From nobody Wed Jul 12 18:09:56 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R1Qkn1xZ8z4mmbb for ; Wed, 12 Jul 2023 18:10:09 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R1Qkn1lKfz4Wgy for ; Wed, 12 Jul 2023 18:10:09 +0000 (UTC) (envelope-from eduardo@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689185409; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=BphJpEvyPDgp2SCl9e8W2/96XYLU3AXY6dQ/kD+ixbc=; b=MQNgRewVFBGGUCgr+bKL45l/WOfxcDk1aaS9T94BeQIhryOMBkM8kXMddd1rx3icOxGZqn jjUCJpr4xHzeHDwinKHqnlut/Q7cn5wIh72Hx1Spqlah3BOJ61HQM5j0+kQNW+iwCKTLrq /qFbJxa1eYUQGyv6q0KSAJ0KGLeChELhFOwzt4U5sDQJyP4WkWE9IPlyJK0ZbYSJrr4Xbo pzbmjdJ7nlqxyEYqawOaotT2/XA6CUP0SRMjhVwfXbcef+7G8A527ucgcbACV9RS7XtmK9 NwhztfsddEzxlfe1HBpXgMUew6XJWYF0BjcKguVX9cLPycvnLm4tvq0kuKIYTw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689185409; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=BphJpEvyPDgp2SCl9e8W2/96XYLU3AXY6dQ/kD+ixbc=; b=RbfEQJn7GB5BacvcC1ThCoMPOVVMUXEc81rO4EBJU/dAyiZVS2s1TRQeOXrbtZcMwCF7Hp FEJ+SjJk+obWRpchw1pynx7DGZBU79Ky38yMBQZIk4moyrQsK0EJoGYK5zTo8Buc3RvWS+ HKMjmojQWNTp9o5J3oIitrdsbMdAE2cImzLRBdg6vFmGnT7CK3X5Ddw0a+Ob8Ttqc91jp7 ZRLfx0PXkA3RHQSXB1Dk78JGXD7dh4YZgkLV9QxtQmffJ9nWL2gUq3rtpme0Hp1Y1yx1HL LYz1uHRvPP4QwlS7RS6TLqe+8kayQyTGKjgLIRG608Rs1Pnszuyv20Z/78GP2g== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1689185409; a=rsa-sha256; cv=none; b=xqBCAzS5mgUXpa5RXbr6RJ5lr5q/N7ViYAUZJi/fN2P29tTwvbTrGuuJZyiXK6XUKtu7Sc vESytPK7iGQ+T3eAGzYxQwHDjh9UvgwXvX9163qD28Dn+fGOCGmlSTF8ZK5iHWaLGCTqpG szqVhYvYzwBE8kOC45sK+vWYiIH0cAQryprhyp8Qzlc0ydEHAba6QQnbtRm9+Gj6bDrqse 0DE8pfMKjU84Fvz3ElbEI0j7KJSJ51TI1NQ7jhBNFW+p+MaqTnT0aPVKMI7c7Jr8oax1Ne YGFIAZSsxJmaoCdqiHzvG/Qp9AInaLmJNRNfCceZVNT45nioFMO9Y5+y8bsb1w== Received: from mail-qt1-f174.google.com (mail-qt1-f174.google.com [209.85.160.174]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) (Authenticated sender: eduardo) by smtp.freebsd.org (Postfix) with ESMTPSA id 4R1Qkn0gg2z10RH for ; Wed, 12 Jul 2023 18:10:09 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: by mail-qt1-f174.google.com with SMTP id d75a77b69052e-403a7066d9bso28418161cf.3 for ; Wed, 12 Jul 2023 11:10:09 -0700 (PDT) X-Gm-Message-State: ABy/qLZHx2dGS0k1wU+kY/cOw0+3s3gpamjwLnAr+jA7K9BTXzNw0ohL iEUnRx+BQmG0e3vVDUR5TNR+ZbBXcIhrMAJ76ag= X-Google-Smtp-Source: APBJJlGKrUu+M2xAKqAmJBlPpDRPa7eQiOafG44DYld43ijJMWGF1o2Uet+R5XLo1sbBmGSwj4j7d9Wb1o8Ca49H8Sg= X-Received: by 2002:a05:622a:486:b0:3ff:407e:12 with SMTP id p6-20020a05622a048600b003ff407e0012mr21680309qtx.25.1689185408347; Wed, 12 Jul 2023 11:10:08 -0700 (PDT) List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 References: <99542360-6350-4636-A9EA-CA9BBCC93C60@yahoo.com> <5D8D94E2-781D-4945-B721-EDD0BF56A8F2@yahoo.com> <70CC43FC-2055-409E-A94E-76F934C14AE2@yahoo.com> <5875BDD2-B792-4FE1-8F42-99D996CAE71D@yahoo.com> <7D1BE218-B8B5-40EB-8CF3-C09CDEABA9C3@yahoo.com> In-Reply-To: From: Nuno Teixeira Date: Wed, 12 Jul 2023 19:09:56 +0100 X-Gmail-Original-Message-ID: Message-ID: Subject: Re: keyboard doesn't work at Boot Menu To: Mark Millard Cc: freebsd-arm@freebsd.org Content-Type: multipart/alternative; boundary="00000000000039817e06004e20f0" X-ThisMailContainsUnwantedMimeParts: N --00000000000039817e06004e20f0 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Hello Mark! Great news: I can confirm that rpi official keyboard works as intended and boot menu works. Thanks! Mark Millard escreveu no dia domingo, 18/06/2023 =C3=A0= (s) 00:36: > On Jun 17, 2023, at 16:01, Nuno Teixeira wrote: > > > - tested it on both USB2 and USB3 ports and same error. > > - added a gamer keyboard on all ports and same error. > > - tested with both keyboads connected, but only one get error from the > normal keyboard, both failed with same error :) > > > > at boot time, none keyboards work. > > at login time, both works. > > > > I'm very curious about raspberry original keyboard! I will buy it next > week. > > Most of the keyboards that I have access to are > much older, many of then from Apple. There