremels@kreme.com X-Spamd-Result: default: False [0.61 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[65.121.55.42:from]; NEURAL_HAM_MEDIUM(-0.99)[-0.985]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+mx:c]; MISSING_MIME_VERSION(2.00)[]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DMARC_NA(0.00)[kreme.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[65.121.55.42:from:127.0.2.255]; TO_DN_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_SPAM_SHORT(0.99)[0.994]; RCVD_COUNT_ZERO(0.00)[0]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:209, ipnet:65.112.0.0/12, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[65.121.55.42:from] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 08:59:59 -0000 On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: > To anyone who has read the bug report, this is clearly a serious = regression issue on certain USB (probably 3) host controller hardware. I've read the bug report and all the replies and it is clearly a flaw in = the controller. It is providing an invalid ID. --=20 "Are you pondering what I'm pondering?" "Are you pondering cheesesticks?" From owner-freebsd-questions@freebsd.org Sat Mar 20 10:35:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 25D0357B904 for ; Sat, 20 Mar 2021 10:35:23 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qv1-xf2b.google.com (mail-qv1-xf2b.google.com [IPv6:2607:f8b0:4864:20::f2b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2cbZ1nKjz3phC for ; Sat, 20 Mar 2021 10:35:22 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qv1-xf2b.google.com with SMTP id by2so6286304qvb.11 for ; Sat, 20 Mar 2021 03:35:22 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=mMpnsEukvST/sZfXxp8hZyiRQd2TphrkMVKvZAbyjRQ=; b=EZP/fHyx8ceOfbYDkyWJAgxGJaW//cARDFPOvfOtO4wR15CbMgPhFLdg8PTc1tGPVj hSWaPEvX729ebB4GUGhZzmVmZQ5reIrvTJ5rkU6MyzHSG3SRPF1zMm2raK/uRI3njs2x arnWqDM9locu/Vqmxty2h7oo/d+yjOlxcE5Ow= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=mMpnsEukvST/sZfXxp8hZyiRQd2TphrkMVKvZAbyjRQ=; b=kw/uzHIblVDEi/2vU+LENGtdKoG2gk+wR5ccR/NBS1wL7A7MIq0dQk9fl8gdkgcJlH JtHVDlCjMPcnsCfd9/cz+THgFYjgqwmuSKDWHa7OrnMZgRP41Q3rcASUvvBeP5Zvy4po ljYYDDb8xe3ojz+j224NCfzRyqYTAHE4VGoo091Pflzm2AcZvkvbcTmhDzK7XzbbG0/c synGmO30qeHiBcpBBtGbWchGvVYh9Kw7PdqzoklXYTGkEgD8KXH3alYWaGBGb1sL45TX u8mpIvvnLIE4fZiR0JGGcKtra6WKmUbJShu0UZff5NzWPhHsiZxE42eKs8YLbtwOaQul NjfA== X-Gm-Message-State: AOAM533AkkLtN6LcOMaXQiuEOX4U3wUaGPP9CUsR7yfRBMax7XGds/D3 aHmPCYJ/80Yio9dTe+xx2xAvsuSWLhcgew== X-Google-Smtp-Source: ABdhPJzDxp5WJnEACvyTmFftifv0V4/fc9NM9Bgb67+rafze57ycoXtQR+4Y0O8BDuZiBhfqjY13cg== X-Received: by 2002:a05:6214:176e:: with SMTP id et14mr13027615qvb.35.1616236520929; Sat, 20 Mar 2021 03:35:20 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id z4sm6729988qkb.94.2021.03.20.03.35.19 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 20 Mar 2021 03:35:19 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2cbW0Fv5z1yWp for ; Sat, 20 Mar 2021 06:35:19 -0400 (EDT) Date: Sat, 20 Mar 2021 06:34:58 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210320063427.000040f5@seibercom.net> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/WHW1JDuI5pDItoHrV872SfB"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2cbZ1nKjz3phC X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=EZP/fHyx; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::f2b as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.39 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f2b:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f2b:from:127.0.2.255]; NEURAL_SPAM_LONG(0.99)[0.989]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f2b:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 10:35:23 -0000 --Sig_/WHW1JDuI5pDItoHrV872SfB Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Fri, 19 Mar 2021 18:30:00 -0400, Aryeh Friedman stated: >On Fri, Mar 19, 2021 at 4:32 PM Ralf Mardorf >wrote: > >> On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: =20 >> >Void uses a runit init system with no systemd =20 >> >> Hi, >> >> I suspect it's not a good idea to use Linux without systemd. For >> example, by upstream udev is part of systemd. Maintaining Linux >> without systemd is a bottomless pit. >> >> On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: =20 >> >Recompiling the kernel is *TRIVIAL* if you refuse to do it then you >> >should not be using any Unix variant =20 >> >> I dislike this tone of voice. However, I agree that compiling the >> kernel might be less effort, than migrating to another operating >> system. If you would e.g. migrate to Arch Linux, you need to get >> used to systemd. Getting used to systemd isn't pleasant. If you >> chose a Linux distro that doesn't use systemd, you likely will >> experience all kinds of trouble, if you want to customize your >> install.=20 > >I used that tone because it really is simple and if you can't/won't >recompile the kernel before throwing the baby out despite with the bath >water then you really don't have the skills/desire needed to use Unix >effectively... Just to show how trivial it really is > >1. Edit /usr/src/sys/amd64/conf/GENERIC (or i386 instead of amd64 if >your still using it) to comment out the xhci line (line 327 in >12.2-RELASE-pl3) to remove USB 3.0 support >2. cd /usr/src >3. make kernel >4. etcupdate >5. reboot > >Done.... how hard is that? I never said I could not compile a new kernel, I said I could not install the OS. Correct me if I am wrong, but doesn't the installation of the OS precede the creation of a new kernel? Furthermore, the screen just rolls away filling up with the error message ad infinitum. By the way, as I understand it, creating a custom kernel nullifies the use of "freebsd update". Wow, things just keep getting better & better. What I cannot understand is that FreeBSD knows it has a problem, one not shared by any other OS as far as I have been able to ascertain, and I have done a lot of research, and they refuse to fix it. The problem did not exist before version 12.x, so it is not like they never were able to get it right. --=20 Jerry --Sig_/WHW1JDuI5pDItoHrV872SfB Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBVz9gACgkQgHBP8gv9 FXcncQv+PG+NbEMimEx8MQikuswEph9KbBKtzXSpxma7LxgsMwbA/t/sk6QNpbpb ssXm+AN8HZsuiqiRSZH+rUSFIUMGSk6nwGrqVEQ107FcKgyjKZgzRL6YJtMK+z81 ToaXpQw6zABagtOLgKso2DfxWwYJ3aCsLZMdv+QCTVN+uW/Jcpnu1GMvL7eflxKM WbxNE39WWGoMyxRvo7cm6lXtDQrObauYFvENrB7BGviOSEjSJJzirql/yyuPya82 rtqAL7nfeqhe/e7GGArt/g2+xLF+3nglDDA3UFQpOv3wNp+2I4Ady1T5FbVyz5gU cJpZEOaE3RCI/ddEJ7QmxVw8t7/fezC9ShqJqRmUNRwzVOulP3NcKAgkE1x9VSCY UxTXiUEpNHKaPCjZrGp6fWMhMD08LVc7aqULzkdivXivVW5kPivvJ5tr+8kKL2e0 C+SdzESyHF6UzZgzNuXBA9Keg6FrzzWjKOC9+4HdFhSrQ2vksbiBM1qBACdBNhHJ qTCrbcTd =jmih -----END PGP SIGNATURE----- --Sig_/WHW1JDuI5pDItoHrV872SfB-- From owner-freebsd-questions@freebsd.org Sat Mar 20 10:52:58 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 8262E57BCB7 for ; Sat, 20 Mar 2021 10:52:58 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: from mail-wm1-x32e.google.com (mail-wm1-x32e.google.com [IPv6:2a00:1450:4864:20::32e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2czs0mTFz3qwh for ; Sat, 20 Mar 2021 10:52:56 +0000 (UTC) (envelope-from parv.0zero9@gmail.com) Received: by mail-wm1-x32e.google.com with SMTP id z6-20020a1c4c060000b029010f13694ba2so6513746wmf.5 for ; Sat, 20 Mar 2021 03:52:56 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=oHwkSEX0G5YWXxv/saWCerKF/HW9sdOSiDj/tqn6H2M=; b=KOb1v5RnCO9I7fBb/KwiDtGiHzHxXXLJl86dK/Bo+2SodMpCg6Sdjlzb22NStyxTPN kPbzzFVg82fg/QrU0MLtmuhUVZfX1PQGMIURuy55bz1Bs9qWTZpMglub3ur6DmrSqBdP 8GBGwF0XTKs7usyChQWzkhcBCVeucAKKVo4+8ubGnaPbQH1ZbNamrPbSTBOrGBGav3qc zYMkW4hcJprHZ1xG5S5rWHRm8xSH63SnVSOXk6eERZ8XZaNf2GHeamsGo1Ja0AcacFc6 dtI53H2OOVP5Vo5oKYB9/6RnazxzqKPmItMhdsvKvZ/+XHOuSYKo/BexBAdEczcn55k0 SdrA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=oHwkSEX0G5YWXxv/saWCerKF/HW9sdOSiDj/tqn6H2M=; b=nBsPesd3tEO6NwuFzmOOibOfgg8BKQx0hBXP3Qt1wh3dvX7auyMv0i2zdv/wnqya31 hBruBxlMphNKlRy4NJaSmSmsYe1XqG06/2bPO3EnmnWez1QB4+5NeAX2ILp7NLbvDJrl rkpfZJnb/Wt/PlFwBmsRKuaVmm0WTRya6NCz/F6OvYZWsDlkKft2tu48Vi1xjh6eFRuW h4U/UKyY124Vi5YPsWZ0uFVpMlVnjEqK9L4BpECBcBSE3/NYyleXpzncC1OtBmHo3K4B vlV+WQq6lTi4Bg66KHO+gFnx9Lpd1GbVa/26CKorc5G19FYcSkW/Zx9bZmVDA0Kyz0Ra M44g== X-Gm-Message-State: AOAM530udb+b0eWzEFCS6CznrosMybb5LQZ8Vi7nTfIfCGmjU6JckuPi pNIW1eVKhd9Hqr2MIq+mhWwo8eKmB0X31tbRRUh/YSZycD8= X-Google-Smtp-Source: ABdhPJx5NJQ+iCh6Mj54xqOl3m3UR+RGKj8DlaWYthqo56yvBK1V/tX5b6LghDbdNJ3Q5XoVdOUl695wwHqrKIqUXLI= X-Received: by 2002:a1c:e244:: with SMTP id z65mr7479104wmg.130.1616237574656; Sat, 20 Mar 2021 03:52:54 -0700 (PDT) MIME-Version: 1.0 From: "parv/freebsd" Date: Sat, 20 Mar 2021 00:50:44 -1000 Message-ID: Subject: pkg- searching by (partial) origin|category for installed packages/ports To: FreeBSD X-Rspamd-Queue-Id: 4F2czs0mTFz3qwh X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=KOb1v5Rn; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of parv0zero9@gmail.com designates 2a00:1450:4864:20::32e as permitted sender) smtp.mailfrom=parv0zero9@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::32e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; TAGGED_FROM(0.00)[freebsd]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::32e:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::32e:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 10:52:58 -0000 Hi there, How does one search for a installed port or package by (partial) origin/category? Failed attempts ... % pkg query %o x11-wm % pkg query %C x11-wm % pkg query %C x11-wm %o % pkg query --evaluate '%o ~ "x11-wm" %o % pkg query --evaluate '%C ~ x11-wm' %o malformed evaluation string % pkg query --evaluate '%C = x11-wm' %o malformed evaluation string ... what am I missing? - parv Yes, I can go round that in brute force way ... % pkg info --all --origin | fgrep x11-wm From owner-freebsd-questions@freebsd.org Sat Mar 20 11:30:28 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id EC71957D139 for ; Sat, 20 Mar 2021 11:30:28 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lf1-x135.google.com (mail-lf1-x135.google.com [IPv6:2a00:1450:4864:20::135]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2dq80Ykmz3sl4 for ; Sat, 20 Mar 2021 11:30:27 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lf1-x135.google.com with SMTP id a198so14021272lfd.7 for ; Sat, 20 Mar 2021 04:30:27 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=5TAd+SIztinWChow2jl89vZ0Zl76BSIc0uAvpfnxeaE=; b=PjwbERvstFA+ENg/1/j9x5WhlEn5mkoXgDqoZ75n+MzIVF+RlGmAQBWY5rybMfpib9 Z/ML5qeUSBfYdx5tjiNZZCgToev6s720SfK7ZbPyMJJrUymcjDsoONvwM8Aa1+48E4QO aljk/VyMWlc9RWYcZCjBp1PZhj+TZqE35GzpiGE8/ABW+D10m744omNGSo7llarbMH+S dGWmvHy+xKwznCFcZY+Yuu7a2TMXMfTDszuXJy910IoNR09zQ3rIs0jox7AuC1sqdcIX JjUis/zfn99neE6fR0lCggv/eWjbqbp2/BQ7hTBBH0YMchXBmzLj50TQ69oWMRnjGWQg ecDg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=5TAd+SIztinWChow2jl89vZ0Zl76BSIc0uAvpfnxeaE=; b=jQ2Y4RihU1Pyu6JCmDY/1QFU3BktGwP1B27ipwSCsVGmKoG5FgsN8bwHRhYhlbUZvI iVka7kJzd2Sh/KLZ/s7Q8n9u2sJte039b8k1WNueAt77OHJPKsUktGfaygrT9xYngbP8 bp+RNJZks/NzC5Njj+2iutWumuA/dYUHk3JvXRY2zmkRj/jnACy11Nk83+ZEGs8p7sqX i+ZCgLlPAaZmvSFFYXp1b5VNqee0aaqv8A4H0sIrJlpfy31s7sgX9R90s57xjtchgBhq GOrfoIX8bN6Ov3D27rW8zAgvox4mxsxCRF6Co7UvDk9fJ42wWpbniHGHjLUipUxcebYW Iy6Q== X-Gm-Message-State: AOAM531xQPnIynLpuVbq3YVLNDxjcKuTpB5VSljqtYvASkqq2i4TZ3/j lxlMudklsZKVMxVnsYS7bhcmAH3L+yNk1yl/durNBz9ELTDA X-Google-Smtp-Source: ABdhPJz2UXjOXvSYm3/5qn2eqdjVt5P4W+BZHsWz6JsQ2WUgH5WFRAoARZY0s61+gWG7Bo3mztUdcN3HgphMkLOSy+Y= X-Received: by 2002:a19:f501:: with SMTP id j1mr3705262lfb.231.1616239826207; Sat, 20 Mar 2021 04:30:26 -0700 (PDT) MIME-Version: 1.0 References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> In-Reply-To: <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> From: Mohammad Noureldin Date: Sat, 20 Mar 2021 12:30:15 +0100 Message-ID: Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD To: FreeBSD X-Rspamd-Queue-Id: 4F2dq80Ykmz3sl4 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=PjwbERvs; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::135 as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; R_SPF_FAIL(1.00)[-all]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[thelightbird.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::135:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::135:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::135:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 11:30:29 -0000 Hi, On Sat, Mar 20, 2021, 10:00 @lbutlr wrote: > On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: > > To anyone who has read the bug report, this is clearly a serious > regression issue on certain USB (probably 3) host controller hardware. > > I've read the bug report and all the replies and it is clearly a flaw in > the controller. It is providing an invalid ID. > If that's the case, I am curious how other Unix-Like Operating Systems manage to work on the same HW ? > -- > "Are you pondering what I'm pondering?" > "Are you pondering cheesesticks?" > > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Fri Mar 19 20:43:05 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 974135AB183 for ; Fri, 19 Mar 2021 20:43:05 +0000 (UTC) (envelope-from office@klepp.biz) Received: from vie01a-dmta-at52-1.mx.upcmail.net (vie01a-dmta-at52-1.mx.upcmail.net [62.179.121.142]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2G7D4X7bz3rVf for ; Fri, 19 Mar 2021 20:43:04 +0000 (UTC) (envelope-from office@klepp.biz) Received: from [172.31.216.41] (helo=vie01a-pemc-psmtp-at50) by vie01a-dmta-at52.mx.upcmail.net with esmtp (Exim 4.92) (envelope-from ) id 1lNLxV-00AoeH-Ll for freebsd-questions@freebsd.org; Fri, 19 Mar 2021 21:43:01 +0100 Received: from t61.lan ([85.126.97.210]) by vie01a-pemc-psmtp-at50 with SMTP @ mailcloud.upcmail.net id iLiw2400K4YLlkt0BLiwcT; Fri, 19 Mar 2021 21:42:56 +0100 X-SourceIP: 85.126.97.210 X-CNFS-Analysis: v=2.2 cv=O6RJhF1W c=1 sm=2 tr=0 cx=a_idp_f:a_exe a=/Ac8Q0O/YFE5LOLfUiYZVw==:117 a=/Ac8Q0O/YFE5LOLfUiYZVw==:17 a=8nJEP1OIZ-IA:10 a=Tw93OqNOAAAA:8 a=6I5d2MoRAAAA:8 a=Lx8Bpjh-HcW9fOScTxcA:9 a=wPNLvfGTeEIA:10 a=tojzhCJciAGkLn-TEnmn:22 a=IjZwj45LgO3ly-622nXo:22 From: "Dr. Nikolaus Klepp" To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Date: Fri, 19 Mar 2021 21:42:55 +0100 User-Agent: KMail/1.9.10 References: <20210319101040.00005c35@seibercom.net> <20210319213214.4f8ddf55@archlinux> In-Reply-To: <20210319213214.4f8ddf55@archlinux> X-KMail-QuotePrefix: > MIME-Version: 1.0 Content-Type: Text/Plain; charset="iso-8859-1" Content-Transfer-Encoding: 7bit Content-Disposition: inline Message-Id: <202103192142.55284.office@klepp.biz> X-Rspamd-Queue-Id: 4F2G7D4X7bz3rVf X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=none (mx1.freebsd.org: domain of office@klepp.biz has no SPF policy when checking 62.179.121.142) smtp.mailfrom=office@klepp.biz X-Spamd-Result: default: False [-0.20 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[62.179.121.142:from]; NEURAL_HAM_MEDIUM(-1.00)[-0.998]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[klepp.biz]; AUTH_NA(1.00)[]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[62.179.121.142:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[3]; NEURAL_HAM_SHORT(-1.00)[-1.000]; MID_CONTAINS_FROM(1.00)[]; FROM_NAME_HAS_TITLE(1.00)[dr]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:6830, ipnet:62.179.0.0/17, country:NL]; RCVD_TLS_LAST(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_IN_DNSWL_LOW(-0.10)[62.179.121.142:from] X-Mailman-Approved-At: Sat, 20 Mar 2021 11:46:19 +0000 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 19 Mar 2021 20:43:05 -0000 Anno domini 2021 Fri, 19 Mar 21:32:14 +0100 Ralf Mardorf scripsit: > On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: > >Void uses a runit init system with no systemd > > Hi, > > I suspect it's not a good idea to use Linux without systemd. For > example, by upstream udev is part of systemd. Maintaining Linux without > systemd is a bottomless pit. Oh, you can use Devuan - wich works perfect. But I'd reverse the argument: It's not a good good idea, to run Linux with systemd. Basicly systemd is the argument to move away from Linux. Nik > > On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: > >Recompiling the kernel is *TRIVIAL* if you refuse to do it then you > >should not be using any Unix variant > > I dislike this tone of voice. However, I agree that compiling the kernel > might be less effort, than migrating to another operating system. If you > would e.g. migrate to Arch Linux, you need to get used to systemd. > Getting used to systemd isn't pleasant. If you chose a Linux distro > that doesn't use systemd, you likely will experience all kinds of > trouble, if you want to customize your install. > > Regards, > Ralf > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to "freebsd-questions-unsubscribe@freebsd.org" > -- Please do not email me anything that you are not comfortable also sharing with the NSA, CIA ... From owner-freebsd-questions@freebsd.org Sat Mar 20 12:02:13 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 037A457E75A for ; Sat, 20 Mar 2021 12:02:13 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lj1-x22b.google.com (mail-lj1-x22b.google.com [IPv6:2a00:1450:4864:20::22b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2fWm1c0Dz3vt1 for ; Sat, 20 Mar 2021 12:02:11 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lj1-x22b.google.com with SMTP id 16so15109797ljc.11 for ; Sat, 20 Mar 2021 05:02:11 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=i3oXvRgItVRmvs//3OY11omf3j8ieWFsw8zynkph7Pc=; b=bGaOALN5WOq/en5xOd6erof1hn3qsCwtpyOT/cn3cfZ339ivoHPvgGuAK/VNn4EUTs Kg2OfoGYd+WjfqDexeUS5Sj4fSOuAJZuMIOm7OxS2LF/f4Je1XO0bk6K4HWqBHeo4AqG zyOabRFg0hn+sg1Um5FOS1yQ+TEQo33l/uFgvj+BkNKgmtG4RYhzj9OZjG3P6l1Tkugs g7WOpV6FO/0NDgUYvqhmXmR/FMC6G2PxGWXLHFLtXgChOxrqtFNp4JuVRkdPYhSj/RHf 5nxC57M/Ho7NUbgFTnVg8bHKrthrdmdrzsKDn/jJMX9mAP3j4eyYyMXX+D/wucpYhwWC BYNQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=i3oXvRgItVRmvs//3OY11omf3j8ieWFsw8zynkph7Pc=; b=mP0mS3JiSmd66EvGbzupnCsqLZm1UF4CDsb9bgGQuVWJOyiVb9rZzAVshTJLxoLxpG J8HE8UxfoD4GOvZ8LGN1rtGzKhgVcLXsm/hpqVdgbF9ZPbPLydMlY/ZYBFttCW5rn2iP CEvNsuOw9PO2QUyocLdHqo5SkCaGeBF1KND2PkZTxBQtn7hyXu68vJeJ229dQkfHr7pQ ZB9PRdSFzzQHtnddzbxkDYkHFH4zlpxHABi0snkOjqATypX5HVZUhPjpAU8n9WuCmdif oSZWdcJIcfXFhmn1OH72OTsTWWhCt79Vku/oSQQ9Wfiwi/YLgjPXoS7mFOy0OdrLkg75 Tflg== X-Gm-Message-State: AOAM532dWdRBEnKdacxMH8QMuJC6u4+yp91m7efY5z84jCYad8RF23qN 4oq6YYlhDNl2hVI+bDOaiMcoEBZthcFv2sMorvS2P1aXc6cD X-Google-Smtp-Source: ABdhPJwT1WdmEvk8mGwDsLG9bsdS+e+tCjueFaQWJ34mQhFKtPyW8ZwdAHpgcmCDUkFPL/G521qtS1lmcJJCcR3OSF8= X-Received: by 2002:a2e:88ca:: with SMTP id a10mr3548108ljk.55.1616241730018; Sat, 20 Mar 2021 05:02:10 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: <20210320063427.000040f5@seibercom.net> From: Mohammad Noureldin Date: Sat, 20 Mar 2021 13:01:58 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F2fWm1c0Dz3vt1 X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=bGaOALN5; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::22b as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; R_SPF_FAIL(1.00)[-all]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::22b:from:127.0.2.255]; DMARC_NA(0.00)[thelightbird.com]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::22b:from]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::22b:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 12:02:13 -0000 Hi all, I am new to this mailing list, using FreeBSD/*BSD on and off. Joined the mailing list because I have a couple of project ideas that I want to build on top of *BSD. Though I am new, and maybe relative to many others here I am a newbie, allow me to comment on all the aspects addressed (so far) in this email thread: - "It is easy to build a new (custom) kernel", "Unix is made by technical people for technical people", etc: Though historically it is true that Unix like systems are made by technical people for technical people, it doesn't mean that it has to stay like this. IMHO, such motto causes a great piece of Engineering like *BSD to loose ground for other Unix like systems, namely Linux and all it's Distros. Not that I am a Linux hatter, I have respect to both. Related to that, I don't believe that it is a good message to FreeBSD users, that if you don't know how to build a new kernel, then there is no place for you here. IMHO, this really hurts the image of the community of FreeBSD specially in the eyes of new commers. Notice these email messages are archived. - About the problem reported: Thanks for all who went through the long list of comments on that PR and explained in brief that it is a USB controller/HW problem. In that respect, I do agree with Jerry and others wondering how other OS(s) can manage running on the same HW (in case that has been proven) ? I believe it worths looking at that. I would have volunteered to dig deeper into that, but I know I don't have the required experience (unless someone is willing to mentor me ? :) ) And responding to that:"OK, just shut up and go install another OS", is not a community building attitude at all. And for the sake of discussion, let's assume for a second that Jerry is lazy or not skilled enough, helping him and fixing the problem or clearly explaining a solution without bashing him, is not just for Jerry, it is for the whole community, for the current and new members who will be interested to join in the future. Jerry, I am curious, did you have time to try one the suggestions, specially running FreeBSD on a VM to see if it still suffers from the same problem ? You all have a great day/evening On Sat, Mar 20, 2021, 11:35 Jerry wrote: > On Fri, 19 Mar 2021 18:30:00 -0400, Aryeh Friedman stated: > >On Fri, Mar 19, 2021 at 4:32 PM Ralf Mardorf > >wrote: > > > >> On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: > >> >Void uses a runit init system with no systemd > >> > >> Hi, > >> > >> I suspect it's not a good idea to use Linux without systemd. For > >> example, by upstream udev is part of systemd. Maintaining Linux > >> without systemd is a bottomless pit. > >> > >> On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: > >> >Recompiling the kernel is *TRIVIAL* if you refuse to do it then you > >> >should not be using any Unix variant > >> > >> I dislike this tone of voice. However, I agree that compiling the > >> kernel might be less effort, than migrating to another operating > >> system. If you would e.g. migrate to Arch Linux, you need to get > >> used to systemd. Getting used to systemd isn't pleasant. If you > >> chose a Linux distro that doesn't use systemd, you likely will > >> experience all kinds of trouble, if you want to customize your > >> install. > > > >I used that tone because it really is simple and if you can't/won't > >recompile the kernel before throwing the baby out despite with the bath > >water then you really don't have the skills/desire needed to use Unix > >effectively... Just to show how trivial it really is > > > >1. Edit /usr/src/sys/amd64/conf/GENERIC (or i386 instead of amd64 if > >your still using it) to comment out the xhci line (line 327 in > >12.2-RELASE-pl3) to remove USB 3.0 support > >2. cd /usr/src > >3. make kernel > >4. etcupdate > >5. reboot > > > >Done.... how hard is that? > > I never said I could not compile a new kernel, I said I could not > install the OS. Correct me if I am wrong, but doesn't the installation > of the OS precede the creation of a new kernel? Furthermore, the > screen just rolls away filling up with the error message ad infinitum. > > By the way, as I understand it, creating a custom kernel nullifies the > use of "freebsd update". Wow, things just keep getting better & better. > > What I cannot understand is that FreeBSD knows it has a problem, one > not shared by any other OS as far as I have been able to ascertain, > and I have done a lot of research, and they refuse to fix it. The > problem did not exist before version 12.x, so it is not like they never > were able to get it right. > > -- > Jerry > > > > From owner-freebsd-questions@freebsd.org Sat Mar 20 12:38:25 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2C6A257F1BC for ; Sat, 20 Mar 2021 12:38:25 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qk1-x72c.google.com (mail-qk1-x72c.google.com [IPv6:2607:f8b0:4864:20::72c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2gKX20G8z4SKW for ; Sat, 20 Mar 2021 12:38:23 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qk1-x72c.google.com with SMTP id 7so5761316qka.7 for ; Sat, 20 Mar 2021 05:38:23 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=txgR7leAMmOYqdzgNuDqZKijYeXm3hSUqrvmr9E/F/4=; b=YIEmspCz02qcczb3H8Qi/tzjY9POj1nLvO4R4WRB9PRfOp1VEmXECdtFDdlJN7m93F B47VAp4yB5qC61Sfg4d7fk1UbAdU8qUFHON3YKM0JGhUXvsznY4B1rbylfb69AZEnnnm rdCvB7Ay/1eiutbFTSQcFTqaawYlCH1OZaR1A= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=txgR7leAMmOYqdzgNuDqZKijYeXm3hSUqrvmr9E/F/4=; b=HiIRJOCWhk0GAskIc4uRyA/OXZQM7LzPaB5UFgfpO0N1OmqBKpGq5y9hYAYdv8I+Pi 9uqGZV1xvOS3AfMxJIOOXmWX8QYGwHrE1SDq/9EwQh8clVn3X8jSATo10PmBjXLpT17a tv1UzD//n2GwDgT3qgMtkTbrItQQCXkSZjMQzVWtvEe6r3287u0Lfn4+EVAQR41P+3IW 47ndJp1a9J23w2s6/94BDQ8Qp42TzFzjwvwrUeEMgdmyQE65TxLKMcmBnkynYa4I/8AM UuYG0orBoSLp9LhY9AsbAOjlq0z9BKYNqulfeKVgeG06OZxvSiGP9TqQltir+U/bFZZt B1nw== X-Gm-Message-State: AOAM5312PUDvJYS2n6fMsMtfJCNUVlWZ1/f2WoTmqw9OwBOoo1nTJuqT ojbvx/uh6Wp/mAMb2ysuoxcTZTWQhxfFQA== X-Google-Smtp-Source: ABdhPJxep3PSYAUmvo95qe4U+dVZVKYDv1Cj7C3TxjPIulwbqwFwhsvUXz6I8Oxkl8Les80Jz8NWtA== X-Received: by 2002:a05:620a:641:: with SMTP id a1mr2724847qka.257.1616243902750; Sat, 20 Mar 2021 05:38:22 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id i17sm2289685qtr.33.2021.03.20.05.38.21 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 20 Mar 2021 05:38:21 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2gKT16grz1yZc for ; Sat, 20 Mar 2021 08:38:21 -0400 (EDT) Date: Sat, 20 Mar 2021 08:38:08 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD Message-ID: <20210320083808.00000cb1@seibercom.net> In-Reply-To: References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/5SF9YYp.XeDq+i/G2lxjqLy"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2gKX20G8z4SKW X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=YIEmspCz; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::72c as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [1.44 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-0.999]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::72c:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.96)[-0.963]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::72c:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::72c:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 12:38:25 -0000 --Sig_/5SF9YYp.XeDq+i/G2lxjqLy Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Sat, 20 Mar 2021 12:30:15 +0100, Mohammad Noureldin stated: >Hi, > >On Sat, Mar 20, 2021, 10:00 @lbutlr wrote: > >> On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: =20 >> > To anyone who has read the bug report, this is clearly a serious =20 >> regression issue on certain USB (probably 3) host controller >> hardware. >> >> I've read the bug report and all the replies and it is clearly a >> flaw in the controller. It is providing an invalid ID. >> =20 > >If that's the case, I am curious how other Unix-Like Operating Systems >manage to work on the same HW ? There are a number of possibilities. 1) They have better programmers that can handle abnormalities. 2) They realize that there are always going to be flaws in software and hardware and are smart enough to work around it. This is of course assuming that the actual problem is a defective controller that every other OS can handle correctly. If, and this is assuming that is correct, then why doesn't FreeBSD just code what the defective controller is allegedly sending and accept it? The simple fact the the code worked in versions prior to 12.x makes this excuse that the controlled is defective highly suspect. --=20 Jerry --Sig_/5SF9YYp.XeDq+i/G2lxjqLy Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBV7LUACgkQgHBP8gv9 FXde4gv/S7Akv7D4zwTXRQEcqju3FPpZ0NtbEET0Tk0VC2AFHSLff8XA9hiOZWP4 SvNeBAdlSTJPwYqgr0j4H9iAz6idkp7jIV795BfhWQUQCT54O5cxEpuRjDGH2tsR u3bsGB7aSaWDdTzXdVwdjxU1JbvpOwjKROWaQXFCiO8IJfggO93OV49Xh9VfU8e5 0c+FZYV19Ah2KkSsmZPgE1SIZQey5TsUEug0U0kShOAvpxmkBNf8FiCdFgp40ecj 4XZXVkTP3CfJNwMgFYbzaVkq0tV3q6G4lypybmwNJm1EXjqMP8HCKqXRWjZzV4ho ISds8M0bgkgZvjTEGXRD/PHUyX/SPN9Pza+nIUBLbO+UR/HKODvWdXOt92qYHRF3 CfGSWpklaPsrexizTVLgNCXVdjivFYz8DjnK6QHfoizoglPBZLjme5PsCTWPz/nQ RVvsWP5FmlYIslYBlF2+pljFWEcW4T84JY/WeiHn0O37eGBWLit3vmVyOxMqTZGq W9cYHq/c =4lal -----END PGP SIGNATURE----- --Sig_/5SF9YYp.XeDq+i/G2lxjqLy-- From owner-freebsd-questions@freebsd.org Sat Mar 20 12:41:44 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4ACFB57F6E4 for ; Sat, 20 Mar 2021 12:41:44 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb33.google.com (mail-yb1-xb33.google.com [IPv6:2607:f8b0:4864:20::b33]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2gPM41YHz4SCp for ; Sat, 20 Mar 2021 12:41:43 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb33.google.com with SMTP id h196so1229160ybg.1 for ; Sat, 20 Mar 2021 05:41:43 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=kcIxSqn1RM++5moKHreVTqNLf2E9fb7Je2g28eDapHA=; b=DliMtXfop2/G7eMpXlzlozvfb6l+g5noRXyX1Lm5HN8t3BKwqRmUIKLMxKQRgV6fUt Bmx46qT72cEdaBxT86VqjgV9DhH8FrX+awajmnTENuje2PNUiM91GqY83AyesHSyyQZL b48GlPUtOjUplg1cahMzdXGi4iqGnodU9QarR3wKD7u2rxpev1ujIJGKuMiqNgGxxIYX P0LXHRa6F4xViJdbonrtG/+CmtNNDi4h4tT76XLuYFpzOEmQPlOsEFv6jYzDBs6qyGu0 UK3e9LvhN0Tf/HIy75p350m7/yZszjiyFHmo/3gKK6IKvDNAeMvBYULYOGE9h8/HxpHD gSKg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=kcIxSqn1RM++5moKHreVTqNLf2E9fb7Je2g28eDapHA=; b=muAW7+Ri0hahyPH8h00RpeCfqAYuQejKQu5959jVPaArBY2uHQpl1OXd9OlbA0t+Uy lvh8occcUZwPIYuIbBG5ZtVMJ/Y8gwvLxP1jYPDhR5tS9ASqTSgtQBi7QP1u1+/ZzkpL k+nGZ4JZuy/zpDsPHNrvS6YSj1NlbByL0Dy5knyIak5b7z2NEh4NmpIX9NjKblMDhzO8 41kEvHbK6bdtIUPyDMY0lrroU2BhDqoicZ74joaTld2q8n/dpcOZ1HK9sdOMQeM9VQ3W O5ZVxVwuc4a1JusRxos3TYSF4aqkQpo5FgQQ340KQhDTtuK+zZ/Q2/gjFOfshSLLr1rc SxKQ== X-Gm-Message-State: AOAM533lNMvTQek9PT4MFz5yxWgYGXE0fa2B6OOBZw5+KHxOTr3S7Ufe py+MXyNzlMRyhH3O/kckVff1gGAQ1zasVWdCfjKIZKxWo9Q= X-Google-Smtp-Source: ABdhPJzzQraN9Kr/7RKkJrBsWK70QVLTfCqYMCeThI4F1Ik1L0meQw3wbhAfTshzPcBbYbvEtvI9FeOCQPNFu4Kxk0k= X-Received: by 2002:a25:5051:: with SMTP id e78mr12637914ybb.386.1616244102181; Sat, 20 Mar 2021 05:41:42 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: <20210320063427.000040f5@seibercom.net> From: Aryeh Friedman Date: Sat, 20 Mar 2021 08:41:31 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2gPM41YHz4SCp X-Spamd-Bar: ---- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=DliMtXfo; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b33 as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b33:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b33:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b33:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 12:41:44 -0000 On Sat, Mar 20, 2021 at 6:35 AM Jerry wrote: > What I cannot understand is that FreeBSD knows it has a problem, one > not shared by any other OS as far as I have been able to ascertain, > and I have done a lot of research, and they refuse to fix it. The > problem did not exist before version 12.x, so it is not like they never > were able to get it right. > The bottom line for many people on the list is this must be the tenth or twentif time you have complained about this same exact bug across multiple threads and have absolutely refused to lift a finger to fix it except complain about how bad FreeBSD is compared to Linux. If Linux is so much better, STFU and just switch or get off your lazy ass and actually try to lend a hand. Either way the reason many people are being so rude to you is at best you refuse to put in any of the work required to fix it and at worst you are purposely being a troll by even making yet another thread/post about the same bug you have rehashed many many times before on this list so that you have a whipping boy to show your hatred towards FreeBSD with. -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 12:45:27 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5AEF357F825 for ; Sat, 20 Mar 2021 12:45:27 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lf1-x134.google.com (mail-lf1-x134.google.com [IPv6:2a00:1450:4864:20::134]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2gTf4lx9z4ShY for ; Sat, 20 Mar 2021 12:45:26 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lf1-x134.google.com with SMTP id b83so14187960lfd.11 for ; Sat, 20 Mar 2021 05:45:26 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=vOuaLAaSeZheXztdZ/CZ2yWL5i6WF+jUBU7Z7MKKryM=; b=pliAxbNV5nohYKGvZZz4kiE8teou3uF6AA67cxdDSkXPrXcw/qNTw/WSiiaCBZ+hJH nrfGhKBa7TMY5d3GiqifGYT120kW7mczvyLwXXlsSmxzw3rTmhYFqWJTrmwCybNOw8ti h+iwpk7Ny8jjLgjlrtqwcQ3hhEL2JMUHI95eqSPVj5kG7hM3rBxKKfwvAX4mLlDQ6xqV 07aDqgQc+JDgVK7lMCY6txqz6KVHRJfmzOODCWYnrP5z5PlfV7ZoHuz+oCvuylxw5q/+ x6I4PDwhSOWi3zvvV6TG6dQXJUMXnXGqflpfFQ5PFPZr+Xk+P1lrNxmvN/rnoHNp/o6c EsWg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=vOuaLAaSeZheXztdZ/CZ2yWL5i6WF+jUBU7Z7MKKryM=; b=FSOdBdjp/AJcOco2h0KvXdWboRGtVywB4BROTsV/nwWWG18pfgkNK6xM3hlVUi6+y3 N2i48f6RMk59BuWCNiANCX1lsWpF6EICOPAndpcza9fy9To8N0p11cvzK1LV4E4d0cuz wCqoHH397wtlXeWJiU4aBTLclY7KtmIFyP9Qv6La3AM+mpgpm7TDv+Dt1J+7Y9CQqZhM hA8uy+pHApqwrOag6aoDEdNR7DmIeJXyASh+UB3qXbs6JZ/G4Wu1Z0Tsqa0VL7aOWFLU VJt7C0d6gY6z9vXPDpTG+WotQ15rvNvW4LxkJMGKAqYx+9KNvz0Nv8gVpnlSxau90MJj S/xw== X-Gm-Message-State: AOAM532xF5GBDvdwhr1RDy6cMvOkQiX0D9acDjbRjZ5WcsAkpKu0VPCQ xxt57sqv63N4D6ZxMbdBoD6cTreuaGs8Fbyd1Xdxfi3l2ZTO X-Google-Smtp-Source: ABdhPJyI6QTWJf5CJoTZR8iUQznIXUMKF25ddc2WsWk83pm/HQOx4Zk0c3DtDMIl6aRNaHgaWvq1ytKtK0Dspktu7e8= X-Received: by 2002:a05:6512:693:: with SMTP id t19mr1389832lfe.205.1616244324830; Sat, 20 Mar 2021 05:45:24 -0700 (PDT) MIME-Version: 1.0 References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> <20210320083808.00000cb1@seibercom.net> In-Reply-To: <20210320083808.00000cb1@seibercom.net> From: Mohammad Noureldin Date: Sat, 20 Mar 2021 13:45:13 +0100 Message-ID: Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F2gTf4lx9z4ShY X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=pliAxbNV; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::134 as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; ARC_NA(0.00)[]; R_SPF_FAIL(1.00)[-all]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::134:from:127.0.2.255]; DMARC_NA(0.00)[thelightbird.com]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::134:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::134:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 12:45:27 -0000 Hi Jerry, On Sat, Mar 20, 2021, 13:38 Jerry wrote: > On Sat, 20 Mar 2021 12:30:15 +0100, Mohammad Noureldin stated: > >Hi, > > > >On Sat, Mar 20, 2021, 10:00 @lbutlr wrote: > > > >> On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: > >> > To anyone who has read the bug report, this is clearly a serious > >> regression issue on certain USB (probably 3) host controller > >> hardware. > >> > >> I've read the bug report and all the replies and it is clearly a > >> flaw in the controller. It is providing an invalid ID. > >> > > > >If that's the case, I am curious how other Unix-Like Operating Systems > >manage to work on the same HW ? > > There are a number of possibilities. > > 1) They have better programmers that can handle abnormalities. > > 2) They realize that there are always going to be flaws in software > and hardware and are smart enough to work around it. > > This is of course assuming that the actual problem is a defective > controller that every other OS can handle correctly. If, and this is > assuming that is correct, then why doesn't FreeBSD just code what the > defective controller is allegedly sending and accept it? > > The simple fact the the code worked in versions prior to 12.x makes > this excuse that the controlled is defective highly suspect. > Hi Jerry, I do understand your frustrations, but if you allow me, it is not a reason to attack the FreeBSD community and it's developers. Let's please focus on facts and possible solutions. As stated in this thread (and another one), did you have time to try any of the proposed tests ? Looking forward to your reply > -- > Jerry > > > From owner-freebsd-questions@freebsd.org Sat Mar 20 13:20:39 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E4B065A81BB for ; Sat, 20 Mar 2021 13:20:39 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qt1-x82e.google.com (mail-qt1-x82e.google.com [IPv6:2607:f8b0:4864:20::82e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2hGG3q5vz4VFY for ; Sat, 20 Mar 2021 13:20:38 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qt1-x82e.google.com with SMTP id c6so9002145qtc.1 for ; Sat, 20 Mar 2021 06:20:38 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=7UoCjoY5JH/CtulziwXNT2hLnodMKQD702hMVRom4e4=; b=IXtnIzDQxDsAyo61itetz5tjHfGkA8A2OgUZ++njrD8lBmZILjHkxrswqccE6unZ+4 