is > only one PC USB gaming keyboard and mouse, not > that they were ever used for such. There is > just the one RPi keyboard and mouse. > > I used the more modern, fairly common keyboard > because trying to figure out if old equipment > related failures are actually the same type of > failure did not seem reasonable. Trying to > match old equipment for comparison/contrast > activities did not seem reasonable either. > > That the modern keyboard happens to be an RPi > one is an accident. > > > Thanks very much for this awesome time that I learned more. > > Thanks for your patience! > > > > And I will stay tuned for updates on firmware and continue testing > stable/current snapshots to check if boot is fixed. > > > > Cheers, > > > > Mark Millard escreveu no dia s=C3=A1bado, 17/06/202= 3 > =C3=A0(s) 23:41: > > On Jun 17, 2023, at 15:28, Nuno Teixeira wrote: > > > > > I think I found the cause! > > > > > > Please take a look at photo. > > > > > > "Scanning xhci_pci devices... Failed to get keyboard state..." > > > > That message was displayed by U-Boot before the > > FreeBSD UEFI loader was even loaded to memory. > > > > The FreeBSD UEFI loader operates by using U-Boot > > services. If U-Boot fails to set up the keyboard > > input, the same would be true in the FreeBSD UEFI > > loader (beastie or otherwise) until FreeBSD's > > kernel does its own bindings and things get another > > chance at working. > > > > (A similar point goes for storage media that U-Boot > > fails to set up.) > > > > Is the keyboard plugged into a USB2 port? USB3? Have > > you tried both ways? > > > > It does seem that the system and keyboard are not > > well matched. > > > > > After a while it gets detected during boot. I've pressed enter key an= d > I saw it creating empty line at boot. > > > Maybe it's a keyboard problem? I'm using a very cheap one (not > raspberry original) > > > > > > Thanks > > > > > > Mark Millard escreveu no dia s=C3=A1bado, 17/06/2= 023 > =C3=A0(s) 23:08: > > > [Commenting out beastie_disable=3D"YES" and loader_color=3D"NO" > > > in stable/13.] > > > > > > On Jun 17, 2023, at 14:42, Mark Millard wrote: > > > > > > > [This time I add continuing the sequence to test the stable/13 > snapshot.] > > > > > > > > On Jun 17, 2023, at 13:56, Mark Millard wrote: > > > > > > > >> On Jun 17, 2023, at 13:53, Mark Millard wrote: > > > >> > > > >>> I'm just making a status report for my experiments. > > > >>> > > > >>> I did a: > > > >>> > > > >>> dd if=3DFreeBSD-13.2-RELEASE-arm64-aarch64-RPI.img of=3D/dev/da1 = bs=3D1m > conv=3Dfsync,sync status=3Dprogress > > > >>> > > > >>> I made no adjustments. > > > >>> > > > >>> I then tried using the USB3 media to start a boot of > > > >>> a 8 GiByte RPi4B. It took my typing to the RPi > > > >>> keyboard just fine: I did not have to wait for > > > >>> the timeout when I hit . The (official) RPi > > > >>> keyboard was plugged into a USB2 port. > > > >>> > > > >>> Unfortunately there is a known issue for my context where it > > > >>> gets: > > > >>> > > > >>> uhub_reattach_port: port 3 reset failed, error=3DUSB_ERR_TIMEOUT > > > >>> uhub_reattach_port: device problem (USB_ERR_TIMEOUT), disabling > port 3 > > > >>> mountroot: waiting for device /dev/ufs/rootfs... > > > >>> Mounting from ufs:/dev/ufs/rootfs failed with error 19. > > > >>> > > > >>> So booting all the way requires me to make an adjustment > > > >>> in the config.txt by adding at the end something like: > > > >>> > > > >>> > > > >>> [all] > > > >>> # > > > >>> # Local addition that avoids USB3 SSD boot failures that look lik= e: > > > >>> # uhub_reattach_port: port ? reset failed, error=3DUSB_ERR_TIME= OUT > > > >>> # uhub_reattach_port: device problem (USB_ERR_TIMEOUT), > disabling port ? > > > >>> initial_turbo=3D60 > > > >>> > > > >>> [It appears that with modern EEPROM context, the RPi* is > > > >>> dynamically adjusting the frequency/voltage combinations > > > >>> even during early booting. The initial_turbo use delays > > > >>> that for the indicated number of seconds (up to 60 sec). > > > >>> FreeBSD seems to not handle the variability and the above > > > >>> gives FreeBSD a stable context for such properties for > > > >>> early booting.] > > > >>> > > > >>> I conclude that there is nothing about use of the RPi > > > >>> keyboard that stops it from working during early booting > > > >>> of 13.2-RELEASE. The RPi* firmware, U-Boot, and FreeBSD > > > >>> UEFI loader all work, other than possibly needing a > > > >>> initial_turbo addition (or analogous that would span > > > >>> at least that early boot time frame). > > > >>> > > > >>> If you had/have problems for the 13.2-RELEASE context, > > > >>> they are likely somehow specific to your context in some > > > >>> respect that deviates from the above. > > > >>> > > > >>> In some respects, investigating in the older context may > > > >>> be better than dealing with stable/13 . It may be keyboard > > > >>> specific in some way if the keyboard is not an RPi > > > >>> keyboard. I did not have a mouse plugged in. An Ethernet > > > >>> cable was plugged in for the booting. > > > >> > > > >> I forgot to mention having the HDMI connection plugged > > > >> into the HDMI port nearest the USB3 power connector. > > > >> > > > >> As I remember, the other port stops updating its display > > > >> at some point during the boot. > > > >> > > > >>> I just retried with the RPi keyboard plugged into a USB3 > > > >>> port instead. It worked the same. (The boot media is also > > > >>> plugged into a USB3 port and is USB3 capable SSD media.) > > > >>> > > > >>> FYI: > > > >>> > > > >>> # more /boot/msdos/config.txt > > > >>> [all] > > > >>> arm_64bit=3D1 > > > >>> dtparam=3Daudio=3Don,i2c_arm=3Don,spi=3Don > > > >>> dtoverlay=3Dmmc > > > >>> dtoverlay=3Ddisable-bt > > > >>> device_tree_address=3D0x4000 > > > >>> kernel=3Du-boot.bin > > > >>> > > > >>> [pi4] > > > >>> hdmi_safe=3D1 > > > >>> armstub=3Darmstub8-gic.bin > > > >>> > > > >>> [all] > > > >>> # > > > >>> # Local addition that avoids USB3 SSD boot failures that look lik= e: > > > >>> # uhub_reattach_port: port ? reset failed, error=3DUSB_ERR_TIME= OUT > > > >>> # uhub_reattach_port: device problem (USB_ERR_TIMEOUT), > disabling port ? > > > >>> initial_turbo=3D60 > > > >>> > > > >>> # more /boot/loader.conf > > > >>> # Configure USB OTG; see usb_template(4). > > > >>> hw.usb.template=3D3 > > > >>> umodem_load=3D"YES" > > > >>> # Multiple console (serial+efi gop) enabled. > > > >>> boot_multicons=3D"YES" > > > >>> boot_serial=3D"YES" > > > >>> # Disable the beastie menu and color > > > >>> beastie_disable=3D"YES" > > > >>> loader_color=3D"NO" > > > >>> > > > >>> (That is unchanged from the image's /boot/loader.conf content.) > > > >>> > > > >>> > > > >>> I'll see about stable/13's snapshot with the u-boot.bin > > > >>> substitution. > > > >>> > > > >>> > > > >>> Side note: I've other USB3 boot media for which having > > > >>> usb_pgood_delay=3D2000 in U-Boot is sufficient but default > > > >>> U-Boot contexts do not find the media suring the USB scan. > > > >>> (There could be a better setting to use for all I know: > > > >>> sufficient but possibly not necessary.) > > > > > > > > This is based on: > > > > > > > > dd > if=3DFreeBSD-13.2-STABLE-arm64-aarch64-RPI-20230615-894492f5bf4e-255597.i= mg > of=3D/dev/da0 bs=3D1m conv=3Dfsync,sync status=3Dprogress > > > > > > > > First dealing with the U-Boot vintage-avoidance issue: > > > > > > > > # mount -onoatime -tmsdosfs /dev/da1s1 /media > > > > # mount -onoatime -tmsdosfs /dev/da0s1 /mnt > > > > > > > > # ls -Tld /media/u-boot.bin /mnt/u-boot.bin > > > > -rwxr-xr-x 1 root wheel 601096 Apr 6 19:47:52 2023 > /media/u-boot.bin > > > > -rwxr-xr-x 1 root wheel 602552 Jun 14 19:43:46 2023 > /mnt/u-boot.bin > > > > > > > > # cp -aRx /media/u-boot.bin /mnt/ > > > > > > > > Then dealing with the initial_turbo issue: > > > > > > > > # diff /media/config.txt /mnt/config.txt > > > > 12,18d11 > > > > < < [all] > > > > < # > > > > < # Local addition that avoids USB3 SSD boot failures that look lik= e: > > > > < # uhub_reattach_port: port ? reset failed, error=3DUSB_ERR_TIME= OUT > > > > < # uhub_reattach_port: device problem (USB_ERR_TIMEOUT), > disabling port ? > > > > < initial_turbo=3D60 > > > > # cp -aRx /media/config.txt /mnt/ > > > > > > > > Finally, checking things overall in the msdosfs: > > > > > > > > # diff -rq /media/ /mnt/ > > > > Files /media/EFI/BOOT/bootaa64.efi and /mnt/EFI/BOOT/bootaa64.efi > differ > > > > > > > > # ls -Tld /media/EFI/*/* /mnt/EFI/*/* > > > > -rwxr-xr-x 1 root wheel 1180860 Apr 6 20:48:14 2023 > /media/EFI/BOOT/bootaa64.efi > > > > -rwxr-xr-x 1 root wheel 1182604 Jun 14 20:47:12 2023 > /mnt/EFI/BOOT/bootaa64.efi > > > > > > > > So: No other differences than the vintage of the FreeBSD UEFI > > > > loader. > > > > > > > > This also booted just fine, taking my input to avoid having > > > > to wait for the timeout. The only difference is which USB3 > > > > SSD was plugged in (the boot drive), in this case the one > > > > with a stable/13 snapshot instead of a releng/13.2 snapshot. > > > > The rest of the ports were as they had been. > > > > > > > > FYI: > > > > > > > > # uname -apKU > > > > FreeBSD generic 13.2-STABLE FreeBSD 13.2-STABLE > stable/13-n255597-894492f5bf4e GENERIC arm64 aarch64 1302505 1302505 > > > > > > > > Having confirmed this much for both releng/13.2 and stable.13 , > > > > I'll go back and look at your notes about file content and the > > > > like and see if I notice any distinctions vs. the above that > > > > might be important. > > > > > > > > > > > > Notes: > > > > > > > > I doubt that the RPi4B EEPROM image vintage would contribute, but > > > > it is something we have not been explicit about. > > > > > > > > I do have various debug outputs enabled, including for > > > > the EEPROM stage. The following is what it reports > > > > about the EEPROM content ("BOOTLOADER release") at > > > > power down after FreeBSD is done: > > > > > > > > RPi: BOOTLOADER release VERSION:8ba17717 DATE: 2023/01/11 TIME: > 17:40:52 > > > > BOOTMODE: 0x06 partition 63 build-ts BUILD_TIMESTAMP=3D1673458852 > serial c740af3c boardrev d03115 stc 421180 > > > > Halt: wake: 1 power_off: 0 > > > > > > > > The "boardrev d03115" indicates a "C0T" Rev1.5 vintage part > > > > that does not require the bounce buffer work around since > > > > the wrapper logic is fixed. (FreeBSD keeps working as if > > > > the bounce buffer was required: it is the only style of > > > > operation the kernel code has for the category of part.) > > > > > > > > I have access to a 8 GiByte Rev 1.4 RPi4B and a Rev 1.1 > > > > 4 GiByte RPi4B and could test those with the same media > > > > and such. All would have the same "BOOTLOADER release" > > > > as above, as I remember. > > > > > > > > > > > > A you sure you have the HDMI plugged into the correct HDMI > > > > port on the RPi4B, the one closest to the USB3 power > > > > connection? > > > > > > [I have also changed the /bin/csh defaults to /bin/sh > > > (which is my normal context).] > > > > > > # more /boot/loader.conf > > > # Configure USB OTG; see usb_template(4). > > > hw.usb.template=3D3 > > > umodem_load=3D"YES" > > > # Multiple console (serial+efi gop) enabled. > > > boot_multicons=3D"YES" > > > boot_serial=3D"YES" > > > # Disable the beastie menu and color > > > # beastie_disable=3D"YES" > > > # loader_color=3D"NO" > > > > > > # shutdown -r now > > > > > > And the beastie shows up and works just fine, > > > operated from the USB RPi keyboard. > > > > > > > > > My bias here is to have minimal differences from > > > the RELEASE and snapshot builds relative to the > > > reported problem. I still see no evidence of any > > > problem with use of the RPi keyboard to control > > > booting. > > > > > > =3D=3D=3D > Mark Millard > marklmi at yahoo.com > > --=20 Nuno Teixeira FreeBSD Committer (ports) --00000000000039817e06004e20f0 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hello Mark!

Great news:

I can confirm that rpi official keyboard works as inte= nded and boot menu works.

Thanks!