dxofAFqJpLNUC+3zeVyq/fk1XfqwGGf1zyWI6Maos9QKtGbMPhouGZZCDDEV0l4Xb17d Sw9sQ7uJ0rZrfjRT9tgM05c5uT6Rjr5TGDUcM= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=7UoCjoY5JH/CtulziwXNT2hLnodMKQD702hMVRom4e4=; b=NjQ8HxhOBXkzbvwAC17Xs7E5xZ0UFw19PS7y3cH1dCzusV/rPBz2Not+DaooYhYnIk s4agB+hjs1c4Vy8VbWNBPrCWtZoCnaPpPyUQIhnhLIqy1+Gzry48VQDGNnOrRN3KOqMb tNFgavJi48YLoW4/mh6AFMniQr6qWlzwCOt4MJsEtabjU4M7Np0bF47iO3VRJ9k3bOlx ip101ZudJE2o2L75GaiWyrs8bL6nChQ5lex4U1ujlT3R4P03fvqmhFbIsZ4SG4Fhayjv /r4xzoDnLU7fIA3aVFqJwx3jRyA1aetD+9wMp5Mq8oQIQ1kBXXMmkkEtU2PuEOR8UbxF 5znA== X-Gm-Message-State: AOAM532oqLn/hEJyHfu3WJ3kt4tT+ZIhQa2Yub7EXtpRjIGAJ3rdjTio AL9NoB/iJsr674vm5vhPWBX78FTwPZkF2w== X-Google-Smtp-Source: ABdhPJwdN4YDJWqgtX5Q0yIbnNAUOWyO42YMMjpLx8I1rQVk84jwrvctMNLys5J9sK2CAMEEyjTsTQ== X-Received: by 2002:ac8:4882:: with SMTP id i2mr2866580qtq.59.1616246437181; Sat, 20 Mar 2021 06:20:37 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id t2sm5785443qtd.13.2021.03.20.06.20.35 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 20 Mar 2021 06:20:36 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2hGC1vl4z1yb6 for ; Sat, 20 Mar 2021 09:20:35 -0400 (EDT) Date: Sat, 20 Mar 2021 09:20:23 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210320092023.000015c8@seibercom.net> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/EdzM+=Z=.oGiBGWL+AAtDSx"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2hGG3q5vz4VFY X-Spamd-Bar: + Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=IXtnIzDQ; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::82e as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [1.41 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::82e:from]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.99)[-0.993]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::82e:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::82e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:20:40 -0000 --Sig_/EdzM+=Z=.oGiBGWL+AAtDSx Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Sat, 20 Mar 2021 08:41:31 -0400, Aryeh Friedman stated: >On Sat, Mar 20, 2021 at 6:35 AM Jerry wrote: > >> What I cannot understand is that FreeBSD knows it has a problem, one >> not shared by any other OS as far as I have been able to ascertain, >> and I have done a lot of research, and they refuse to fix it. The >> problem did not exist before version 12.x, so it is not like they >> never were able to get it right. >> =20 > >The bottom line for many people on the list is this must be the tenth >or twentif time you have complained about this same exact bug across >multiple threads and have absolutely refused to lift a finger to fix >it except complain about how bad FreeBSD is compared to Linux. If >Linux is so much better, STFU and just switch or get off your lazy ass >and actually try to lend a hand. Either way the reason many people >are being so rude to you is at best you refuse to put in any of the >work required to fix it and at worst you are purposely being a troll >by even making yet another thread/post about the same bug you have >rehashed many many times before on this list so that you have a >whipping boy to show your hatred towards FreeBSD with. Actually, you are the only asshole that seems to have a bug up his ass. Maybe if you took the swastika out of your ass, you wouldn't be such an annoying kibitzer. --=20 Jerry --Sig_/EdzM+=Z=.oGiBGWL+AAtDSx Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBV9pwACgkQgHBP8gv9 FXdMtwwApfa8gpE7bMuLWmOH6nWv/d5EqQiHfDFEKA/SpcajxxsHukjZx7f63F5+ dlhTqD6TKeYOwK7cvIPq9K2hy5IYW/fG1QC8pwtmk2RyoW/PJjNwVpReLKRTttGM 9PgayN1M3F6Ay7BnH2oykFFAz5sFw0hBkZMp6jd0zJYWduBy2iu44JSDOvCa9Cgi S6bdUgS0dHhl9UqlPW64FpvBbV5NGqu1M7wHnpje74886U6R0YxvSQ83eEQj/8YR Rq4XLTV/97bzQjijhl+E+4mvIVLqyDc6xWsVHr6Y2RtbqIUiaV/RTP7qAJttus2O lsivQruwyE1s7Mj1jaMuWeKPQt2CN/a6j04DU4OROoHwi+zy/FkiPKmGIH/KiVf8 HpR/uuh62U/gVQrngC+fBlVUGeEPTBc72rcMFrBGzJsfaBiBrzKYpWG8AlbVtwii vLuQejM3aHVjt6ZXhRUDywsJLYLv5lmFwqRZZchMwcwdDjlGgyC5yIdLQuBTNMid A27erExG =5sej -----END PGP SIGNATURE----- --Sig_/EdzM+=Z=.oGiBGWL+AAtDSx-- From owner-freebsd-questions@freebsd.org Sat Mar 20 13:20:48 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A627F5A8059 for ; Sat, 20 Mar 2021 13:20:48 +0000 (UTC) (envelope-from tomek@cedro.info) Received: from mail-ed1-x52c.google.com (mail-ed1-x52c.google.com [IPv6:2a00:1450:4864:20::52c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2hGR6W03z4Tqq for ; Sat, 20 Mar 2021 13:20:47 +0000 (UTC) (envelope-from tomek@cedro.info) Received: by mail-ed1-x52c.google.com with SMTP id e7so13956663edu.10 for ; Sat, 20 Mar 2021 06:20:47 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cedro.info; s=google; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=P2RzPFPie9BDZ5ZV3ZfjC0GpzHRsyhqYgY+wLieVHms=; b=TX0+Xozd/rUey3WSQBRTxNfraKwvV/XeyGlJjhBfA5WNYkfXa7bk6EtWXNuWXgWUX5 bWGa4FyA8bnY1wGKWdf+7ApQN+j84iy0InK5qaMG5rfI1dYurDUfqLaunN6qeiyDM9it hagjkTKAeoP65DcZxy9k+Sgikfk9BUkbyD0dlZro47YjqFJ/BIVMbnmbqpheb0At7upy DxIITbSjk+wiheU4a+ihTTxA3C2+dlmmSWOTWG6A51D0cp1UtVj/5SLgp1q8PNmHlm8Y DtwFdL4xSNPikq6D9NuqdCTfmWMv8ViM7mRoEeDYBEDPXy+i+Pw6NgN22/uOYIMvuh+s u3cQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=P2RzPFPie9BDZ5ZV3ZfjC0GpzHRsyhqYgY+wLieVHms=; b=SC2EppEm7AIslnMP1GWVGjAVq2LVDzwLS+BXhimwWEymxD623AGX0bCX0a9RpsLKjX 619zKUW2SfAlFdtvSGvqdDdM+0tLf07i+UacJcwcXj1gZ7KulHg30qZvFwUGoSoQoO+r LIvdi8YheOO9YWu2OplCsN/etTStTczhdVv1Nq61aZaEPFwg44D5KHgHiC78Iq0D3U0t POYm7nQ9PKzuhi2KDenoooWSNhA/dQdKuifcXju6Xh6OQsWMmg9eHEgSo5Yy/mpxLSrG pZKE6HQ0MNEsF+45Xe2QsA2qBtkdVowzS6Ha/l8lpRVRAtylncO2W8QA9dsFe+U/sJoq 9LDg== X-Gm-Message-State: AOAM531ua0ij2SUYyGJlA9vk/IFRwd5czmuxfdxGbczCl5Tkx0moIcvW DPomRnkESeJcl/LkiEb+3XQA5idD6sS+xW5eZl7dEbC1Qi4= X-Google-Smtp-Source: ABdhPJz5L5FuqwtXSjj1Al4cjrpdS1ruIsarEZfkJDxoU+euva5wzhlOuBX+DyWkNikVVQPY85kbIXn3X99hwNpQqlc= X-Received: by 2002:aa7:d347:: with SMTP id m7mr15176553edr.260.1616246446224; Sat, 20 Mar 2021 06:20:46 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: <20210320063427.000040f5@seibercom.net> From: Tomasz CEDRO Date: Sat, 20 Mar 2021 14:20:33 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: FreeBSD Questions Mailing List X-Rspamd-Queue-Id: 4F2hGR6W03z4Tqq X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=cedro.info header.s=google header.b=TX0+Xozd; dmarc=none; spf=none (mx1.freebsd.org: domain of tomek@cedro.info has no SPF policy when checking 2a00:1450:4864:20::52c) smtp.mailfrom=tomek@cedro.info X-Spamd-Result: default: False [-3.30 / 15.00]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[cedro.info:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[cedro.info]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::52c:from:127.0.2.255]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[cedro.info:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::52c:from]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::52c:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:20:48 -0000 On Sat, Mar 20, 2021, 11:35 Jerry wrote: > I never said I could not compile a new kernel, I said I could not > install the OS. Correct me if I am wrong, but doesn't the installation > of the OS precede the creation of a new kernel? Furthermore, the > screen just rolls away filling up with the error message ad infinitum. > > By the way, as I understand it, creating a custom kernel nullifies the > use of "freebsd update". Wow, things just keep getting better & better. > > What I cannot understand is that FreeBSD knows it has a problem, one > not shared by any other OS as far as I have been able to ascertain, > and I have done a lot of research, and they refuse to fix it. The > problem did not exist before version 12.x, so it is not like they never > were able to get it right. > > -- > Jerry Hey Jerry :-) Please just rebuild and install new kernel, at least to see if that fixes your problem :-) This is a standard procedure when you find a problem, it seems identified, workaround seems available, a least try if that works for you :-) I also use custom compliled kernel to get my Touchpad working on a non-standard configuration. Until fix is ready and does not break configuration for others I need to work that way because this is a problem with _my_setup_. It seems that your problem seems similar. Look on the other hand you are helping others not to have this problem in future.. developers are going through this way everyday and we usually have broken or incomplete setup just to help others not to have such problems. With new hardware showing up faster and faster, using their own standards, or enforcing linux like solutions thing are and will get even worse. This is not really the issue with FreeBSD, it only gets impacted by this "bleeding edge" approach around :-) Because of drivers I have chosen Linux over FreeBSD around 1999 on my first desktop PC. Then when Linux kernel api started changing with every minor release, and when the stable USB stack was created by HPS, I have abandoned Linux for good and FreeBSD is my ultimate OS of the choice. I even prefer FreeBSD over OSX/macOS. The problem of quickly changing things and breaking compatibility is the Linux by design. You will find many more problems like this over there. We are experiencing this kind of issues here because world has changed that way unfortunately. I can see three effective solutions here: 1. Use Alt+F2 to switch away from terminal flood and recompile your kernel. 2. Maybe XHCI/USB3.0 controller can/could be disabled at runtime in bootloader so it wont be active and the workaround can be ready with no kernel recompile. 3. Provide a hardware and development fee for a person that is willing to fix the problem for you. This will cost time and money but there is a chance that you will get the fix one day just using freebsd-update :-) Free Softwate is free to use, but is really cost developers life time and all other technical resources and experiences. Just imagine how many problems of this kind developers have everyday. Most of them work for free in their free time, but they also need to pay the bills. Best regards :-) Tomek -- CeDeROM, SQ7MHZ, http://www.tomek.cedro.info From owner-freebsd-questions@freebsd.org Sat Mar 20 13:33:23 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 2E7CD5A8943 for ; Sat, 20 Mar 2021 13:33:23 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qk1-x732.google.com (mail-qk1-x732.google.com [IPv6:2607:f8b0:4864:20::732]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2hXy1nv0z4VxN for ; Sat, 20 Mar 2021 13:33:21 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qk1-x732.google.com with SMTP id x14so5866929qki.10 for ; Sat, 20 Mar 2021 06:33:21 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=lPrdLGLTpvWSdO+DBLDw055h085ZVVvecx6MXRjjwBI=; b=Gy8OHGEMRRgvFvlm8Jbd/cV6V/ap9ViSgW/1MOm79rHLTr0R8xwJHIyIJlbVXvn03u KmbR06CmmEfzBMnj8t55hvNSLbStM81BzP6jvBRXNAHFAZkMB6/9UDf5OdIISI37NCWF YEoUxCYyTkSJJJ+08V/V7A3nNSRbi6R9I36Ww= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=lPrdLGLTpvWSdO+DBLDw055h085ZVVvecx6MXRjjwBI=; b=SZFWSdNyU8jUuBHsPmKknft0dgSky2ntUDimB4ptH/ZPVTE9rnm9PF//FD++XGpaTi e9l0dPhuzPX71OKRZwg83S2P3HAZvxY3kYOVR7sMLtiNIH18DMIx2uZqY26G8eYhEXhR mz1xUbdHwX/6WM2Xakau+Nx7XQ1ZoiAAxQqTLBlN7W2ooKxZUjWqxF1/yiFb/ugfg6Fz jAz72uRcQ1ueKg2ltZxCLUjTgPYsOGHMIhYPbhI7n5u32/gRpyhgHGXKmof8gBpEDkGN q4oQ5+XQyZ0zWqIPYuGNeUBfJvINoazV+lesN0lUfLgTaWBrJnvK2ZF3z4GKAL58PXb/ eoSw== X-Gm-Message-State: AOAM531nfwfVfpRxEIMydmhVnKv79m/p8bOgIDnjFgA2VnWedBZAFoEa M6TXkEkVP4yIRcCDt8TUwi4NsRscl6nDPg== X-Google-Smtp-Source: ABdhPJzt9MZhFq5fh7I7Sn5z6S3fuSB+GdkUeR63TK0HiuzRQjfELDD7fwGDzSYyJVVFu43yNP6jCA== X-Received: by 2002:a37:a404:: with SMTP id n4mr2905383qke.439.1616247200708; Sat, 20 Mar 2021 06:33:20 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id i6sm6731929qkk.31.2021.03.20.06.33.19 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 20 Mar 2021 06:33:19 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2hXt59Zcz1ybY for ; Sat, 20 Mar 2021 09:33:18 -0400 (EDT) Date: Sat, 20 Mar 2021 09:33:04 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD Message-ID: <20210320093304.00001e37@seibercom.net> In-Reply-To: References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> <20210320083808.00000cb1@seibercom.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/12d7pw2.i.gZ+tsbkt0Dnle"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2hXy1nv0z4VxN X-Spamd-Bar: ++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=Gy8OHGEM; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::732 as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [2.11 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-0.51)[-0.508]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::732:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.79)[-0.786]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::732:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::732:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:33:23 -0000 --Sig_/12d7pw2.i.gZ+tsbkt0Dnle Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Sat, 20 Mar 2021 13:45:13 +0100, Mohammad Noureldin stated: >Hi Jerry, > >On Sat, Mar 20, 2021, 13:38 Jerry wrote: > >> On Sat, 20 Mar 2021 12:30:15 +0100, Mohammad Noureldin stated: =20 >> >Hi, >> > >> >On Sat, Mar 20, 2021, 10:00 @lbutlr wrote: >> > =20 >> >> On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: =20 >> >> > To anyone who has read the bug report, this is clearly a >> >> > serious =20 >> >> regression issue on certain USB (probably 3) host controller >> >> hardware. >> >> >> >> I've read the bug report and all the replies and it is clearly a >> >> flaw in the controller. It is providing an invalid ID. >> >> =20 >> > >> >If that's the case, I am curious how other Unix-Like Operating >> >Systems manage to work on the same HW ? =20 >> >> There are a number of possibilities. >> >> 1) They have better programmers that can handle abnormalities. >> >> 2) They realize that there are always going to be flaws in software >> and hardware and are smart enough to work around it. >> >> This is of course assuming that the actual problem is a defective >> controller that every other OS can handle correctly. If, and this is >> assuming that is correct, then why doesn't FreeBSD just code what the >> defective controller is allegedly sending and accept it? >> >> The simple fact the the code worked in versions prior to 12.x makes >> this excuse that the controlled is defective highly suspect. >> =20 > >Hi Jerry, > >I do understand your frustrations, but if you allow me, it is not a >reason to attack the FreeBSD community and it's developers. Let's >please focus on facts and possible solutions. > >As stated in this thread (and another one), did you have time to try >any of the proposed tests ? > >Looking forward to your reply I CANNOT install it, so I am unsure of how to build a custom kernel. Then, assuming I could build a custom kernel, I would not be able to use the "freebsd update" utility. So, to put it in the vernacular, "I am fucked if I do, and fucked if I don't". Not a great choice of options. I am investigating it though. I got some help from a friend on the Microsoft forum who told me he was almost positive I could install Windows 10 PRO, then Hyper V and run FreeBSD 12.x or 13.x from there. He is polling other users to see if they have had success with the same equipment I process. The one very apparent advantage is that I would be able to take advantage of Intel's Optane Memory and Storage. As far as I can tell, FreeBSD does not support that architecture. In computing, the robustness principle is a design guideline for software: Be conservative in what you do, be liberal in what you accept from others (often reworded as "Be conservative in what you send, be liberal in what you accept"). The principle is also known as Postel's law, after Jon Postel, who wrote in an early specification of TCP: TCP implementations should follow a general principle of robustness: be conservative in what you do, be liberal in what you accept from others. In other words, programs that send messages to other machines (or to other programs on the same machine) should conform completely to the specifications, but programs that receive messages should accept non-conformant input as long as the meaning is clear. Among programmers, to produce compatible functions, the principle is also known in the form be contravariant in the input type and covariant in the output type. While this is not a TCP issue directly, the same general principal is still relevant. --=20 Jerry --Sig_/12d7pw2.i.gZ+tsbkt0Dnle Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBV+ZYACgkQgHBP8gv9 FXfxWgv/SyKV2YqxHtPItbixLXrOmgTz2xvmsFxSzd6Sm8yjnl3pVKRdg2oNYSku ykCC+YyxfNjr5fAyZcrBRn0yQs9WTxHs6M7eWDHCo8Ja+BrSbcXiJpcs1ilKzgMk tNsMlLEDWMwpRlmwNTeWfeNi6b46OQ9mCa97piv5krOPg47tQIK3xglYX851/9gT hgkrU9H4e6JruBLusJRo3O5E3tNx31IcBmd/vhHaVZ03BJ7xmNO/IEyEGJ9uihgQ ZHEGH7Zd3d9uetyZY1VVNtCgqo503paz+ah0E9PKUVZGI+g6wyvEq1BRGSUKEM4z ohHc5uAeke5ulqP1ZzfXcDlIDd9ESn3cfEo0aZSQLDDdvz1fcYjY3WEu5y1mXQ/H viVkx400wJ+Os6rgpQ8rnZGnl6xXmtTaW2lLTsc03lwK2QKkNXozm6G+kW9SmpcQ IQwODuQE6EVV+V477RAuyHMgZFK8v2kSWbDrXIqOPH/4unTiMedWqIVCDZ8820CF MoNi8diJ =ODFm -----END PGP SIGNATURE----- --Sig_/12d7pw2.i.gZ+tsbkt0Dnle-- From owner-freebsd-questions@freebsd.org Sat Mar 20 13:49:14 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E85605A8C72 for ; Sat, 20 Mar 2021 13:49:14 +0000 (UTC) (envelope-from 4250.82.1d4ce00039b1905.a6c741cd5735f9d22c2e8a0688315e85@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2hvF5mqCz4Wbc for ; Sat, 20 Mar 2021 13:49:13 +0000 (UTC) (envelope-from 4250.82.1d4ce00039b1905.a6c741cd5735f9d22c2e8a0688315e85@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616248154; x=1618840154; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:cc:to:from:date:x-thread-info; bh=pZFTJaWS4rJ8O8zfIPaliJlN1TCaFI5HTx5SWnBPGrg=; b=EfY0mg+OssfsGU9RsvhXC0KTXzGJwfCEs+SIQffQhIsgu2tPMilIr1M1A7DoNxDzW/ixSPCDCiaRdgCS/WtwBBk90HeJ9+shauqgiROs2lOY/SeXN0Qi/eI8Now6EcKp+DGnjzOV4/X/yOcBrqgN697bxC2UyK2wAd1jur5lRFE= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDM5YjE5MDUuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r1.us-east-2.aws.in.socketlabs.com (r1.us-east-2.aws.in.socketlabs.com [142.0.189.1]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sat, 20 Mar 2021 09:49:11 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r1.us-east-2.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sat, 20 Mar 2021 09:49:03 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lNbyQ-000PXC-8b; Sat, 20 Mar 2021 13:49:02 +0000 Date: Sat, 20 Mar 2021 13:49:02 +0000 From: Steve O'Hara-Smith To: Tomasz CEDRO Cc: FreeBSD Questions Mailing List Subject: Re: OS to replace FreeBSD Message-Id: <20210320134902.1d0213791f9c6d90a8f259e8@sohara.org> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2hvF5mqCz4Wbc X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=EfY0mg+O; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce00039b1905.a6c741cd5735f9d22c2e8a0688315e85@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce00039b1905.a6c741cd5735f9d22c2e8a0688315e85@email-od.com X-Spamd-Result: default: False [-2.70 / 15.00]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; MIME_GOOD(-0.10)[text/plain]; DMARC_NA(0.00)[sohara.org]; NEURAL_HAM_LONG(-1.00)[-1.000]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[email-od.com:+]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce00039b1905.a6c741cd5735f9d22c2e8a0688315e85@email-od.com]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce00039b1905.a6c741cd5735f9d22c2e8a0688315e85@email-od.com]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:49:15 -0000 On Sat, 20 Mar 2021 14:20:33 +0100 Tomasz CEDRO wrote: > Free Softwate is free to use, but is really cost developers life time and > all other technical resources and experiences. Just imagine how many > problems of this kind developers have everyday. Most of them work for free > in their free time, but they also need to pay the bills. To amplify this it has been three years since anyone other than Hans Petter Selasky committed to xhci.c, he could probably do with some help keeping up with the chaos that is USB hardware. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Sat Mar 20 13:55:15 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 163625A8E19 for ; Sat, 20 Mar 2021 13:55:15 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lf1-x131.google.com (mail-lf1-x131.google.com [IPv6:2a00:1450:4864:20::131]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2j2B2Vgyz4X8t for ; Sat, 20 Mar 2021 13:55:14 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lf1-x131.google.com with SMTP id b14so1119365lfv.8 for ; Sat, 20 Mar 2021 06:55:13 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=drfd8+hG4K3ixr0TFIRKhxzfuPfY4cq2MFwzkXcqzQs=; b=JRcrtiOgnY8X4BCLtzOfiHMvKNUafa7RdnvhwKFI42gvOl2LTrlowqTCIBj9itqoz7 CJU2IwcsI4Ga4s1Px3Gv2hH3zbT/xO/SJznbsm+/h+pRcuDjKfZKOJP61nBcidWPHwUW vcj2f0Oz9F4dOOOxwQON0pnCOt5zVSOn5X0pcmxPBPeDrjqPvWM4EEzR1YVj+hwza3N+ weFEzvPuX0fhT+JZAw/O4Dovzgkl7C474lEmovAFpYx5SclGw/uHRbd22tE+H2h6xYhc KQ14IeBab0ZVwpqNlZxTLU18TkmPpoW+P5EH5xrLdQyuJ7xa92T34Hbkrtzs04x6Idd3 7ttQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=drfd8+hG4K3ixr0TFIRKhxzfuPfY4cq2MFwzkXcqzQs=; b=ofXCH9x+J7WXx6MBF68Z1SCtxi8cdLpcZ8UmRhJuTxQyTVEMY9LIjIM9q94iELCXNm iVlSm9qgAz3fh4DcFQZy4mCEPvzHGdhfb8T6QcA1WzoBri5B4pmyXru7stSUjK72QqPE FIwdID551w/uSbzBD0eyZ+Pb9qG+237xSXK6eCOaqEtOw8f2LjCfokEte0xN4vnB+uLU FLwd9/Jtjlek9OgrIhvyL//ho5j4eFyMiDZ1eHXpDt5Oa0G6sestDwL3xwVGHAU/DLtm xLN3x9rpgs5QXIUGePjNJmmMOsDUXJmqiLL+inhfQNeF+YDiQvt63Oj1Ri78SScGpHIb Pzjw== X-Gm-Message-State: AOAM533Bj32MOLul1wsXA7Mj/ket/IfMjC4FsEtYRHfUrD9EDWwcQr35 vvwMczWZJhRC6IQ/bYWRj24w+X4fMF0Dt98V5OtOQ02VJWmZ X-Google-Smtp-Source: ABdhPJwpnx0o76O+0JXLfDiliQIIstj52UvpAnbb6BHNbqORdB6Iy1ytinF78/IDBZKCH9/D71lPKhQwFqU7LBBYY7o= X-Received: by 2002:a05:6512:219:: with SMTP id a25mr1326676lfo.222.1616248512587; Sat, 20 Mar 2021 06:55:12 -0700 (PDT) MIME-Version: 1.0 References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> <20210320083808.00000cb1@seibercom.net> <20210320093304.00001e37@seibercom.net> In-Reply-To: <20210320093304.00001e37@seibercom.net> From: Mohammad Noureldin Date: Sat, 20 Mar 2021 14:55:01 +0100 Message-ID: Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD To: freebsd-questions@freebsd.org X-Rspamd-Queue-Id: 4F2j2B2Vgyz4X8t X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=JRcrtiOg; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::131 as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; ARC_NA(0.00)[]; R_SPF_FAIL(1.00)[-all]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::131:from:127.0.2.255]; DMARC_NA(0.00)[thelightbird.com]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::131:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::131:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:55:15 -0000 Hi Jerry, I do agree with others not to talk about the same problem on more than one thread. This is not helping you or anyone else. As for your reply, I was not talking about installing FreeBSD directly, I was talking about one of the proposed ways to test, by installing FreeBSD in a VM to see if you would get the same issues. IIUC, this can help more in understanding and solving the problem. On Sat, Mar 20, 2021, 14:33 Jerry wrote: > On Sat, 20 Mar 2021 13:45:13 +0100, Mohammad Noureldin stated: > >Hi Jerry, > > > >On Sat, Mar 20, 2021, 13:38 Jerry wrote: > > > >> On Sat, 20 Mar 2021 12:30:15 +0100, Mohammad Noureldin stated: > >> >Hi, > >> > > >> >On Sat, Mar 20, 2021, 10:00 @lbutlr wrote: > >> > > >> >> On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: > >> >> > To anyone who has read the bug report, this is clearly a > >> >> > serious > >> >> regression issue on certain USB (probably 3) host controller > >> >> hardware. > >> >> > >> >> I've read the bug report and all the replies and it is clearly a > >> >> flaw in the controller. It is providing an invalid ID. > >> >> > >> > > >> >If that's the case, I am curious how other Unix-Like Operating > >> >Systems manage to work on the same HW ? > >> > >> There are a number of possibilities. > >> > >> 1) They have better programmers that can handle abnormalities. > >> > >> 2) They realize that there are always going to be flaws in software > >> and hardware and are smart enough to work around it. > >> > >> This is of course assuming that the actual problem is a defective > >> controller that every other OS can handle correctly. If, and this is > >> assuming that is correct, then why doesn't FreeBSD just code what the > >> defective controller is allegedly sending and accept it? > >> > >> The simple fact the the code worked in versions prior to 12.x makes > >> this excuse that the controlled is defective highly suspect. > >> > > > >Hi Jerry, > > > >I do understand your frustrations, but if you allow me, it is not a > >reason to attack the FreeBSD community and it's developers. Let's > >please focus on facts and possible solutions. > > > >As stated in this thread (and another one), did you have time to try > >any of the proposed tests ? > > > >Looking forward to your reply > > I CANNOT install it, so I am unsure of how to build a custom kernel. > Then, assuming I could build a custom kernel, I would not be able to > use the "freebsd update" utility. So, to put it in the vernacular, > "I am fucked if I do, and fucked if I don't". Not a great choice of > options. I am investigating it though. I got some help from a friend on > the Microsoft forum who told me he was almost positive I could install > Windows 10 PRO, then Hyper V and run FreeBSD 12.x or 13.x from there. > He is polling other users to see if they have had success with the same > equipment I process. The one very apparent advantage is that I would be > able to take advantage of Intel's Optane Memory and Storage. As far as > I can tell, FreeBSD does not support that architecture. > > In computing, the robustness principle is a design guideline for software: > > Be conservative in what you do, be liberal in what you accept from > others (often reworded as "Be conservative in what you send, be liberal > in what you accept"). The principle is also known as Postel's law, > after Jon Postel, who wrote in an early specification of TCP: > > TCP implementations should follow a general principle of robustness: be > conservative in what you do, be liberal in what you accept from others. > In other words, programs that send messages to other machines (or to > other programs on the same machine) should conform completely to the > specifications, but programs that receive messages should accept > non-conformant input as long as the meaning is clear. > > Among programmers, to produce compatible functions, the principle is > also known in the form be contravariant in the input type and covariant > in the output type. > > While this is not a TCP issue directly, the same general principal is > still relevant. > > -- > Jerry > > > From owner-freebsd-questions@freebsd.org Sat Mar 20 13:57:53 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id CCF365A9889 for ; Sat, 20 Mar 2021 13:57:53 +0000 (UTC) (envelope-from 4250.82.1d4ce00039b20e9.14cf9bcfaabae505be5000eb85a99328@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2j5F0yQCz4XSL for ; Sat, 20 Mar 2021 13:57:52 +0000 (UTC) (envelope-from 4250.82.1d4ce00039b20e9.14cf9bcfaabae505be5000eb85a99328@email-od.com) DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1616248673; x=1618840673; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info; bh=I+WBAYUVLE4D8tSyXUp4QG1pzuSso25XEYZPNTMk56s=; b=GLtAk/1WLEa8kIUY/GglwIpuytNYtPIk10NTdmxnyslNm9hBtjOii+wiKa+ZJjL6M/QSbvnQnYJWNd5ytD4KCKArxMThFwsGA1+zE5TANEj0DYL4fxOwduQg5iD20UF7MhI3yMhmJqsQMtQVZcZyVMvrhS2U63J4DZMURWi8UHs= X-Thread-Info: NDI1MC4xMi4xZDRjZTAwMDM5YjIwZTkuZnJlZWJzZC1xdWVzdGlvbnM9ZnJlZWJzZC5vcmc= Received: from r3.h.in.socketlabs.com (r3.h.in.socketlabs.com [142.0.180.13]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sat, 20 Mar 2021 09:57:42 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r3.h.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Sat, 20 Mar 2021 09:57:42 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.94 (FreeBSD)) (envelope-from ) id 1lNc6m-000PYZ-Qq for freebsd-questions@freebsd.org; Sat, 20 Mar 2021 13:57:40 +0000 Date: Sat, 20 Mar 2021 13:57:40 +0000 From: Steve O'Hara-Smith To: freebsd-questions@freebsd.org Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD Message-Id: <20210320135740.c10f4d671d34ce6590527eb6@sohara.org> In-Reply-To: <20210320093304.00001e37@seibercom.net> References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> <20210320083808.00000cb1@seibercom.net> <20210320093304.00001e37@seibercom.net> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd12.1) X-Clacks-Overhead: "GNU Terry Pratchett" Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Rspamd-Queue-Id: 4F2j5F0yQCz4XSL X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=GLtAk/1W; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d4ce00039b20e9.14cf9bcfaabae505be5000eb85a99328@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d4ce00039b20e9.14cf9bcfaabae505be5000eb85a99328@email-od.com X-Spamd-Result: default: False [-2.25 / 15.00]; ARC_NA(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[142.0.176.198:from]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20:c]; MV_CASE(0.50)[]; MIME_GOOD(-0.10)[text/plain]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[sohara.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[142.0.176.198:from:127.0.2.255]; RCVD_COUNT_THREE(0.00)[4]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DKIM_TRACE(0.00)[email-od.com:+]; NEURAL_HAM_SHORT(-0.55)[-0.548]; NEURAL_HAM_LONG(-1.00)[-1.000]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d4ce00039b20e9.14cf9bcfaabae505be5000eb85a99328@email-od.com]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d4ce00039b20e9.14cf9bcfaabae505be5000eb85a99328@email-od.com]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:57:53 -0000 On Sat, 20 Mar 2021 09:33:04 -0400 Jerry wrote: > I CANNOT install it, Perhaps I am misunderstanding the situation. AIUI the install completes it is just that the default console is spammed by error messages so you can't see the login prompt (it is actually possible to log in and work under these conditions but it is hideous to do). Fortunately there is a better option, there are several active virtual consoles available by hitting Alt-F simply switch to one of those, log in and proceed as normal. > so I am unsure of how to build a custom kernel. > Then, assuming I could build a custom kernel, I would not be able to > use the "freebsd update" utility. Of course you can use freebsd-update with a custom kernel, I do it all the time. It just adds the extra step of compiling your custom kernel before rebooting after the update. My usual sequence for this is: freebsd-update fetch freebsd-update install cd /usr/src make kernel reboot NB: make kernel works because I have kernconf set in /etc/make.conf to the name of my custom kernel config. > So, to put it in the vernacular, > "I am fucked if I do, and fucked if I don't". Nope, you just have to understand how to get yourself out of the hole. -- Steve O'Hara-Smith From owner-freebsd-questions@freebsd.org Sat Mar 20 13:59:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 35BB15A8E79 for ; Sat, 20 Mar 2021 13:59:06 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lj1-x235.google.com (mail-lj1-x235.google.com [IPv6:2a00:1450:4864:20::235]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2j6d2j5fz4XWZ for ; Sat, 20 Mar 2021 13:59:05 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lj1-x235.google.com with SMTP id y1so15381847ljm.10 for ; Sat, 20 Mar 2021 06:59:05 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=OuqJ9//Rt86P1Zf8aXdF73LveZ1IwebBNCdXqywyxXs=; b=wXeN7o8YzxSHDsuxkLfoUv3GpK3l4QufSsFk97oSQidE/2JZCgNXIu5jqGQVxqawXp K4oX1qhnO0dui6IEZEle8KsUUKvGRzdGA1hNjZYS2sPb0w4DfecylRmboIrukjSzOGMX s1sivbb0Fvo9/rdIPaeJ7MkP+GZ92juRZy78VlQFA3J5ApinnLk0Mbivdy2A5tK9OhF+ i7oeMLoGEUF3aUk6x3PYLIuMG3ssEwO1RIblh/qhKd8xU6mzmYng86JF5fg4haOG5zB5 mzD1Sz0BDMCG8UB1vfPONGnPRsfiCF0eEjbXA0P0ovfd4snbM9rISPnsXts/44rco1jB TBsw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=OuqJ9//Rt86P1Zf8aXdF73LveZ1IwebBNCdXqywyxXs=; b=J1X7e3CzeqGhNBu2W87ZkG1clwRCVK5IsRGi8unuEcivgXbO3DAIYI+A/zlz7vTPu0 Rm0Fx010NHrZORoiwI8oWYMMR/HLQgar0BsvS9ANUFmPR/UepWd0MUGb/OqaFIYgQ//q n8dxBj3kwilXehKP5qa2z/hvXxnr/Q3Sq2giQR6BnLMNvavxWZ8NVxADEnRLbvWYA6Tw B1giY9cgH2fuYoAuDDeWk6UVBmR+TFzu8XpcZJ0KbRpyPQAd/azGUjWzRc79KhEPwTRs XX2qSQlSJE509jNC6ihjoFu32QfxWuKKiVqPlTYFGDeofg9BKqZ4VI1p1C5dbEJbtDoh HzrQ== X-Gm-Message-State: AOAM533TJi1Vkciab12HWCt1c5/AMRbU441Q5TAIPJBcAnlHpzwxDNho 8I2VFUvadYN3HKZc6n7st/GWWNDhjHfxk9VS1PEm0O23afQ2 X-Google-Smtp-Source: ABdhPJxPUFDRz2t6YyOmfRwFxK6Ij+hBtbwxIHksBSfqM7ib/TPqxKXkcJjvWg9sBlN5iOKE5MaWARPAyQ1fXS75ZpM= X-Received: by 2002:a2e:b5b9:: with SMTP id f25mr3945049ljn.90.1616248742871; Sat, 20 Mar 2021 06:59:02 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: From: Mohammad Noureldin Date: Sat, 20 Mar 2021 14:58:51 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: FreeBSD Questions Mailing List X-Rspamd-Queue-Id: 4F2j6d2j5fz4XWZ X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=wXeN7o8Y; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::235 as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; ARC_NA(0.00)[]; R_SPF_FAIL(1.00)[-all:c]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; RCVD_TLS_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[thelightbird.com]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::235:from:127.0.2.255]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; NEURAL_HAM_SHORT(-1.00)[-0.998]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::235:from]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::235:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 13:59:06 -0000 Hi Tomasz, Well said! On Sat, Mar 20, 2021, 14:21 Tomasz CEDRO wrote: > On Sat, Mar 20, 2021, 11:35 Jerry wrote: > > > I never said I could not compile a new kernel, I said I could not > > install the OS. Correct me if I am wrong, but doesn't the installation > > of the OS precede the creation of a new kernel? Furthermore, the > > screen just rolls away filling up with the error message ad infinitum. > > > > By the way, as I understand it, creating a custom kernel nullifies the > > use of "freebsd update". Wow, things just keep getting better & better. > > > > What I cannot understand is that FreeBSD knows it has a problem, one > > not shared by any other OS as far as I have been able to ascertain, > > and I have done a lot of research, and they refuse to fix it. The > > problem did not exist before version 12.x, so it is not like they never > > were able to get it right. > > > > -- > > Jerry > > > > Hey Jerry :-) > > Please just rebuild and install new kernel, at least to see if that fixes > your problem :-) > > This is a standard procedure when you find a problem, it seems identified, > workaround seems available, a least try if that works for you :-) > > I also use custom compliled kernel to get my Touchpad working on a > non-standard configuration. Until fix is ready and does not break > configuration for others I need to work that way because this is a problem > with _my_setup_. It seems that your problem seems similar. > > Look on the other hand you are helping others not to have this problem in > future.. developers are going through this way everyday and we usually have > broken or incomplete setup just to help others not to have such problems. > With new hardware showing up faster and faster, using their own standards, > or enforcing linux like solutions thing are and will get even worse. This > is not really the issue with FreeBSD, it only gets impacted by this > "bleeding edge" approach around :-) > > Because of drivers I have chosen Linux over FreeBSD around 1999 on my first > desktop PC. Then when Linux kernel api started changing with every minor > release, and when the stable USB stack was created by HPS, I have abandoned > Linux for good and FreeBSD is my ultimate OS of the choice. I even prefer > FreeBSD over OSX/macOS. The problem of quickly changing things and breaking > compatibility is the Linux by design. You will find many more problems like > this over there. We are experiencing this kind of issues here because world > has changed that way unfortunately. > > I can see three effective solutions here: > 1. Use Alt+F2 to switch away from terminal flood and recompile your kernel. > 2. Maybe XHCI/USB3.0 controller can/could be disabled at runtime in > bootloader so it wont be active and the workaround can be ready with no > kernel recompile. > 3. Provide a hardware and development fee for a person that is willing to > fix the problem for you. This will cost time and money but there is a > chance that you will get the fix one day just using freebsd-update :-) > > Free Softwate is free to use, but is really cost developers life time and > all other technical resources and experiences. Just imagine how many > problems of this kind developers have everyday. Most of them work for free > in their free time, but they also need to pay the bills. > > Best regards :-) > Tomek > > -- > CeDeROM, SQ7MHZ, http://www.tomek.cedro.info > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > From owner-freebsd-questions@freebsd.org Sat Mar 20 14:06:12 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id BF5335A9C28 for ; Sat, 20 Mar 2021 14:06:12 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb32.google.com (mail-yb1-xb32.google.com [IPv6:2607:f8b0:4864:20::b32]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2jGq5yW2z4Y1B for ; Sat, 20 Mar 2021 14:06:11 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb32.google.com with SMTP id w8so1390493ybt.3 for ; Sat, 20 Mar 2021 07:06:11 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=2AipzdZ06a/3fONuHT/nmpxukiVvSegMjowZEqRsXiI=; b=U+n6BeR2EtoJk/lF7LxpTxUPpjB9VvAIZLT9voQt2saMeBaHMBDH7CfeVPXq1lLZAX 0b+SwhDUCeLnYUiwskOvLvkj6VrGhPcoM+2t86QUoqUx9C5tIps9orvlkR5D0PX7ePr9 ey1P3StdHuB6Y+PrkxieGw7o23HOS+PvSpf0T4VcquE4QKGtcxHP9ooy5i1pwbq+mnTc m888mWyYgit2aha++Qv6spgmq9id/v2o2rqeLSQqm5DxFxiVQMxEfMUVxqjtjLTh0AHX FQJZWHX9/Z6a6s0IkD7WofkemFF4QtvLsIAewk+sb2TRgM60J/hXmBLmukNmu4yD28ol 939w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=2AipzdZ06a/3fONuHT/nmpxukiVvSegMjowZEqRsXiI=; b=QaODMRtzcU+iUGUdwJF4+z2LsAARLfrTOi09rOdAAGguIsgQvX4jwKctYowlYDh+XF H7q166myxawSgw2Vrf6mAKM99PlyAJrgLuf2Nh9aRSeDS2yvZ3SGONTLvtuXZNSIku8F aeM5dF8HFAFAwyOP/uW/xo3EEKUbaVdSX/N9vyLOqTxIKBGKZWSzJhufIgIPITS+wXYq 2tAMlIMxo8QBTjAuUoc2Bimdhoiu8AdK6ltQg51DgkFr2gQjSO3NomQiEDNbUZWu0HFv Jgllg+snxFEn17EmhX91l9d5yahAtRdkrT4eUeT49bfbHbrlYKrUZHYvEVK9fYM3QpLY UbNw== X-Gm-Message-State: AOAM530cZNHJlK2sCYjcaLYQsjKnoy79z/lSYRy5qbZqwQkNcBdRhcrf xwjfkYMRKouF110INXjHcRLkGNl7mJEXkQabYRYX5p+93rU= X-Google-Smtp-Source: ABdhPJwowUgJpeBPrLPJUgrOEdVYdZEGHLgGaDa5NqRYf1c5pOYIwu/umU0Y9l51AbLgZjBZGYwveU7YUXuA9DxuJ34= X-Received: by 2002:a25:d091:: with SMTP id h139mr12508458ybg.437.1616249170647; Sat, 20 Mar 2021 07:06:10 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> <20210320092023.000015c8@seibercom.net> In-Reply-To: <20210320092023.000015c8@seibercom.net> From: Aryeh Friedman Date: Sat, 20 Mar 2021 10:05:59 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2jGq5yW2z4Y1B X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=U+n6BeR2; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b32 as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-0.996]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b32:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b32:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b32:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 14:06:12 -0000 On Sat, Mar 20, 2021 at 9:20 AM Jerry wrote: > On Sat, 20 Mar 2021 08:41:31 -0400, Aryeh Friedman stated: > >On Sat, Mar 20, 2021 at 6:35 AM Jerry wrote: > > > >> What I cannot understand is that FreeBSD knows it has a problem, one > >> not shared by any other OS as far as I have been able to ascertain, > >> and I have done a lot of research, and they refuse to fix it. The > >> problem did not exist before version 12.x, so it is not like they > >> never were able to get it right. > >> > > > >The bottom line for many people on the list is this must be the tenth > >or twentif time you have complained about this same exact bug across > >multiple threads and have absolutely refused to lift a finger to fix > >it except complain about how bad FreeBSD is compared to Linux. If > >Linux is so much better, STFU and just switch or get off your lazy ass > >and actually try to lend a hand. Either way the reason many people > >are being so rude to you is at best you refuse to put in any of the > >work required to fix it and at worst you are purposely being a troll > >by even making yet another thread/post about the same bug you have > >rehashed many many times before on this list so that you have a > >whipping boy to show your hatred towards FreeBSD with. > > Actually, you are the only asshole that seems to have a bug up his ass. > Maybe if you took the swastika out of your ass, you wouldn't be such an > annoying kibitzer. > You went so far as a few threads ago saying that you *REFUSED* to do any testing or helping on this problem because Dell *REFUSED* to give you *FREE* hardware to test it on. That sounds really helpful to me! ... BTW I don't know what country you in but in some countries falsely calling someone a Nazi is felony.... but calling someone with first name in Hebrew a Nazi is way beyond any short of netetiquet I don't even know what to call it -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 14:15:12 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 96CA85AA06C for ; Sat, 20 Mar 2021 14:15:12 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2jTC4NmBz4YVD for ; Sat, 20 Mar 2021 14:15:11 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [IPv6:2607:fb90:a350:998f:e9fd:df9c:7ad3:d244] (unknown [172.58.140.141]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id C23C74E696; Sat, 20 Mar 2021 09:15:10 -0500 (CDT) Content-Type: text/plain; charset=utf-8 Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.4\)) Subject: Re: OS to replace FreeBSD From: Valeri Galtsev In-Reply-To: Date: Sat, 20 Mar 2021 09:15:09 -0500 Cc: freebsd-questions@freebsd.org Content-Transfer-Encoding: quoted-printable Message-Id: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> To: Mohammad Noureldin X-Mailer: Apple Mail (2.3608.120.23.2.4) X-Rspamd-Queue-Id: 4F2jTC4NmBz4YVD X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [-2.40 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-0.999]; RCPT_COUNT_TWO(0.00)[2]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_SPF_NA(0.00)[no SPF record]; RCVD_NO_TLS_LAST(0.10)[]; FROM_EQ_ENVFROM(0.00)[]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 14:15:12 -0000 > On Mar 20, 2021, at 7:01 AM, Mohammad Noureldin = wrote: >=20 > Hi all, >=20 > I am new to this mailing list, using FreeBSD/*BSD on and off. Joined = the > mailing list because I have a couple of project ideas that I want to = build > on top of *BSD. >=20 > Though I am new, and maybe relative to many others here I am a newbie, > allow me to comment on all the aspects addressed (so far) in this = email > thread: >=20 > - "It is easy to build a new (custom) kernel", "Unix is made by = technical > people for technical people", etc: >=20 > Though historically it is true that Unix like systems are made by = technical > people for technical people, it doesn't mean that it has to stay like = this. > IMHO, such motto causes a great piece of Engineering like *BSD to = loose > ground for other Unix like systems, namely Linux and all it's Distros. = Not > that I am a Linux hatter, I have respect to both. >=20 > Related to that, I don't believe that it is a good message to FreeBSD > users, that if you don't know how to build a new kernel, then there is = no > place for you here. IMHO, this really hurts the image of the community = of > FreeBSD specially in the eyes of new commers. Notice these email = messages > are archived. That was said by only one - very loud - member of FreeBSD community, = people here are much milder and way more polite. And I for one do not = share the view that FreeBSD in particular and open source systems in = general are only for people with [some] technical knowledge. 1. Installation of FreeBSD is quite streamlined (and same are Debian, = Ubuntu=E2=80=A6) 2. Interaction with machine is same nice as closed source systems' once = you have Xwindow installed (here FreeBSD may need a bit effort compared = to Linuxes I mentioned) 3. Compiling kernel. In general this suggest that I repeat here what I = tell my users who never used Linux or UNIX: how many commands do you = need to know to start using shell? 4 - 5, I=E2=80=99ll show you them in = a minute. Then you just start, =E2=80=A6 and this is really true. = Compiling kernel is just another 3-4 commands. It is simple, no need to = hold people from doing it > - About the problem reported: >=20 > Thanks for all who went through the long list of comments on that PR = and > explained in brief that it is a USB controller/HW problem. >=20 > In that respect, I do agree with Jerry and others wondering how other = OS(s) > can manage running on the same HW (in case that has been proven) ? I > believe it worths looking at that. I would have volunteered to dig = deeper > into that, but I know I don't have the required experience (unless = someone > is willing to mentor me ? :) ) No comment on this specific troublesome hardware. Linux in my = observation has many =E2=80=9Cworkarounds=E2=80=9D to deal with = misbehaving hardware. FreeBSD may be acting =E2=80=9Ccleaner=E2=80=9D = here, hence stays more stringent system, but experts may correct me. I = still remember one chipset which is NOT worth effort writing driver for: = BCM 43xx Broadcom WiFi. That is 32 bit chip, sitting on 64 bit bus, no = need to add more detail after that. > And responding to that:"OK, just shut up and go install another OS", = is not > a community building attitude at all. I agree, saying that is not polite. Better just ignore the OP. Which I = observe many experts did, though several tried to help. Way back before = first asking for help on one of technical lists I read list etiquette = carefully, and there are several things to keep in mind, the OP didn=E2=80= =99t show some of them (not all definitely). Just some of what I = remember: Before asking for help, try do resolve issue yourself within your = ability Describe what you tried and give all details; this simultaneously will = show that you did put effort on your side, then you will less likely to = be ignored Disrespect to others is likely to make you ignored Read carefully suggestions and try to follow them. Report what worked = and what didn=E2=80=99t. You at least have to respect time and effort of = experts trying to help you. -- I stop here just by saying, please, everybody, do not take this as an = attempt of =E2=80=9Cmentoring=E2=80=9D, but someone may find truth in = the above; I for one did. I have just one comment on the hardware choice: this one is one of Dell = =E2=80=9Cconsumer grade=E2=80=9D products, which is not intended to = last, I wouldn=E2=80=99t choose it myself. They look cheaper upfront, = but they end up more expensive in a log run. Dell OptiPlex (not much = more expensive) would have been my choice of the same class of hardware. Be it me, I would go with one or both of solutions already suggested in = the thread: 1. Disable in BIOS on board USB and add USB card if necessary 2. Recompile kernel with switched off USB-3. The first for me would be = preferable, just to not keep recompiling kernel once kernel security = patches are released (but that is me, lazy person) Good luck, Jerry, in resolving your technical issue. Valeri > And for the sake of discussion, let's assume for a second that Jerry = is > lazy or not skilled enough, helping him and fixing the problem or = clearly > explaining a solution without bashing him, is not just for Jerry, it = is for > the whole community, for the current and new members who will be = interested > to join in the future. >=20 > Jerry, I am curious, did you have time to try one the suggestions, > specially running FreeBSD on a VM to see if it still suffers from the = same > problem ? >=20 > You all have a great day/evening >=20 > On Sat, Mar 20, 2021, 11:35 Jerry wrote: >=20 >> On Fri, 19 Mar 2021 18:30:00 -0400, Aryeh Friedman stated: >>> On Fri, Mar 19, 2021 at 4:32 PM Ralf Mardorf = >>> wrote: >>>=20 >>>> On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: >>>>> Void uses a runit init system with no systemd >>>>=20 >>>> Hi, >>>>=20 >>>> I suspect it's not a good idea to use Linux without systemd. For >>>> example, by upstream udev is part of systemd. Maintaining Linux >>>> without systemd is a bottomless pit. >>>>=20 >>>> On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: >>>>> Recompiling the kernel is *TRIVIAL* if you refuse to do it then = you >>>>> should not be using any Unix variant >>>>=20 >>>> I dislike this tone of voice. However, I agree that compiling the >>>> kernel might be less effort, than migrating to another operating >>>> system. If you would e.g. migrate to Arch Linux, you need to get >>>> used to systemd. Getting used to systemd isn't pleasant. If you >>>> chose a Linux distro that doesn't use systemd, you likely will >>>> experience all kinds of trouble, if you want to customize your >>>> install. >>>=20 >>> I used that tone because it really is simple and if you can't/won't >>> recompile the kernel before throwing the baby out despite with the = bath >>> water then you really don't have the skills/desire needed to use = Unix >>> effectively... Just to show how trivial it really is >>>=20 >>> 1. Edit /usr/src/sys/amd64/conf/GENERIC (or i386 instead of amd64 if >>> your still using it) to comment out the xhci line (line 327 in >>> 12.2-RELASE-pl3) to remove USB 3.0 support >>> 2. cd /usr/src >>> 3. make kernel >>> 4. etcupdate >>> 5. reboot >>>=20 >>> Done.... how hard is that? >>=20 >> I never said I could not compile a new kernel, I said I could not >> install the OS. Correct me if I am wrong, but doesn't the = installation >> of the OS precede the creation of a new kernel? Furthermore, the >> screen just rolls away filling up with the error message ad = infinitum. >>=20 >> By the way, as I understand it, creating a custom kernel nullifies = the >> use of "freebsd update". Wow, things just keep getting better & = better. >>=20 >> What I cannot understand is that FreeBSD knows it has a problem, one >> not shared by any other OS as far as I have been able to ascertain, >> and I have done a lot of research, and they refuse to fix it. The >> problem did not exist before version 12.x, so it is not like they = never >> were able to get it right. >>=20 >> -- >> Jerry >>=20 >>=20 >>=20 >>=20 > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" From owner-freebsd-questions@freebsd.org Sat Mar 20 14:41:57 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 441765AAE09 for ; Sat, 20 Mar 2021 14:41:57 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2k4448PYz4Zn4 for ; Sat, 20 Mar 2021 14:41:56 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [192.168.43.231] (unknown [172.58.140.242]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 073224E6AF; Sat, 20 Mar 2021 09:35:35 -0500 (CDT) Content-Type: text/plain; charset=utf-8 Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.4\)) Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD From: Valeri Galtsev In-Reply-To: Date: Sat, 20 Mar 2021 09:35:34 -0500 Cc: FreeBSD Content-Transfer-Encoding: quoted-printable Message-Id: <98F5179B-981F-46F3-8F6C-2695EE23C5E8@kicp.uchicago.edu> References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> To: Mohammad Noureldin X-Mailer: Apple Mail (2.3608.120.23.2.4) X-Rspamd-Queue-Id: 4F2k4448PYz4Zn4 X-Spamd-Bar: ++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [2.68 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; MV_CASE(0.50)[]; TO_DN_ALL(0.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; RCVD_NO_TLS_LAST(0.10)[]; RECEIVED_SPAMHAUS_PBL(0.00)[172.58.140.242:received]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; FROM_EQ_ENVFROM(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; ARC_NA(0.00)[]; RECEIVED_SPAMHAUS_XBL(5.00)[172.58.140.242:received]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-0.92)[-0.923]; MIME_GOOD(-0.10)[text/plain]; R_DKIM_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,meta]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 14:41:57 -0000 > On Mar 20, 2021, at 6:30 AM, Mohammad Noureldin = wrote: >=20 > Hi, >=20 > On Sat, Mar 20, 2021, 10:00 @lbutlr wrote: >=20 >> On 19 Mar 2021, at 10:10, freebsd@johnea.net wrote: >>> To anyone who has read the bug report, this is clearly a serious >> regression issue on certain USB (probably 3) host controller = hardware. >>=20 >> I've read the bug report and all the replies and it is clearly a flaw = in >> the controller. It is providing an invalid ID. >>=20 >=20 > If that's the case, I am curious how other Unix-Like Operating Systems > manage to work on the same HW ? >=20 Linux may have =E2=80=9Cworkaround=E2=80=9D that. But that is Linux: it = is really full of hacks and workarounds, good clean system better does = not go that way. I=E2=80=99m glad FreeBSD doesn=E2=80=99t (hopefully). = Don=E2=80=99t be a hostage of bad hardware manufacturers. Just my $0.02 Valeri >=20 >> -- >> "Are you pondering what I'm pondering?" >> "Are you pondering cheesesticks?" >>=20 >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to " >> freebsd-questions-unsubscribe@freebsd.org" >>=20 > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" From owner-freebsd-questions@freebsd.org Sat Mar 20 14:41:57 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 441585AAD5D for ; Sat, 20 Mar 2021 14:41:57 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2k444jFcz4ZcY for ; Sat, 20 Mar 2021 14:41:56 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [IPv6:2607:fb90:a350:998f:e9fd:df9c:7ad3:d244] (unknown [172.58.140.141]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 8B15F4E652; Sat, 20 Mar 2021 09:32:21 -0500 (CDT) Content-Type: text/plain; charset=us-ascii Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.4\)) Subject: Re: OS to replace FreeBSD From: Valeri Galtsev In-Reply-To: <202103192142.55284.office@klepp.biz> Date: Sat, 20 Mar 2021 09:32:20 -0500 Cc: freebsd-questions@freebsd.org Content-Transfer-Encoding: quoted-printable Message-Id: <617090F5-5664-44E2-AA96-218A486A3C69@kicp.uchicago.edu> References: <20210319101040.00005c35@seibercom.net> <20210319213214.4f8ddf55@archlinux> <202103192142.55284.office@klepp.biz> To: "Dr. Nikolaus Klepp" X-Mailer: Apple Mail (2.3608.120.23.2.4) X-Rspamd-Queue-Id: 4F2k444jFcz4ZcY X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [3.09 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCPT_COUNT_TWO(0.00)[2]; RCVD_NO_TLS_LAST(0.10)[]; RECEIVED_SPAMHAUS_PBL(0.00)[172.58.140.141:received]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; FROM_EQ_ENVFROM(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; ARC_NA(0.00)[]; RECEIVED_SPAMHAUS_XBL(5.00)[172.58.140.141:received]; NEURAL_HAM_MEDIUM(-0.99)[-0.995]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-0.51)[-0.514]; MIME_GOOD(-0.10)[text/plain]; R_DKIM_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,body]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 