<= br>
Mark Mi= llard <marklmi@yahoo.com> es= creveu no dia domingo, 18/06/2023 =C3=A0(s) 00:36:
On Jun 17, 2023, at 16:01, Nuno Teixeira= <eduardo@freeb= sd.org> wrote:

> - tested it on both USB2 and USB3 ports and same error.
> - added a gamer keyboard on all ports and same error.
> - tested with both keyboads connected, but only one get error from the= normal keyboard, both failed with same error :)
>
> at boot time, none keyboards work.
> at login time, both works.
>
> I'm very curious about raspberry original keyboard! I will buy it = next week.

Most of the keyboards that I have access to are
much older, many of then from Apple. There is
only one PC USB gaming keyboard and mouse, not
that they were ever used for such. There is
just the one RPi keyboard and mouse.

I used the more modern, fairly common keyboard
because trying to figure out if old equipment
related failures are actually the same type of
failure did not seem reasonable. Trying to
match old equipment for comparison/contrast
activities did not seem reasonable either.

That the modern keyboard happens to be an RPi
one is an accident.

> Thanks very much for this awesome time that I learned more.
> Thanks for your patience!
>
> And I will stay tuned for updates on firmware and continue testing sta= ble/current snapshots to check if boot is fixed.
>
> Cheers,
>
> Mark Millard <marklmi@yahoo.com> escreveu no dia s=C3=A1bado, 17/06/2023 =C3=A0(= s) 23:41:
> On Jun 17, 2023, at 15:28, Nuno Teixeira <eduardo@freebsd.org> wrote:
>
> > I think I found the cause!
> >
> > Please take a look at photo.
> >
> > "Scanning xhci_pci devices... Failed to get keyboard state..= ."
>
> That message was displayed by U-Boot before the
> FreeBSD UEFI loader was even loaded to memory.
>
> The FreeBSD UEFI loader operates by using U-Boot
> services. If U-Boot fails to set up the keyboard
> input, the same would be true in the FreeBSD UEFI
> loader (beastie or otherwise) until FreeBSD's
> kernel does its own bindings and things get another
> chance at working.
>
> (A similar point goes for storage media that U-Boot
> fails to set up.)
>
> Is the keyboard plugged into a USB2 port? USB3? Have
> you tried both ways?
>
> It does seem that the system and keyboard are not
> well matched.
>
> > After a while it gets detected during boot. I've pressed ente= r key and I saw it creating empty line at boot.
> > Maybe it's a keyboard problem? I'm using a very cheap one= (not raspberry original)
> >
> > Thanks
> >
> > Mark Millard <marklmi@yahoo.com> escreveu no dia s=C3=A1bado, 17/06/2023 = =C3=A0(s) 23:08:
> > [Commenting out beastie_disable=3D"YES" and loader_colo= r=3D"NO"
> > in stable/13.]
> >
> > On Jun 17, 2023, at 14:42, Mark Millard <marklmi@yahoo.com> wrote:
> >
> > > [This time I add continuing the sequence to test the stable/= 13 snapshot.]
> > >
> > > On Jun 17, 2023, at 13:56, Mark Millard <marklmi@yahoo.com> wrote:
> > >
> > >> On Jun 17, 2023, at 13:53, Mark Millard <marklmi@yahoo.com> wrote:=
> > >>
> > >>> I'm just making a status report for my experimen= ts.
> > >>>
> > >>> I did a:
> > >>>
> > >>> dd if=3DFreeBSD-13.2-RELEASE-arm64-aarch64-RPI.img o= f=3D/dev/da1 bs=3D1m conv=3Dfsync,sync status=3Dprogress
> > >>>
> > >>> I made no adjustments.
> > >>>
> > >>> I then tried using the USB3 media to start a boot of=
> > >>> a 8 GiByte RPi4B. It took my typing to the RPi
> > >>> keyboard just fine: I did not have to wait for
> > >>> the timeout when I hit <return>. The (official= ) RPi
> > >>> keyboard was plugged into a USB2 port.
> > >>>
> > >>> Unfortunately there is a known issue for my context = where it
> > >>> gets:
> > >>>
> > >>> uhub_reattach_port: port 3 reset failed, error=3DUSB= _ERR_TIMEOUT
> > >>> uhub_reattach_port: device problem (USB_ERR_TIMEOUT)= , disabling port 3
> > >>> mountroot: waiting for device /dev/ufs/rootfs...
> > >>> Mounting from ufs:/dev/ufs/rootfs failed with error = 19.
> > >>>
> > >>> So booting all the way requires me to make an adjust= ment
> > >>> in the config.txt by adding at the end something lik= e:
> > >>>
> > >>>
> > >>> [all]
> > >>> #
> > >>> # Local addition that avoids USB3 SSD boot failures = that look like:
> > >>> #=C2=A0 =C2=A0uhub_reattach_port: port ? reset faile= d, error=3DUSB_ERR_TIMEOUT
> > >>> #=C2=A0 =C2=A0uhub_reattach_port: device problem (US= B_ERR_TIMEOUT), disabling port ?
> > >>> initial_turbo=3D60
> > >>>
> > >>> [It appears that with modern EEPROM context, the RPi= * is
> > >>> dynamically adjusting the frequency/voltage combinat= ions
> > >>> even during early booting. The initial_turbo use del= ays
> > >>> that for the indicated number of seconds (up to 60 s= ec).
> > >>> FreeBSD seems to not handle the variability and the = above
> > >>> gives FreeBSD a stable context for such properties f= or
> > >>> early booting.]
> > >>>
> > >>> I conclude that there is nothing about use of the RP= i
> > >>> keyboard that stops it from working during early boo= ting
> > >>> of 13.2-RELEASE. The RPi* firmware, U-Boot, and Free= BSD
> > >>> UEFI loader all work, other than possibly needing a<= br> > > >>> initial_turbo addition (or analogous that would span=
> > >>> at least that early boot time frame).
> > >>>
> > >>> If you had/have problems for the 13.2-RELEASE contex= t,
> > >>> they are likely somehow specific to your context in = some
> > >>> respect that deviates from the above.
> > >>>
> > >>> In some respects, investigating in the older context= may
> > >>> be better than dealing with stable/13 . It may be ke= yboard
> > >>> specific in some way if the keyboard is not an RPi > > >>> keyboard. I did not have a mouse plugged in. An Ethe= rnet
> > >>> cable was plugged in for the booting.
> > >>
> > >> I forgot to mention having the HDMI connection plugged > > >> into the HDMI port nearest the USB3 power connector.
> > >>
> > >> As I remember, the other port stops updating its display=
> > >> at some point during the boot.
> > >>
> > >>> I just retried with the RPi keyboard plugged into a = USB3
> > >>> port instead. It worked the same. (The boot media is= also
> > >>> plugged into a USB3 port and is USB3 capable SSD med= ia.)
> > >>>
> > >>> FYI:
> > >>>
> > >>> # more /boot/msdos/config.txt
> > >>> [all]
> > >>> arm_64bit=3D1
> > >>> dtparam=3Daudio=3Don,i2c_arm=3Don,spi=3Don
> > >>> dtoverlay=3Dmmc
> > >>> dtoverlay=3Ddisable-bt
> > >>> device_tree_address=3D0x4000
> > >>> kernel=3Du-boot.bin
> > >>>
> > >>> [pi4]
> > >>> hdmi_safe=3D1
> > >>> armstub=3Darmstub8-gic.bin
> > >>>
> > >>> [all]
> > >>> #
> > >>> # Local addition that avoids USB3 SSD boot failures = that look like:
> > >>> #=C2=A0 =C2=A0uhub_reattach_port: port ? reset faile= d, error=3DUSB_ERR_TIMEOUT
> > >>> #=C2=A0 =C2=A0uhub_reattach_port: device problem (US= B_ERR_TIMEOUT), disabling port ?
> > >>> initial_turbo=3D60
> > >>>
> > >>> # more /boot/loader.conf
> > >>> # Configure USB OTG; see usb_template(4).
> > >>> hw.usb.template=3D3
> > >>> umodem_load=3D"YES"
> > >>> # Multiple console (serial+efi gop) enabled.
> > >>> boot_multicons=3D"YES"
> > >>> boot_serial=3D"YES"
> > >>> # Disable the beastie menu and color
> > >>> beastie_disable=3D"YES"
> > >>> loader_color=3D"NO"
> > >>>
> > >>> (That is unchanged from the image's /boot/loader= .conf content.)
> > >>>
> > >>>
> > >>> I'll see about stable/13's snapshot with the= u-boot.bin
> > >>> substitution.
> > >>>
> > >>>
> > >>> Side note: I've other USB3 boot media for which = having
> > >>> usb_pgood_delay=3D2000 in U-Boot is sufficient but d= efault
> > >>> U-Boot contexts do not find the media suring the USB= scan.
> > >>> (There could be a better setting to use for all I kn= ow:
> > >>> sufficient but possibly not necessary.)
> > >
> > > This is based on:
> > >
> > > dd if=3DFreeBSD-13.2-STABLE-arm64-aarch64-RPI-20230615-89449= 2f5bf4e-255597.img of=3D/dev/da0 bs=3D1m conv=3Dfsync,sync status=3Dprogres= s
> > >
> > > First dealing with the U-Boot vintage-avoidance issue:
> > >
> > > # mount -onoatime -tmsdosfs /dev/da1s1 /media
> > > # mount -onoatime -tmsdosfs /dev/da0s1 /mnt
> > >
> > > # ls -Tld /media/u-boot.bin /mnt/u-boot.bin
> > > -rwxr-xr-x=C2=A0 1 root=C2=A0 wheel=C2=A0 601096 Apr=C2=A0 6= 19:47:52 2023 /media/u-boot.bin
> > > -rwxr-xr-x=C2=A0 1 root=C2=A0 wheel=C2=A0 602552 Jun 14 19:4= 3:46 2023 /mnt/u-boot.bin
> > >
> > > # cp -aRx /media/u-boot.bin /mnt/
> > >
> > > Then dealing with the initial_turbo issue:
> > >
> > > # diff /media/config.txt /mnt/config.txt
> > > 12,18d11
> > > <=C2=A0 < [all]
> > > < #
> > > < # Local addition that avoids USB3 SSD boot failures tha= t look like:
> > > < #=C2=A0 =C2=A0uhub_reattach_port: port ? reset failed, = error=3DUSB_ERR_TIMEOUT
> > > < #=C2=A0 =C2=A0uhub_reattach_port: device problem (USB_E= RR_TIMEOUT), disabling port ?