14:41:57 -0000 > On Mar 19, 2021, at 3:42 PM, Dr. Nikolaus Klepp = wrote: >=20 > Anno domini 2021 Fri, 19 Mar 21:32:14 +0100 > Ralf Mardorf scripsit: >> On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: >>> Void uses a runit init system with no systemd >>=20 >> Hi, >>=20 >> I suspect it's not a good idea to use Linux without systemd. For >> example, by upstream udev is part of systemd. Maintaining Linux = without >> systemd is a bottomless pit. >=20 > Oh, you can use Devuan - wich works perfect. But I'd reverse the = argument: It's not a good good idea, to run Linux with systemd. Basicly = systemd is the argument to move away from Linux. >=20 Indeed. Once [systemd related] code was aded to kernel, it was it. = Kernel is polluted, and cleaning that away from kernel only adds extra = bugs and problems. Even maintaining the branch of kernel stemming from = pre-systemd is not as good as were it no systemd in the world at all. But that is just extra argument to move away from Linux (at least = systems that can be moved away). Valeri > Nik >=20 >>=20 >> On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: >>> Recompiling the kernel is *TRIVIAL* if you refuse to do it then you >>> should not be using any Unix variant >>=20 >> I dislike this tone of voice. However, I agree that compiling the = kernel >> might be less effort, than migrating to another operating system. If = you >> would e.g. migrate to Arch Linux, you need to get used to systemd. >> Getting used to systemd isn't pleasant. If you chose a Linux distro >> that doesn't use systemd, you likely will experience all kinds of >> trouble, if you want to customize your install. >>=20 >> Regards, >> Ralf >> _______________________________________________ >> freebsd-questions@freebsd.org mailing list >> https://lists.freebsd.org/mailman/listinfo/freebsd-questions >> To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" >>=20 >=20 >=20 >=20 > --=20 > Please do not email me anything that you are not comfortable also = sharing with the NSA, CIA ... > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" From owner-freebsd-questions@freebsd.org Sat Mar 20 14:47:52 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A2BB65AB3D9 for ; Sat, 20 Mar 2021 14:47:52 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: from mail-ej1-x62e.google.com (mail-ej1-x62e.google.com [IPv6:2a00:1450:4864:20::62e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2kBw02XVz4bX4 for ; Sat, 20 Mar 2021 14:47:51 +0000 (UTC) (envelope-from grahamperrin@gmail.com) Received: by mail-ej1-x62e.google.com with SMTP id jy13so14218206ejc.2 for ; Sat, 20 Mar 2021 07:47:51 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=subject:to:references:from:message-id:date:user-agent:mime-version :in-reply-to:content-transfer-encoding:content-language; bh=kgE7sM+DGp/PUJWnz+tWLcOyulFtaJM9TmFd6DwAI78=; b=CE8QorGse71LW37uSFTupIjaSZa+Cs20IjYnHJ2A2tgKrYy9cRm/5NM4K0Gx4WWlQ4 I2HatFufSK+SiCxP4QH7cogyVusXLcPuHtOn8pzV8NB44DVP04Bg03nmFYedjPoi9YTq ojfwNW6ru5ce+Ip5doCXpU5fX1W7HWgqVth176O0lRAmWloBZwP6nr0iuZY+wESKNlSE nZb28e5Ax3g1JQmQMjPqKwJLyq2tQ4SkBmJeDAcxXM7DcID9yc46hRpHonZ94ogpsvcT DMc1cPtzocKFVp8h3SC2Pg7Dcak21xHr4+HxvIKVFn2w4PixS1GnHFLASPYhf173H+eT 1YPQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:subject:to:references:from:message-id:date :user-agent:mime-version:in-reply-to:content-transfer-encoding :content-language; bh=kgE7sM+DGp/PUJWnz+tWLcOyulFtaJM9TmFd6DwAI78=; b=QrOoGg/mCzZIDIOfehIrsejmgheVRdIjyd8dsc2MfM34DY81a0Z2ON4hKkq5ELZWN7 NajI2/4PzkMDTqVuLIrjvClL+cn1QKkIFAEiq0t5g3i4EX4tiFXjAbLtQgWJpPCq+xzW mS7fr8ZLD/MijhMhf1sL4TXxJg74sJY1ZNThSBeKiWTJ1xTQ35Iw/JBE4gCOb4kbCnTb ooy6v7uZqh8b8ewxBztBI0HHh+9DI2As6XKrSTedpSCqPL7YpTnS3m4H6FvClCNiindo U3oedN+OAjx5OZsN+KbT18HuqeEIvRBf3i6/eafetQHvCVyfWkPnHYnyMCCJVX5ajgUm 3EXA== X-Gm-Message-State: AOAM532wTE40hBqMFOjjU0Q6oYY4jgLwtI1qGlNXwhyzjmCxB8C9kdUA UVC6H/qzVMEqIvucuwdJrAQfrf80LhJHOQ== X-Google-Smtp-Source: ABdhPJzootzbkb9U9gD/aME0mYXT8S62ogKgf4CdizLI2l0HDP80xHch11nFk75W2gnmIKmfzpBKAA== X-Received: by 2002:a17:906:81c9:: with SMTP id e9mr9937077ejx.456.1616251670371; Sat, 20 Mar 2021 07:47:50 -0700 (PDT) Received: from [192.168.1.13] (88-105-96-80.dynamic.dsl.as9105.com. [88.105.96.80]) by smtp.gmail.com with ESMTPSA id r19sm6263245edp.52.2021.03.20.07.47.49 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sat, 20 Mar 2021 07:47:49 -0700 (PDT) Subject: Re: pkg- searching by (partial) origin|category for installed packages/ports To: freebsd-questions@freebsd.org References: From: Graham Perrin Message-ID: <7353fe8f-35d7-3428-9aef-5a265837ddac@gmail.com> Date: Sat, 20 Mar 2021 14:47:49 +0000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:78.0) Gecko/20100101 Thunderbird/78.8.1 MIME-Version: 1.0 In-Reply-To: Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: 8bit Content-Language: en-GB X-Rspamd-Queue-Id: 4F2kBw02XVz4bX4 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=CE8QorGs; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of grahamperrin@gmail.com designates 2a00:1450:4864:20::62e as permitted sender) smtp.mailfrom=grahamperrin@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[88.105.96.80:received]; FROM_EQ_ENVFROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::62e:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::62e:from:127.0.2.255]; MIME_TRACE(0.00)[0:+]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::62e:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 14:47:52 -0000 On 20/03/2021 10:50, parv/freebsd wrote: > Hi there, > > How does one search for a installed port or package by (partial) > origin/category? … Now I wonder about --by-origin ---- % pkg info -x --origin virtualbox virtualbox-ose-6.1.18          emulators/virtualbox-ose virtualbox-ose-kmod-6.1.18     emulators/virtualbox-ose-kmod % pkg info --by-origin emulators % From owner-freebsd-questions@freebsd.org Sat Mar 20 14:54:22 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id E0B7A5AB937 for ; Sat, 20 Mar 2021 14:54:22 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from kicp.uchicago.edu (kicp.uchicago.edu [128.135.20.70]) by mx1.freebsd.org (Postfix) with ESMTP id 4F2kLQ0ZYfz4cb8 for ; Sat, 20 Mar 2021 14:54:21 +0000 (UTC) (envelope-from galtsev@kicp.uchicago.edu) Received: from [IPv6:2607:fb90:a350:998f:e9fd:df9c:7ad3:d244] (unknown [172.58.140.141]) (Authenticated sender: galtsev) by kicp.uchicago.edu (Postfix) with ESMTPSA id 3447D4E652; Sat, 20 Mar 2021 09:54:21 -0500 (CDT) Content-Type: text/plain; charset=utf-8 Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.4\)) Subject: Re: Call to delay EOL of 11.x -> Re: OS to replace FreeBSD From: Valeri Galtsev In-Reply-To: <20210320135740.c10f4d671d34ce6590527eb6@sohara.org> Date: Sat, 20 Mar 2021 09:54:19 -0500 Cc: freebsd-questions@freebsd.org Content-Transfer-Encoding: quoted-printable Message-Id: <7270A6A8-4514-4B61-80AD-7812CC0AEFD7@kicp.uchicago.edu> References: <5743CB5D-338C-4609-8E89-396440926CEC@videotron.ca> <20210319110001.00000bf8@seibercom.net> <4602cbad-bf26-18d1-83e6-cba9627787d8@johnea.net> <90FEC704-1764-43E7-BEFA-C9481CF14714@kreme.com> <20210320083808.00000cb1@seibercom.net> <20210320093304.00001e37@seibercom.net> <20210320135740.c10f4d671d34ce6590527eb6@sohara.org> To: Steve O'Hara-Smith X-Mailer: Apple Mail (2.3608.120.23.2.4) X-Rspamd-Queue-Id: 4F2kLQ0ZYfz4cb8 X-Spamd-Bar: ++++ Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=uchicago.edu (policy=none); spf=none (mx1.freebsd.org: domain of galtsev@kicp.uchicago.edu has no SPF policy when checking 128.135.20.70) smtp.mailfrom=galtsev@kicp.uchicago.edu X-Spamd-Result: default: False [4.40 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; MV_CASE(0.50)[]; RCPT_COUNT_TWO(0.00)[2]; RCVD_NO_TLS_LAST(0.10)[]; RECEIVED_SPAMHAUS_PBL(0.00)[172.58.140.141:received]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[128.135.20.70:from]; FROM_EQ_ENVFROM(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; ASN(0.00)[asn:160, ipnet:128.135.0.0/16, country:US]; ARC_NA(0.00)[]; RECEIVED_SPAMHAUS_XBL(5.00)[172.58.140.141:received]; NEURAL_HAM_MEDIUM(-0.99)[-0.994]; FROM_HAS_DN(0.00)[]; NEURAL_SPAM_SHORT(0.20)[0.197]; NEURAL_HAM_LONG(-0.41)[-0.408]; MIME_GOOD(-0.10)[text/plain]; R_DKIM_NA(0.00)[]; SPAMHAUS_ZRD(0.00)[128.135.20.70:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_COUNT_TWO(0.00)[2]; GREYLIST(0.00)[pass,meta]; MAILMAN_DEST(0.00)[freebsd-questions]; DMARC_POLICY_SOFTFAIL(0.10)[uchicago.edu : No valid SPF, No valid DKIM,none] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 14:54:22 -0000 > On Mar 20, 2021, at 8:57 AM, Steve O'Hara-Smith = wrote: >=20 > On Sat, 20 Mar 2021 09:33:04 -0400 > Jerry wrote: >=20 >> I CANNOT install it,=20 >=20 > Perhaps I am misunderstanding the situation. AIUI the install > completes it is just that the default console is spammed by error = messages > so you can't see the login prompt (it is actually possible to log in = and > work under these conditions but it is hideous to do). Fortunately = there is > a better option, there are several active virtual consoles available = by > hitting Alt-F simply switch to one of those, log in and proceed as > normal. >=20 I had to install FreeBSD not in GUI but in text menu mode once on the = machine producing constant stream of messages (USB related on console). = In my case I was booting off USB medium. That effectively obliterated my = ability to interact with menu. The solution to that was to suppress console messages: when boot menu appears do "ESCape to loader prompt=E2=80=9D. Then in in boot prompt: set boot_mute=3D=E2=80=9CYES=E2=80=9D boot After that there were no console messages, and I was able to = successfully do installation. In general, to suppress console messages on already installed system, = you can add to /boot/loader.conf: boot_mute=3D"YES" I hope, this helps. Valeri >> so I am unsure of how to build a custom kernel. >> Then, assuming I could build a custom kernel, I would not be able to >> use the "freebsd update" utility. >=20 > Of course you can use freebsd-update with a custom kernel, I do = it > all the time. It just adds the extra step of compiling your custom = kernel > before rebooting after the update. My usual sequence for this is: >=20 > freebsd-update fetch > freebsd-update install > cd /usr/src > make kernel > reboot >=20 > NB: make kernel works because I have kernconf set in = /etc/make.conf > to the name of my custom kernel config. >=20 >> So, to put it in the vernacular, >> "I am fucked if I do, and fucked if I don't". >=20 > Nope, you just have to understand how to get yourself out of the > hole. >=20 > --=20 > Steve O'Hara-Smith > _______________________________________________ > freebsd-questions@freebsd.org mailing list > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > To unsubscribe, send any mail to = "freebsd-questions-unsubscribe@freebsd.org" From owner-freebsd-questions@freebsd.org Sat Mar 20 16:02:50 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 0B00F5AD5A4 for ; Sat, 20 Mar 2021 16:02:50 +0000 (UTC) (envelope-from tomek@cedro.info) Received: from mail-ej1-x631.google.com (mail-ej1-x631.google.com [IPv6:2a00:1450:4864:20::631]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2lsP2m5Gz4h25 for ; Sat, 20 Mar 2021 16:02:48 +0000 (UTC) (envelope-from tomek@cedro.info) Received: by mail-ej1-x631.google.com with SMTP id w3so14430684ejc.4 for ; Sat, 20 Mar 2021 09:02:48 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cedro.info; s=google; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=2Pm4a1eJxtzExts8WZfeUpNcpriyoW1ZviCR5p5ndeM=; b=UR0dAXYP7IGpooeEHabNW3VvpZOK75blL89V4rf/VTcY+En0hPpW755AXs5UY0WLJb kf5daI//+GYY84bOD2KSEvog4FpE/27Yj++U4GdstJSqJAkIKCuBS+o5fq2H2E6SxTQ8 QLK/d5XC8/Bu6MI/To/kFkZb3zKoSIkgbiVEO9T/ksRFo/p04HGPFB42K46JQfOTIvwe V7gVfOO0xGo9ZIhGW6xgHAclsEO1/M/ibYUFtDarfi6qbquNLZW6d20P6eYXnNXYs4Lf HlydfP8fAaoaKHLISvZG5eAWQbJUSq5nWI1bVCM5YaC+4rEBEloWqK6xYvH5EmI8yK5w OFdQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=2Pm4a1eJxtzExts8WZfeUpNcpriyoW1ZviCR5p5ndeM=; b=RZyj0am8lWAQrWWwYcplsjErHQ5cekIkr7QCijlMv9K73aHJbOKLIf+u700Ys3cM8v vWUnFBOCjykHhxRcSeaadiBmPmbamiXq1KOmqrWfE1azkl+a+vczawLL9WIkrMA+xJJX blGMoLxfga+TgOtZ8qgGSNiGnmy9ZbhLHKhxUVOnqVvcXHJb45JXhbYm0LxINu1wV4Cq EQG2EWFPa3MUxr9RYqL3D92pxYgc5huRdX2J9mfK6M6QNKy7Bijjh186HQL4yYnDKFvv xPAymYSibiARCGz0xTDmvYlibuJqnbYPZFaY8v5bPD7yNvvGQi0/v9TwWTxCNnmG09Yh Lc7w== X-Gm-Message-State: AOAM532LCDkZT+GIULp6G07kugpCgyihcXj42+3e3mmrhITCNQzqfUGP VaDbXlxsU5QIBhOaC/UQDalcFHSwU9CdTl64AT/T3c63uXA= X-Google-Smtp-Source: ABdhPJztJRyhx9aT1YX1HWAKJBlaIk8kg75/EIosGcSyT+jIQPRDPZ5kBjlINcZMhbvSYxmtoi1Rs+iGruvQnIY4F0I= X-Received: by 2002:a17:906:4747:: with SMTP id j7mr10188535ejs.221.1616256167378; Sat, 20 Mar 2021 09:02:47 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> <20210320134902.1d0213791f9c6d90a8f259e8@sohara.org> In-Reply-To: <20210320134902.1d0213791f9c6d90a8f259e8@sohara.org> From: Tomasz CEDRO Date: Sat, 20 Mar 2021 17:02:36 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: "Steve O'Hara-Smith" Cc: FreeBSD Questions Mailing List Content-Type: text/plain; charset="UTF-8" X-Rspamd-Queue-Id: 4F2lsP2m5Gz4h25 X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=cedro.info header.s=google header.b=UR0dAXYP; dmarc=none; spf=none (mx1.freebsd.org: domain of tomek@cedro.info has no SPF policy when checking 2a00:1450:4864:20::631) smtp.mailfrom=tomek@cedro.info X-Spamd-Result: default: False [-3.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[cedro.info:s=google]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[cedro.info]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::631:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[cedro.info:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::631:from]; NEURAL_HAM_SHORT(-1.00)[-0.999]; R_SPF_NA(0.00)[no SPF record]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::631:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 16:02:50 -0000 On Sat, Mar 20, 2021 at 2:49 PM Steve O'Hara-Smith wrote: > > On Sat, 20 Mar 2021 14:20:33 +0100 > Tomasz CEDRO wrote: > > > Free Softwate is free to use, but is really cost developers life time and > > all other technical resources and experiences. Just imagine how many > > problems of this kind developers have everyday. Most of them work for free > > in their free time, but they also need to pay the bills. > > To amplify this it has been three years since anyone other than Hans > Petter Selasky committed to xhci.c, he could probably do with some help > keeping up with the chaos that is USB hardware. TRUE! HPS IS A PURE GENIUS AND MY SUPER HERO!! =) -- CeDeROM, SQ7MHZ, http://www.tomek.cedro.info From owner-freebsd-questions@freebsd.org Sat Mar 20 16:25:37 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id A69785ADBF0 for ; Sat, 20 Mar 2021 16:25:37 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qk1-x72d.google.com (mail-qk1-x72d.google.com [IPv6:2607:f8b0:4864:20::72d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2mMh5hckz4jTY for ; Sat, 20 Mar 2021 16:25:36 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qk1-x72d.google.com with SMTP id x14so6210091qki.10 for ; Sat, 20 Mar 2021 09:25:36 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=tsVUYMknjKi3wQoD/ba6XRt3zFf7ng4yMnvtU2riPJ8=; b=h9LqpEH0pJOcsots9wwXRiUUgs47p+4BJjIQqPa4Y8LZoRjktmaol3GJ28m2dnAn67 YyGNM1K7psMd+YsOZ7I8GS3+14QLyYjnS9a9E2ulH3er61X8pcLy2kLZxySSYlRMnAH/ ziQXVSqtJenwAX94QdVntgdGsWhxrCy00T/E0= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=tsVUYMknjKi3wQoD/ba6XRt3zFf7ng4yMnvtU2riPJ8=; b=Hp0nvYEqtNV8uh7ytZBpz045NkGomMvcIyI85iqSRRwMZGoSEwWpt66Pjlauyd3k5o kHQ1slGbM2L6ljZkcCUwkvuLcRSD4c9j+OULJWdoUmQixey2nQXzksWeo1ooipj7AtxV Njic+HvKtkxfcctu2iCayFpInoQslqY9ZkIE/vgqOx0P/aaDM3iK1QTN/rZ0+vUCeuHk LL6/EB9OR4jpJqkz5efVGGoPRWDiRQ3hg3NeOoEZmc8UZl6qmkHe5NrKv4dgPWjSs5bw lnl93KOm3F+VInWYD50uNHPGCzhztMB8zDxZc9fysO0H/2/Fu3YewHWVF3Kcma2hIONO Banw== X-Gm-Message-State: AOAM530oloxh6lT3cOJyj1oxIxFiyOci/tGh89tV1kIVZk4vSZK6lFVV XVRKTQDZ2FtKW3ZGjyCWZbKrak/sDbneoQ== X-Google-Smtp-Source: ABdhPJw4nZOn6CGIfJs6Jp+7FWukz71HtfjcodlnrAXpP0Gcs6nccI/TFjZnJtk4qzb4178Ziau6pg== X-Received: by 2002:a05:620a:1530:: with SMTP id n16mr3502651qkk.288.1616257535405; Sat, 20 Mar 2021 09:25:35 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id h6sm5878513qtj.75.2021.03.20.09.25.34 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 20 Mar 2021 09:25:34 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2mMd4rV4z1yg5 for ; Sat, 20 Mar 2021 12:25:33 -0400 (EDT) Date: Sat, 20 Mar 2021 12:25:07 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210320122507.0000282b@seibercom.net> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> <20210320092023.000015c8@seibercom.