> > > < initial_turbo=3D60
> > > # cp -aRx /media/config.txt /mnt/
> > >
> > > Finally, checking things overall in the msdosfs:
> > >
> > > # diff -rq /media/ /mnt/
> > > Files /media/EFI/BOOT/bootaa64.efi and /mnt/EFI/BOOT/bootaa6= 4.efi differ
> > >
> > > # ls -Tld /media/EFI/*/* /mnt/EFI/*/*
> > > -rwxr-xr-x=C2=A0 1 root=C2=A0 wheel=C2=A0 1180860 Apr=C2=A0 = 6 20:48:14 2023 /media/EFI/BOOT/bootaa64.efi
> > > -rwxr-xr-x=C2=A0 1 root=C2=A0 wheel=C2=A0 1182604 Jun 14 20:= 47:12 2023 /mnt/EFI/BOOT/bootaa64.efi
> > >
> > > So: No other differences than the vintage of the FreeBSD UEF= I
> > > loader.
> > >
> > > This also booted just fine, taking my input to avoid having<= br> > > > to wait for the timeout. The only difference is which USB3 > > > SSD was plugged in (the boot drive), in this case the one > > > with a stable/13 snapshot instead of a releng/13.2 snapshot.=
> > > The rest of the ports were as they had been.
> > >
> > > FYI:
> > >
> > > # uname -apKU
> > > FreeBSD generic 13.2-STABLE FreeBSD 13.2-STABLE stable/13-n2= 55597-894492f5bf4e GENERIC arm64 aarch64 1302505 1302505
> > >
> > > Having confirmed this much for both releng/13.2 and stable.1= 3 ,
> > > I'll go back and look at your notes about file content a= nd the
> > > like and see if I notice any distinctions vs. the above that=
> > > might be important.
> > >
> > >
> > > Notes:
> > >
> > > I doubt that the RPi4B EEPROM image vintage would contribute= , but
> > > it is something we have not been explicit about.
> > >
> > > I do have various debug outputs enabled, including for
> > > the EEPROM stage. The following is what it reports
> > > about the EEPROM content ("BOOTLOADER release") at=
> > > power down after FreeBSD is done:
> > >
> > > RPi: BOOTLOADER release VERSION:8ba17717 DATE: 2023/01/11 TI= ME: 17:40:52
> > > BOOTMODE: 0x06 partition 63 build-ts BUILD_TIMESTAMP=3D16734= 58852 serial c740af3c boardrev d03115 stc 421180
> > > Halt: wake: 1 power_off: 0
> > >
> > > The "boardrev d03115" indicates a "C0T" = Rev1.5 vintage part
> > > that does not require the bounce buffer work around since > > > the wrapper logic is fixed. (FreeBSD keeps working as if
> > > the bounce buffer was required: it is the only style of
> > > operation the kernel code has for the category of part.)
> > >
> > > I have access to a 8 GiByte Rev 1.4 RPi4B and a Rev 1.1
> > > 4 GiByte RPi4B and could test those with the same media
> > > and such. All would have the same "BOOTLOADER release&q= uot;
> > > as above, as I remember.
> > >
> > >
> > > A you sure you have the HDMI plugged into the correct HDMI > > > port on the RPi4B, the one closest to the USB3 power
> > > connection?
> >
> > [I have also changed the /bin/csh defaults to /bin/sh
> > (which is my normal context).]
> >
> > # more /boot/loader.conf
> > # Configure USB OTG; see usb_template(4).
> > hw.usb.template=3D3
> > umodem_load=3D"YES"
> > # Multiple console (serial+efi gop) enabled.
> > boot_multicons=3D"YES"
> > boot_serial=3D"YES"
> > # Disable the beastie menu and color
> > # beastie_disable=3D"YES"
> > # loader_color=3D"NO"
> >
> > # shutdown -r now
> >
> > And the beastie shows up and works just fine,
> > operated from the USB RPi keyboard.
> >
> >
> > My bias here is to have minimal differences from
> > the RELEASE and snapshot builds relative to the
> > reported problem. I still see no evidence of any
> > problem with use of the RPi keyboard to control
> > booting.