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/Lx.1a2V3+AGJ2rWL.CZP9yM"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2mMh5hckz4jTY X-Spamd-Bar: +++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=h9LqpEH0; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::72d as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [3.35 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::72d:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.99)[-0.994]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::72d:from:127.0.2.255]; NEURAL_SPAM_SHORT(0.94)[0.944]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::72d:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 16:25:37 -0000 --Sig_/Lx.1a2V3+AGJ2rWL.CZP9yM Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Sat, 20 Mar 2021 10:05:59 -0400, Aryeh Friedman stated: >On Sat, Mar 20, 2021 at 9:20 AM Jerry wrote: > >> On Sat, 20 Mar 2021 08:41:31 -0400, Aryeh Friedman stated: =20 >> >On Sat, Mar 20, 2021 at 6:35 AM Jerry wrote: >> > =20 >> >> What I cannot understand is that FreeBSD knows it has a problem, >> >> one not shared by any other OS as far as I have been able to >> >> ascertain, and I have done a lot of research, and they refuse to >> >> fix it. The problem did not exist before version 12.x, so it is >> >> not like they never were able to get it right. >> >> =20 >> > >> >The bottom line for many people on the list is this must be the >> >tenth or twentif time you have complained about this same exact bug >> >across multiple threads and have absolutely refused to lift a >> >finger to fix it except complain about how bad FreeBSD is compared >> >to Linux. If Linux is so much better, STFU and just switch or get >> >off your lazy ass and actually try to lend a hand. Either way the >> >reason many people are being so rude to you is at best you refuse >> >to put in any of the work required to fix it and at worst you are >> >purposely being a troll by even making yet another thread/post >> >about the same bug you have rehashed many many times before on this >> >list so that you have a whipping boy to show your hatred towards >> >FreeBSD with. =20 >> >> Actually, you are the only asshole that seems to have a bug up his >> ass. Maybe if you took the swastika out of your ass, you wouldn't be >> such an annoying kibitzer. >> =20 >You went so far as a few threads ago saying that you *REFUSED* to do >any testing or helping on this problem because Dell *REFUSED* to give >you *FREE* hardware to test it on. That sounds really helpful to me! >... BTW I don't know what country you in but in some countries falsely >calling someone a Nazi is felony.... but calling someone with first >name in Hebrew a Nazi is way beyond any short of netetiquet I don't >even know what to call it I did not request free hardware for myself. A user stated that if I shipped them a system exactly like mine, he might be be to diagnose the problem. I told him to contact Dell directly. I am not sure what country you are in either, but if it is mine then we really do need to tighten the immigration laws. --=20 Jerry --Sig_/Lx.1a2V3+AGJ2rWL.CZP9yM Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBWIegACgkQgHBP8gv9 FXdshgv5Aa4rc0/0BIJDT3CTBLP1sdEupbj/gvVgxBDqGYx6Whv/Zt5SvCfZ/m0j 1a7Z1PrKO+u7U9T2sSFW4r5rBM3DWoPvLS6Jw1UnIawf+tcVTw/S0yHjbRm5d8ES hCRrxd/pJWMsvfkq3nmUSUw51MPvq1kuY52awMw7YeTu72q5c6/AQIFvf0SOULfk QPa/tSbt2CSPEv04dsZG8ootBWknR9fbkY5UbJ8+Bf/s0KIGs8cyZPb0fSWEtHLx Z/R+C5Yi2E+ebskskHiQEUtU/mHuLP960hTUE2wbA4eN2dkruQ0V5A/l5DpJRuJe OdY5ZmtxUwB+zLaFcI6o27hT8fEZKJrIgBPjZ8gzzUSxjY05s81WmCT4/QHkFuHO 9ntFlOhKaCm2FFuIpbgB9EE9wY4VFGzuRUMSQNNpHEYu467JIJgHvjhp31SDlROF dTL8ZFdw7egz15q4UjQycIQnXPibztkaqkUh6lGSxxBVKcJbBpgwWt2G8k4YY7mG Hbsfy0qk =NgJp -----END PGP SIGNATURE----- --Sig_/Lx.1a2V3+AGJ2rWL.CZP9yM-- From owner-freebsd-questions@freebsd.org Sat Mar 20 16:40:27 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 980CA5AE2DC for ; Sat, 20 Mar 2021 16:40:27 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb29.google.com (mail-yb1-xb29.google.com [IPv6:2607:f8b0:4864:20::b29]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2mhp4Zgvz4kKs for ; Sat, 20 Mar 2021 16:40:26 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb29.google.com with SMTP id z1so1689382ybf.6 for ; Sat, 20 Mar 2021 09:40:26 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=wvbP/jo1dGQ9JWBC2KRQlYf6LI5WEooVcHmkcETv1Z0=; b=IxCqtYFOthOfUO9q29DHwnycgTjYDJF4+JDEgQP25DYi0cIEfXYHXVd9pM9S12udw9 Z6raUMpGCKFJgsEneXkpWLreeB12Tt0KQtzZVK2O5Otp2kRZ9mbszSKhI+7Lnq5QfHYN IiFZNfIH6ntVninTRpPNPYQ/uJL2zkSnzrIh8DnTmJ3dpmADw0ho2f223Ef0Ll2sUn/S d3+yk5OUspTOeuiBw+SqjujpK0ORPBGxmTn1Azo6O/pZW4H+JYCnsLRpOQCJMQIW7Q4M vIdPp8gGFKQQ0PnsrRfzu91wRw27PEF8v5Dao1cAQ/smBmww7zBKLilTydKb3QuDzNs8 QGnA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=wvbP/jo1dGQ9JWBC2KRQlYf6LI5WEooVcHmkcETv1Z0=; b=WGSEYkn/wX4I0QiMzdIbI3Y3OaIs4Cqv6zwyMbkgAXyDaimSZKNYROeZEV+gbYBHYj XzloZMjrheQZDFOFwPJTebVGLcEqFUotL+Wk04/+nbY/cVd9eAZiYF2VGF19I52XcX7k 5kVoEBJoF1Rb1zQ99d3U9ekF10LVkqRNM3yWLSgYJPrg+MCbKXVmkeRyqGtyAh+yo9eK 34Is3OBF4VzI3VpN73kzwIRglvBk7XGFl1L1v3vsI+F9c0JPb6KejetY7sltzeNh7cOr eivb35b9LAD3AkZlYICptx7RHLrhGlmKmgCyjDhxniC1dCBiDCKORmlyXLLe4RynVYKw sJkQ== X-Gm-Message-State: AOAM532bhkb1OFFGE/vQKxik4ickhUEI7w37kEc45EplC2nWJrL2/PQS DCkBUXaC4sZjuL7scZm0GLF1//Hx03zoAzwPCBAvgpTN2Sg= X-Google-Smtp-Source: ABdhPJyZg/zN/3JNvJWAeIjFDU2iVIu9eOOM81Iqna/JWTixUG4RwTY95e5Ql48oi9qIM5JiAsVNo1eHDwVti62DdrA= X-Received: by 2002:a25:5146:: with SMTP id f67mr14187088ybb.332.1616258425326; Sat, 20 Mar 2021 09:40:25 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> <20210320092023.000015c8@seibercom.net> <20210320122507.0000282b@seibercom.net> In-Reply-To: <20210320122507.0000282b@seibercom.net> From: Aryeh Friedman Date: Sat, 20 Mar 2021 16:40:15 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2mhp4Zgvz4kKs X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=IxCqtYFO; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b29 as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [0.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; DATE_IN_FUTURE(4.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b29:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b29:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b29:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 16:40:27 -0000 On Sat, Mar 20, 2021 at 12:25 PM Jerry wrote: > I am not sure what country you are in either, but if it is mine then we > really do need to tighten the immigration laws. > I wonder if it is the one my family (direct blood line) has lived in for 400 years ever since they landed on some rock that starts with a P. I suspect I am the one that should be calling you an immigrant if it is the same one (we accept everyone including jerks). -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 16:45:59 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 4FE5A5AE6E5 for ; Sat, 20 Mar 2021 16:45:59 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: from mail-io1-xd31.google.com (mail-io1-xd31.google.com [IPv6:2607:f8b0:4864:20::d31]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2mqB1dsMz4kdf for ; Sat, 20 Mar 2021 16:45:58 +0000 (UTC) (envelope-from michaelsprivate@gmail.com) Received: by mail-io1-xd31.google.com with SMTP id f19so9445949ion.3 for ; Sat, 20 Mar 2021 09:45:58 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=20NVTvy2v9WpRg9oDfZBZX/e0+wjujaQToIEKCtV3a0=; b=c1zgVwjQwMyl02JyKx/OfnQTui/zTeNQ+h1Hz4ofY9JBt+0uWOb0pBdbJmpCcynTyu JxTiOptjfwnNdlAbNKtMXYDzYps+HCKj1mB5yEY5OSfMNt0mQXq6VAQOwogET4R1jb/+ UgoPDpKTCGxUxR1gCR+GMpwt11tYcr76khkO63XG0i3XIhk18yBFUbfTUIu7LbfZdyCt v/LW02HGqkWg72lJ8iZjiddBSa75IFEXNpSgggZOIxbUqkOPm+f6BwJEnkr28JjQYMaV y+LfrrO8TDkx4Y80LZGN4wasgBEYfT7zjdjOLuof45BxrdbgfZng4Q8mLZHGTklgCgxC N0Rg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=20NVTvy2v9WpRg9oDfZBZX/e0+wjujaQToIEKCtV3a0=; b=rm47xeP3z0TcpHqWflYkDVu6lxYwFzylEgeOcIRz+qkVY73UVJElBAGCVl1N2jmP21 8VlIpr7Z/CjGgJlqIporzCZXiMN239ZZ5wg0jxpYtR6fx1B1veoJha4sSSxkWAsYF8Wg I8eXgQsbHbz7QnRHolTbcX527MqGcUU+bvffm9khB4eiD3mE44xarQeyZ4r2oZLivOey QX7nT7u31o7+6avVWjcS7j7VZuEyRYYHk2Ss78j6HcfLanZ3QrloiEpOAUO4b/i+oxm1 VDBpQI1luU7IKnYH+7Mi2XQVw2Qz7Bez+aTqE1g9xpTFaacmoSDMlhfBcVnJbG/Yfl8b CLUg== X-Gm-Message-State: AOAM5307NYqxgjx8RRpjLeb//vHwqKkOjU0JEOx/T60q8ilX3BsaGebN I6oOTDLqLwGJ93shGdjrvQX2DsR3gXS5Q1vwefQ= X-Google-Smtp-Source: ABdhPJy6KjbFlpiWHlw0meDpUUWttFDYokxHDA5Uj+rJ2yUhWWFqLE3KyH7P9dbHxF1ci6XRFCohXcyvVAi7pN7Q6SU= X-Received: by 2002:a05:6602:3144:: with SMTP id m4mr6296278ioy.103.1616258756894; Sat, 20 Mar 2021 09:45:56 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> <20210320092023.000015c8@seibercom.net> <20210320122507.0000282b@seibercom.net> In-Reply-To: From: Michael Schuster Date: Sat, 20 Mar 2021 17:45:46 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: Aryeh Friedman Cc: FreeBSD Mailing List X-Rspamd-Queue-Id: 4F2mqB1dsMz4kdf X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=c1zgVwjQ; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of michaelsprivate@gmail.com designates 2607:f8b0:4864:20::d31 as permitted sender) smtp.mailfrom=michaelsprivate@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; FREEMAIL_FROM(0.00)[gmail.com]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-0.999]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::d31:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::d31:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::d31:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 16:45:59 -0000 On Sat, Mar 20, 2021 at 5:40 PM Aryeh Friedman wrote: > On Sat, Mar 20, 2021 at 12:25 PM Jerry wrote: > > > I am not sure what country you are in either, but if it is mine then we > > really do need to tighten the immigration laws. > > > > I wonder if it is the one my family (direct blood line) has lived in for > 400 years ever since they landed on some rock that starts with a P. I > suspect I am the one that should be calling you an immigrant if it is the > same one (we accept everyone including jerks). > guys ... please. I understand that emotions are involved here. If you must continue this ... dialogue, please do so offline. regards -- Michael Schuster http://recursiveramblings.wordpress.com/ recursion, n: see 'recursion' From owner-freebsd-questions@freebsd.org Sat Mar 20 17:23:54 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id DD6495AF695 for ; Sat, 20 Mar 2021 17:23:54 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: from mail-qv1-xf36.google.com (mail-qv1-xf36.google.com [IPv6:2607:f8b0:4864:20::f36]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2nfx6YTKz4mYD for ; Sat, 20 Mar 2021 17:23:53 +0000 (UTC) (envelope-from jerry@seibercom.net) Received: by mail-qv1-xf36.google.com with SMTP id by2so6639812qvb.11 for ; Sat, 20 Mar 2021 10:23:53 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=seibercom.net; s=google; h=date:from:to:subject:message-id:in-reply-to:references:reply-to :organization:mime-version; bh=nsdlcZl7BzkImo+L+EEhfmvt8SviQ3XfdcqJrKuUhDM=; b=kYPuZhwhL8ofAm8dMhXhDGOkzlkEAkkA4LWqJmJh28AYAp7v9zW9yhP6T6FdI6sDeK wW12VfEOzpGjjEzcukb2DSSwI+nujI9tjJpXJoXPd4LoO/b/WUlPBdWnG8zAtmp5TzB2 nNaukFSb5WqdPaaBaBnP5aY7ZTeRITDz0UFTg= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:date:from:to:subject:message-id:in-reply-to :references:reply-to:organization:mime-version; bh=nsdlcZl7BzkImo+L+EEhfmvt8SviQ3XfdcqJrKuUhDM=; b=GUjfr+OCuNRjxHcZMxfA13nEzEqU0xtMfiGbhZQmWykHQsU9PZBleACeokYdzpPvbK WjWpzq+csdPEQQ+HouKJyI7HOFzsZIJdlxaXjKwLhFSOjNp9+8caS6+bruvf796T2NlF tKd00HfTT7MJZyM57zLmoOz+Q4b6bCXBcH0sBjcnfL7unb61YDrV50gTHIC14ULKJyUe YWx6400ILVBPirMBDNcJbjDvG5QP8ez6SdrOzbeSHZy0r6GkvbxPyxO69rfC+3vAoY5O Mhn9u3M2DayFAicNR1ARWqQ8oNiMV1UokkoUXozHaR7lASLyepRX/7R6lQZsHKr7I/WS 21qw== X-Gm-Message-State: AOAM532G/HrFyMC0JyCpbuqoY676/6LD/h0mc2YroZ47r0Xqs2zrPfiz KFpMP5az0kWKYCxkG+OAezcoMaWQHAIuOQ== X-Google-Smtp-Source: ABdhPJzgRfQIwY2oXTOtHB/DoVlZLJJ3TzOaBUMCymeOh/0ivmBeKOxnWpiLmrl+GFQCEZZrKxwV8A== X-Received: by 2002:a05:6214:c27:: with SMTP id a7mr14450046qvd.54.1616261032549; Sat, 20 Mar 2021 10:23:52 -0700 (PDT) Received: from scorpio.seibercom.net (cpe-174-109-231-236.nc.res.rr.com. [174.109.231.236]) by smtp.gmail.com with ESMTPSA id p8sm6259405qtu.8.2021.03.20.10.23.51 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sat, 20 Mar 2021 10:23:51 -0700 (PDT) Received: from localhost (zeus.seibercom.net [192.168.1.1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) (Authenticated sender: jerry@seibercom.net) by scorpio.seibercom.net (Postfix) with ESMTPSA id 4F2nft5jfLz1yh9 for ; Sat, 20 Mar 2021 13:23:50 -0400 (EDT) Date: Sat, 20 Mar 2021 13:23:39 -0400 From: Jerry To: freebsd-questions@freebsd.org Subject: Re: OS to replace FreeBSD Message-ID: <20210320132339.00004d9a@seibercom.net> In-Reply-To: References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> Reply-To: freebsd-questions@freebsd.org Organization: seibercom.net X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.33; i686-w64-mingw32) MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/I9E2D7Xt/_+h=ENi4L6yv9q"; protocol="application/pgp-signature"; micalg=pgp-sha256 X-Rspamd-Queue-Id: 4F2nfx6YTKz4mYD X-Spamd-Bar: ++++ Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seibercom.net header.s=google header.b=kYPuZhwh; dmarc=none; spf=pass (mx1.freebsd.org: domain of jerry@seibercom.net designates 2607:f8b0:4864:20::f36 as permitted sender) smtp.mailfrom=jerry@seibercom.net X-Spamd-Result: default: False [4.14 / 15.00]; HAS_REPLYTO(0.00)[freebsd-questions@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; GREYLIST(0.00)[pass,meta]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; TO_DN_NONE(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[seibercom.net:+]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RECEIVED_SPAMHAUS_PBL(0.00)[174.109.231.236:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; REPLYTO_EQ_TO_ADDR(5.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::f36:from]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; ARC_NA(0.00)[]; R_DKIM_ALLOW(-0.20)[seibercom.net:s=google]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-0.26)[-0.263]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[seibercom.net]; NEURAL_SPAM_MEDIUM(1.00)[1.000]; RCPT_COUNT_ONE(0.00)[1]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::f36:from:127.0.2.255]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::f36:from]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 17:23:54 -0000 --Sig_/I9E2D7Xt/_+h=ENi4L6yv9q Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable On Sat, 20 Mar 2021 02:38:49 -0600, @lbutlr stated: >As I understand it, the controller was always broken (returning an >invalid and illegal ID?) it's just that FreeBSD tried to properly >parse that ID and fails. Who know, there are probably security >considerations. I know I do not want my system rusting a errant USB >port considering the security disater that USB is. Can you provide verifiable proof of that statement relating to the know defect in the USB controller? I had a Dell technician online a few minutes ago, and he claimed that there was no such defect known to exist in that unit. If you could provide me verifiable proof that the controller was defective, I could make a case for them to replace it. There counter was that Free BSD created a bug when they moved to version 12.x and it is not Dell's problem to correct it. His statement made sense since versions <=3D 11.x do work correctly. --=20 Jerry --Sig_/I9E2D7Xt/_+h=ENi4L6yv9q Content-Type: application/pgp-signature Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQGzBAEBCAAdFiEELeCiu2K+9VmEYYgTgHBP8gv9FXcFAmBWL58ACgkQgHBP8gv9 FXd/SQv9F5YQof9HZmfg5/ahuPnBtMqcv9JJJh4ka7LOyPX5W2UBeLP3zy/lQHrm ZCQvVeWR+RhHJsQh6Maud+R59Tcnec1yuBjNBtrCQ1XtXLdIhzN1qZ2sFVEJYW5e c15YZzpM73XqJAb8POE5HyIoz7A9BuMJB00BgON3uhPVT10CLNHkcVLtOQNjIngQ N6L8amiesgpxecQSpeP6qGqYPw52oTx/QOO+rPM+P4q11KJGH5cGGQK9x+q9lMU9 oWrekfDULbe6Fp11+SDlsPIm1dqhidMCTQCJgLbm2sjKaBwAPh7YrnUDKul6LhEA 7XQDtZSaWWDCWqKAsNDAfBrXgaCtItv5tFz9zY8iyGoFL+RSDdzCM8hQy+atpKZ3 HjSrqWDg8h8GZ2PtBSLAnVRwDCvoKuASM7h4HhP7fciVhsBBQEKBFAJaKmOBCAcz uSPbNK9RuVL8YLaoswCLD30L3xZHKxB8TZh5oMS7dBNi0mLv7veCM3cM1c0Num7t Tkg8Jsp3 =m0g9 -----END PGP SIGNATURE----- --Sig_/I9E2D7Xt/_+h=ENi4L6yv9q-- From owner-freebsd-questions@freebsd.org Sat Mar 20 17:38:10 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 13A345AFE14 for ; Sat, 20 Mar 2021 17:38:10 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lj1-x22c.google.com (mail-lj1-x22c.google.com [IPv6:2a00:1450:4864:20::22c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2nzP0d0dz4n8B for ; Sat, 20 Mar 2021 17:38:08 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lj1-x22c.google.com with SMTP id 184so15886234ljf.9 for ; Sat, 20 Mar 2021 10:38:08 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=u2U6wpKh9sSEPgYn9Quga0x5kQeAoDFih178lzJ/Mhw=; b=ptj/dV5EnDQFukzZOkQAoNQ15OcSCZmwOAKYeY+AiNAZbm1lKopBw1zEgIgl7D1Hhl MbCrnOTjl8H6UATpAOIvu6s+bEh0BSNj6D5Wyxv5NYlq1mMFRZerqUM6Znk9gsqKvTJd uXi+vEBsNFJVDM0cdr4YDcVn+nJ/g+8zK+MDoouCaW6mKIf+Q1q7CzE4kDXaNbf0Fpzq M4y/ZN3MIF3YIXaQ403pbcUO6OQICLxNf+pBdIud8QTthBmAsrVlVXwcQ1xkU6nfmUHv IEdVNccbPAYPh2edXByqZfPZGO86tuTqrHrYr3BuiOEBH1OBBMAp6pOMcc34yn4dheL8 Cn8g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=u2U6wpKh9sSEPgYn9Quga0x5kQeAoDFih178lzJ/Mhw=; b=LKL58Hrn9lqkdL1GIYJ28aKy+OG/qah0KFZoyz9aMVsdxLQBGed89mXEVWuZmc4g6r QFdIMIjJh1zuIH/VHGmnypdcEAbfrMdjP5R/YR6B0rmicieWtEwbNApLjQNFECP5tx0z e1TUyLhsDjSHhbwMljxHnJbwER80/ZGih0I5ldq7RRIV2ZyzZm0YuREjX+1yYnmr3N9G naxTmNtvpWAOgu4xvs7xhGxXAjZXGlI5pWpDyZ4zBtXSAAydkfdpWMRR2WyNxXtX/KqG BqK7zjcBQUb0xgbZdw/WOoWUpY1dt63CZlBcmyz90xYKUC3F57FiNl2VFgD39HwydiEG 2pLg== X-Gm-Message-State: AOAM530ehlXLmLkm14qmoZbgAt4/T7XCeuBvsm/dM8mVfsjt3USke5Wa fMdU6PNxU2RunFLBI1Aa0BkZ19fW32HKfyczCjhPcrzVzrFifr8= X-Google-Smtp-Source: ABdhPJwt/blx/IHYvtlONrNqUi84HqxbaaLrli+u6E+nrrjByMnH/rTibbRtY7VLm1Z3xk9sk7aBgDCq6TAvlAqC5/c= X-Received: by 2002:a2e:b5b9:: with SMTP id f25mr4427802ljn.90.1616261886184; Sat, 20 Mar 2021 10:38:06 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: From: Mohammad Noureldin Date: Sat, 20 Mar 2021 18:37:56 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: Valeri Galtsev Cc: FreeBSD X-Rspamd-Queue-Id: 4F2nzP0d0dz4n8B X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=ptj/dV5E; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::22c as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; ARC_NA(0.00)[]; R_SPF_FAIL(1.00)[-all]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[thelightbird.com]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::22c:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::22c:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::22c:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions]; RCVD_COUNT_TWO(0.00)[2] Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 17:38:10 -0000 Hi Valeri, On Sat, Mar 20, 2021 at 3:15 PM Valeri Galtsev wrote: > > > > On Mar 20, 2021, at 7:01 AM, Mohammad Noureldin < > mohammad@thelightbird.com> wrote: > > > > Hi all, > > > > I am new to this mailing list, using FreeBSD/*BSD on and off. Joined th= e > > mailing list because I have a couple of project ideas that I want to > build > > on top of *BSD. > > > > Though I am new, and maybe relative to many others here I am a newbie, > > allow me to comment on all the aspects addressed (so far) in this email > > thread: > > > > - "It is easy to build a new (custom) kernel", "Unix is made by technic= al > > people for technical people", etc: > > > > Though historically it is true that Unix like systems are made by > technical > > people for technical people, it doesn't mean that it has to stay like > this. > > IMHO, such motto causes a great piece of Engineering like *BSD to loose > > ground for other Unix like systems, namely Linux and all it's Distros. > Not > > that I am a Linux hatter, I have respect to both. > > > > Related to that, I don't believe that it is a good message to FreeBSD > > users, that if you don't know how to build a new kernel, then there is = no > > place for you here. IMHO, this really hurts the image of the community = of > > FreeBSD specially in the eyes of new commers. Notice these email messag= es > > are archived. > > That was said by only one - very loud - member of FreeBSD community, > people here are much milder and way more polite. And I for one do not sha= re > the view that FreeBSD in particular and open source systems in general ar= e > only for people with [some] technical knowledge. > That was exactly my point :) . One reason to share my opinions, though I am new here, is that I have 100% trust in the openness, inclusiveness and friendliness of the FreeBSD community. But some conversations may be read in the wrong way in readers didn't read the details of the discussion. > > 1. Installation of FreeBSD is quite streamlined (and same are Debian, > Ubuntu=E2=80=A6) > > 2. Interaction with machine is same nice as closed source systems' once > you have Xwindow installed (here FreeBSD may need a bit effort compared t= o > Linuxes I mentioned) > > 3. Compiling kernel. In general this suggest that I repeat here what I > tell my users who never used Linux or UNIX: how many commands do you need > to know to start using shell? 4 - 5, I=E2=80=99ll show you them in a minu= te. Then > you just start, =E2=80=A6 and this is really true. Compiling kernel is ju= st another > 3-4 commands. It is simple, no need to hold people from doing it > > > - About the problem reported: > > > > Thanks for all who went through the long list of comments on that PR an= d > > explained in brief that it is a USB controller/HW problem. > > > > In that respect, I do agree with Jerry and others wondering how other > OS(s) > > can manage running on the same HW (in case that has been proven) ? I > > believe it worths looking at that. I would have volunteered to dig deep= er > > into that, but I know I don't have the required experience (unless > someone > > is willing to mentor me ? :) ) > > No comment on this specific troublesome hardware. Linux in my observation > has many =E2=80=9Cworkarounds=E2=80=9D to deal with misbehaving hardware.= FreeBSD may be > acting =E2=80=9Ccleaner=E2=80=9D here, hence stays more stringent system,= but experts may > correct me. I still remember one chipset which is NOT worth effort writin= g > driver for: BCM 43xx Broadcom WiFi. That is 32 bit chip, sitting on 64 bi= t > bus, no need to add more detail after that. > > > And responding to that:"OK, just shut up and go install another OS", is > not > > a community building attitude at all. > > I agree, saying that is not polite. Better just ignore the OP. Which I > observe many experts did, though several tried to help. Way back before > first asking for help on one of technical lists I read list etiquette > carefully, and there are several things to keep in mind, the OP didn=E2= =80=99t show > some of them (not all definitely). Just some of what I remember: > > Before asking for help, try do resolve issue yourself within your ability > > Describe what you tried and give all details; this simultaneously will > show that you did put effort on your side, then you will less likely to b= e > ignored > > Disrespect to others is likely to make you ignored > > Read carefully suggestions and try to follow them. Report what worked and > what didn=E2=80=99t. You at least have to respect time and effort of expe= rts trying > to help you. > > -- > I stop here just by saying, please, everybody, do not take this as an > attempt of =E2=80=9Cmentoring=E2=80=9D, but someone may find truth in the= above; I for one > did. > > > I have just one comment on the hardware choice: this one is one of Dell > =E2=80=9Cconsumer grade=E2=80=9D products, which is not intended to last,= I wouldn=E2=80=99t choose > it myself. They look cheaper upfront, but they end up more expensive in a > log run. Dell OptiPlex (not much more expensive) would have been my choic= e > of the same class of hardware. > > Be it me, I would go with one or both of solutions already suggested in > the thread: > > 1. Disable in BIOS on board USB and add USB card if necessary > > 2. Recompile kernel with switched off USB-3. The first for me would be > preferable, just to not keep recompiling kernel once kernel security > patches are released (but that is me, lazy person) > > > Good luck, Jerry, in resolving your technical issue. > > Valeri > > > And for the sake of discussion, let's assume for a second that Jerry is > > lazy or not skilled enough, helping him and fixing the problem or clear= ly > > explaining a solution without bashing him, is not just for Jerry, it is > for > > the whole community, for the current and new members who will be > interested > > to join in the future. > > > > Jerry, I am curious, did you have time to try one the suggestions, > > specially running FreeBSD on a VM to see if it still suffers from the > same > > problem ? > > > > You all have a great day/evening > > > > On Sat, Mar 20, 2021, 11:35 Jerry wrote: > > > >> On Fri, 19 Mar 2021 18:30:00 -0400, Aryeh Friedman stated: > >>> On Fri, Mar 19, 2021 at 4:32 PM Ralf Mardorf > >>> wrote: > >>> > >>>> On Fri, 19 Mar 2021 11:16:33 -0700, freebsd@johnea.net wrote: > >>>>> Void uses a runit init system with no systemd > >>>> > >>>> Hi, > >>>> > >>>> I suspect it's not a good idea to use Linux without systemd. For > >>>> example, by upstream udev is part of systemd. Maintaining Linux > >>>> without systemd is a bottomless pit. > >>>> > >>>> On Fri, 19 Mar 2021 13:35:21 -0400, Aryeh Friedman wrote: > >>>>> Recompiling the kernel is *TRIVIAL* if you refuse to do it then you > >>>>> should not be using any Unix variant > >>>> > >>>> I dislike this tone of voice. However, I agree that compiling the > >>>> kernel might be less effort, than migrating to another operating > >>>> system. If you would e.g. migrate to Arch Linux, you need to get > >>>> used to systemd. Getting used to systemd isn't pleasant. If you > >>>> chose a Linux distro that doesn't use systemd, you likely will > >>>> experience all kinds of trouble, if you want to customize your > >>>> install. > >>> > >>> I used that tone because it really is simple and if you can't/won't > >>> recompile the kernel before throwing the baby out despite with the ba= th > >>> water then you really don't have the skills/desire needed to use Unix > >>> effectively... Just to show how trivial it really is > >>> > >>> 1. Edit /usr/src/sys/amd64/conf/GENERIC (or i386 instead of amd64 if > >>> your still using it) to comment out the xhci line (line 327 in > >>> 12.2-RELASE-pl3) to remove USB 3.0 support > >>> 2. cd /usr/src > >>> 3. make kernel > >>> 4. etcupdate > >>> 5. reboot > >>> > >>> Done.... how hard is that? > >> > >> I never said I could not compile a new kernel, I said I could not > >> install the OS. Correct me if I am wrong, but doesn't the installation > >> of the OS precede the creation of a new kernel? Furthermore, the > >> screen just rolls away filling up with the error message ad infinitum. > >> > >> By the way, as I understand it, creating a custom kernel nullifies the > >> use of "freebsd update". Wow, things just keep getting better & better= . > >> > >> What I cannot understand is that FreeBSD knows it has a problem, one > >> not shared by any other OS as far as I have been able to ascertain, > >> and I have done a lot of research, and they refuse to fix it. The > >> problem did not exist before version 12.x, so it is not like they neve= r > >> were able to get it right. > >> > >> -- > >> Jerry > >> > >> > >> > >> > > _______________________________________________ > > freebsd-questions@freebsd.org mailing list > > https://lists.freebsd.org/mailman/listinfo/freebsd-questions > > To unsubscribe, send any mail to " > freebsd-questions-unsubscribe@freebsd.org" > > --=20 Mohammad Noureldin Founder/Owner The Lightbird From owner-freebsd-questions@freebsd.org Sat Mar 20 17:51:57 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5F6DE5B063E for ; Sat, 20 Mar 2021 17:51:57 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-yb1-xb30.google.com (mail-yb1-xb30.google.com [IPv6:2607:f8b0:4864:20::b30]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2pHJ3Pqpz4pNn for ; Sat, 20 Mar 2021 17:51:56 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: by mail-yb1-xb30.google.com with SMTP id h196so1822110ybg.1 for ; Sat, 20 Mar 2021 10:51:56 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=zLPIsbwmuJlgyGatn4WRmQws7OImgMInCuK6UKY1hcI=; b=D+PBtDvd575d1xPB4wr3G9092hVfsOgUaK/BQ1NUoqLdCJ8Gr/jV7cOEUKGQ3zPmDw Pp2+OMR4HWi39XtdizC+akdN9yndyA2V9yv7Tq2sHgga7eq6uw/fq61sgJ8BRJ/Mpyht 48HPRYmblS45agtV4lENBTj7sWbcRtP4KsAoRrNiwpl0AwdD8Hl5QPXh8ekZd7ivWI3C HZZcppU68GmrZyXuht1oYUMOFlb0KRbqCt1xl4T9UdTOo1iDqZ9X361Oil8B3wDvTssv qLBVuPWm6cdss84YolWFbIOI/5AKVlMG2JaNfb5+suXJ7TKjd4K10xHqY+weeDFUU/O3 0IfA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=zLPIsbwmuJlgyGatn4WRmQws7OImgMInCuK6UKY1hcI=; b=hWyORveUTdk8zU85qH/aMiWaPY2q6059ymQ9Uida0OsmAwsRd/FpOlFuzs5p7Jv8Mh VBppfv6Ea6FamGLlwZVnOuSbf99NwbNRJHD+/PDtCizyMxH0WGfW54ikO3jUP6Q4AZY/ +YNEPx7wj815g67iaAJdM8uYKlu3hC3JYcpxLe92cJhbeoWFsoRNxQKpkLWHoNIRvX+g c7FcQvvs9Er9/9zTqpk4XrKbr04iKXJqXJ/TisueSvKvk0dpKPbocirpCkw9Lf6jsJR9 E9pX0Or2ttEdg+0NHkG47VIgksSWsBGnGlxC8t5mZYk78arPDsqA/MmoyPrTltfMuIsE +7FQ== X-Gm-Message-State: AOAM532p/aiRWZElOBdO9fhdhnGi+Qg3GZ8XRapv7Ii8mWbVSBgcu5gU fiiFKK6N8B/qE50twtqFqzhw5vizw3Uq2MxLgMnhtToNhxQ= X-Google-Smtp-Source: ABdhPJz6GwqNZeOzw8zsK9O2F5xy1T2B+vXZ7jSkOQjI3zrNDrL5hXooX2EdoBCldhWgiVs17gS3FhBmuuLpV4POTkM= X-Received: by 2002:a25:5146:: with SMTP id f67mr14514949ybb.332.1616262715636; Sat, 20 Mar 2021 10:51:55 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: From: Aryeh Friedman Date: Sat, 20 Mar 2021 13:51:44 -0400 Message-ID: Subject: Re: OS to replace FreeBSD To: Mohammad Noureldin Cc: Valeri Galtsev , FreeBSD X-Rspamd-Queue-Id: 4F2pHJ3Pqpz4pNn X-Spamd-Bar: --- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20161025 header.b=D+PBtDvd; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of aryehfriedman@gmail.com designates 2607:f8b0:4864:20::b30 as permitted sender) smtp.mailfrom=aryehfriedman@gmail.com X-Spamd-Result: default: False [-4.00 / 15.00]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36:c]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2607:f8b0:4864:20::b30:from]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; TAGGED_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20161025]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[3]; NEURAL_HAM_LONG(-1.00)[-1.000]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; SPAMHAUS_ZRD(0.00)[2607:f8b0:4864:20::b30:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::b30:from]; RCVD_COUNT_TWO(0.00)[2]; RCVD_TLS_ALL(0.00)[]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 17:51:57 -0000 On Sat, Mar 20, 2021 at 1:38 PM Mohammad Noureldin < mohammad@thelightbird.com> wrote: > > > That was said by only one - very loud - member of FreeBSD community, > > people here are much milder and way more polite. And I for one do not > share > > the view that FreeBSD in particular and open source systems in general > are > > only for people with [some] technical knowledge. > > > > That was exactly my point :) . One reason to share my opinions, though I am > new here, is that I have 100% trust in the openness, inclusiveness and > friendliness of the FreeBSD community. But some conversations may be read > in the wrong way in readers didn't read the details of the discussion. > You are missing the point I was making with the original comment on the who and why Unix was designed. It was not to say that it is only for technical people but it was to say when you run into an issue that requires you to dive into deeper water then normal you have no right to complain about how the deep end was designed to be so deep.... it was designed that way because you need deep water to safely have a (high) diving board to jump from when your doing more than just swimming laps.... so if you don't know how to swim (you only know how to float/dog paddle) you should not attempt to swim in the deep end... in this metaphor Unix (without a lot of very fancy GUI work like Apple does) is the deep end... i.e. you might not need or use the diving board but you have no right to complain about there being a deep end if you decide to do full pool laps (it is on you to get the skills needed to be in the deep end before entering it). -- Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org From owner-freebsd-questions@freebsd.org Sat Mar 20 18:21:06 2021 Return-Path: Delivered-To: freebsd-questions@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id AE0975B11E1 for ; Sat, 20 Mar 2021 18:21:06 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: from mail-lf1-x131.google.com (mail-lf1-x131.google.com [IPv6:2a00:1450:4864:20::131]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1O1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4F2pwx5ZlNz4qmq for ; Sat, 20 Mar 2021 18:21:05 +0000 (UTC) (envelope-from mohammad@thelightbird.com) Received: by mail-lf1-x131.google.com with SMTP id g8so7849447lfv.12 for ; Sat, 20 Mar 2021 11:21:05 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=thelightbird-com.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=7xukxKZ98hmyoWvTzJZeV+BloCtdxOv383bL2Cl1xwU=; b=HlnDAxG0mdAyTyfyoT89C/uEWWj78uz+U606K8tyKTLhRsQmv/1O0VdYcYOcbtKcw2 G7eOSe33CINqO8qZBj6t3KXQ5Owd3m1a2e59N3IQ5Ch1vQwq0x0ZYSfXhCZ9UAS9s3tT 6V5+03f8dy5vbA5TVm37nEYEEQPOy7duoymS7q+prAkAgumluVAJ3jWOJHp5TajnFeJQ euX6jWUpfYtc+fgr3xZXtoW6KdGTNoppCQ2Mv3vlWMPhQLaL0LGBMAR4PE22uCJPdwIB PSeMxOe9Pg1LUgxTVbVmA0c8H2/mgQiv7UflFYslRL8WCVjH4koZnkm+llb9e++hwHTj 0kaQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=7xukxKZ98hmyoWvTzJZeV+BloCtdxOv383bL2Cl1xwU=; b=NAQcKi5NoALIETO1FUmG+Xj7bRaJjVS3ISzWZRyJ1DdOdY9aQwfCoYYD/5Iqg1uJLX 897wYccDKWXiiWV46gcmhbYoAKcNEkHBEE4zuWe+Y2DqSrDbD434vxra38Ra84vHSsw6 AzXbj8rn9UkqInXTlzMmGDWLOYhWXLNzsnDcIjU+ZmbMf6gxVnX8zx/ccdVYvM3/Yk7j +yCUguLJrHTEklJ4Xbnrgh6JOnWqQVXX44eTehRsf44YEu2Ls7bW/PcIWriULk2h0/7x cxCviyx2hCghn+fGdr51tPNWJykpDsIobCr+UW8u2z3mhrfsXSGyteDvkNLTG4oFY73W 4zPw== X-Gm-Message-State: AOAM533T3F+sOUbIU2DatqYqSrufHNWtt1fekaZHA/iFDNuIcfqc2c51 WF/BYh86QHk87EiSWzFWDJEdzbJy38Nd46Cq2UKR X-Google-Smtp-Source: ABdhPJykwv4m9re+eG3drhrFpC41ArrispylEHtSqYOd6XzOOwhGCSz3mfbmAGnlambf8P5ulF6wIcqbWK7ouQtYxbU= X-Received: by 2002:a05:6512:314d:: with SMTP id s13mr4024052lfi.95.1616264461731; Sat, 20 Mar 2021 11:21:01 -0700 (PDT) MIME-Version: 1.0 References: <20210319101040.00005c35@seibercom.net> <6054BE1B.50706@gmail.com> <20210319130249.000042a1@seibercom.net> <5a8cf0be-646a-a433-2428-9700a47c1bf0@att.net> <20210319140448.00007521@seibercom.net> <20210319213214.4f8ddf55@archlinux> <20210320063427.000040f5@seibercom.net> In-Reply-To: From: Mohammad Noureldin Date: Sat, 20 Mar 2021 19:20:52 +0100 Message-ID: Subject: Re: OS to replace FreeBSD To: Aryeh Friedman Cc: FreeBSD X-Rspamd-Queue-Id: 4F2pwx5ZlNz4qmq X-Spamd-Bar: -- Authentication-Results: mx1.freebsd.org; dkim=pass header.d=thelightbird-com.20150623.gappssmtp.com header.s=20150623 header.b=HlnDAxG0; dmarc=none; spf=fail (mx1.freebsd.org: domain of mohammad@thelightbird.com does not designate 2a00:1450:4864:20::131 as permitted sender) smtp.mailfrom=mohammad@thelightbird.com X-Spamd-Result: default: False [-2.30 / 15.00]; RCVD_TLS_ALL(0.00)[]; R_SPF_FAIL(1.00)[-all]; R_DKIM_ALLOW(-0.20)[thelightbird-com.20150623.gappssmtp.com:s=20150623]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; TAGGED_RCPT(0.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[thelightbird.com]; SPAMHAUS_ZRD(0.00)[2a00:1450:4864:20::131:from:127.0.2.255]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[thelightbird-com.20150623.gappssmtp.com:+]; RCPT_COUNT_TWO(0.00)[2]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::131:from]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FREEMAIL_TO(0.00)[gmail.com]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RBL_DBL_DONT_QUERY_IPS(0.00)[2a00:1450:4864:20::131:from]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_TWO(0.00)[2]; MAILMAN_DEST(0.00)[freebsd-questions] Content-Type: text/plain; charset="UTF-8" X-Content-Filtered-By: Mailman/MimeDel 2.1.34 X-BeenThere: freebsd-questions@freebsd.org X-Mailman-Version: 2.1.34 Precedence: list List-Id: User questions List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 20 Mar 2021 18:21:06 -0000 Hi Aryeh, On Sat, Mar 20, 2021 at 6:51 PM Aryeh Friedman wrote: > > > On Sat, Mar 20, 2021 at 1:38 PM Mohammad Noureldin < > mohammad@thelightbird.com> wrote: > >> >> > That was said by only one - very loud - member of FreeBSD community, >> > people here are much milder and way more polite. And I for one do not >> share >> > the view that FreeBSD in particular and open source systems in general >> are >> > only for people with [some] technical knowledge. >> > >> >> That was exactly my point :) . One reason to share my opinions, though I >> am >> new here, is that I have 100% trust in the openness, inclusiveness and >> friendliness of the FreeBSD community. But some conversations may be read >> in the wrong way in readers didn't read the details of the discussion. >> > > You are missing the point I was making with the original comment on the > who and why Unix was designed. It was not to say that it is only for > technical people but it was to say when you run into an issue that requires > you to dive into deeper water then normal you have no right to complain > about how the deep end was designed to be so deep.... it was designed that > way because you need deep water to safely have a (high) diving board to > jump from when your doing more than just swimming laps.... so if you don't > know how to swim (you only know how to float/dog paddle) you should not > attempt to swim in the deep end... in this metaphor Unix (without a lot of > very fancy GUI work like Apple does) is the deep end... i.e. you might not > need or use the diving board but you have no right to complain about there > being a deep end if you decide to do full pool laps (it is on you to get > the skills needed to be in the deep end before entering it). > I see what you are trying to explain. Again no real difference or objection here. Some topics are indeed clear deep water and I do agree with you that if someone who barely knows how to swim, they should not just dive in that deep water. But some other points are not deep for some people while it is for others, and there where we need to be helpful, which I am sure we are. As I said, I have full trust in our FreeBSD community, so lets not keep going into that circle a lot :). > > > -- > Aryeh M. Friedman, Lead Developer, http://www.PetiteCloud.org > -- Mohammad Noureldin Founder/Owner The Lightbird