> >


=3D=3D=3D
Mark Millard
marklmi at yahoo.com



--
Nuno Teixeira
FreeBSD Committ= er (ports)
--00000000000039817e06004e20f0-- From nobody Sun Jul 16 21:00:36 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R3yKd559Rz4n4Nb for ; Sun, 16 Jul 2023 21:00:37 +0000 (UTC) (envelope-from bugzilla-noreply@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R3yKd0QLKz3tG1 for ; Sun, 16 Jul 2023 21:00:37 +0000 (UTC) (envelope-from bugzilla-noreply@FreeBSD.org) ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689541237; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=T31g/8PdgLDttwkcjaIcEV1Bn0gSTtdbyU9D5jj/KNs=; b=D6J7oV1zqhkiW7pK1fJWTzQvrZIjv0ulNx5NEVoNzae5zaB0L91V9zk1M8vPFBJLqaZZqW yFtVtmvf2RpdvZf6ibsQ/+r8Y+b7PqrSIGc/BJMWRX0NyN8o63NV1WB69SSrjlioFOZ3ge UW8/CLXzzN06YrIomdXiVAWzKSaC+QZQXZjaiAZJsn1bEd+iIkDq65V7Isx98zFZMzTy+u NronHSG4A31KO4ZRLRnZ16HJqtkUEeGfxwkAEdRXOitXcLy74lK7yucViHjtahsl8rlaPf bRZbeDijx/2GLSGUQ9l39NfbP2l4GgbHiCiz5G4MLlD19Hx2lu4R/DQXtnLjkg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1689541237; a=rsa-sha256; cv=none; b=UDAtAJf+QrExM4m/PCuv8cKmeclvy8mXZ79oXLuiDs0or3JdfNFYjjTHykvPkIgTuDw+1I 9ntxafgK3yWdbRV+aCMCs9tZpZxN5urlg8l1qplpRHm7iYSq4qbVrj2vd2MaXYdMJUJs1S y6Zqo6ipZD3UDIHdndIRrwPYz6X1P9AkpdW77kT42rPT1f5db4vpGGmIdnIQhQmhnV1CIq 15FJYNfkgEPg3l9U/3QChg+zT9FHdl1MJtKMB/Nn5vJWqxD6oV0EZdY4KqlLgC899R5jTG DalBvp7gbOGVz2Bwu5b50Mno99BxA/+0mKB90evaWKHG6dHg1KDNEFiH1l1Gow== Received: from kenobi.freebsd.org (kenobi.freebsd.org [IPv6:2610:1c1:1:606c::50:1d]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4R3yKc6Qz7zxRj for ; Sun, 16 Jul 2023 21:00:36 +0000 (UTC) (envelope-from bugzilla-noreply@FreeBSD.org) Received: from kenobi.freebsd.org ([127.0.1.5]) by kenobi.freebsd.org (8.15.2/8.15.2) with ESMTP id 36GL0a0W070903 for ; Sun, 16 Jul 2023 21:00:36 GMT (envelope-from bugzilla-noreply@FreeBSD.org) Received: (from bugzilla@localhost) by kenobi.freebsd.org (8.15.2/8.15.2/Submit) id 36GL0a8d070902 for freebsd-arm@FreeBSD.org; Sun, 16 Jul 2023 21:00:36 GMT (envelope-from bugzilla-noreply@FreeBSD.org) Message-Id: <202307162100.36GL0a8d070902@kenobi.freebsd.org> X-Authentication-Warning: kenobi.freebsd.org: bugzilla set sender to bugzilla-noreply@FreeBSD.org using -f From: bugzilla-noreply@FreeBSD.org To: freebsd-arm@FreeBSD.org Subject: Problem reports for freebsd-arm@FreeBSD.org that need special attention Date: Sun, 16 Jul 2023 21:00:36 +0000 List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="16895412367.93AAb.67715" Content-Transfer-Encoding: 7bit X-ThisMailContainsUnwantedMimeParts: N --16895412367.93AAb.67715 Date: Sun, 16 Jul 2023 21:00:36 +0000 MIME-Version: 1.0 Content-Type: text/plain; charset="UTF-8" To view an individual PR, use: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=(Bug Id). The following is a listing of current problems submitted by FreeBSD users, which need special attention. These represent problem reports covering all versions including experimental development code and obsolete releases. Status | Bug Id | Description ------------+-----------+--------------------------------------------------- Open | 238576 | Raspberry Pi 3B+ "shutdown -p" does not shut off Open | 257670 | mpr(4): SAS3008 PCI-Express Fusion-MPT SAS-3: Fat 2 problems total for which you should take action. --16895412367.93AAb.67715 Date: Sun, 16 Jul 2023 21:00:36 +0000 MIME-Version: 1.0 Content-Type: text/html; charset="UTF-8" 
The following is a listing of current problems submitted by FreeBSD users,
which need special attention. These represent problem reports covering
all versions including experimental development code and obsolete releases.

Status      |    Bug Id | Description
------------+-----------+---------------------------------------------------
Open        |    238576 | Raspberry Pi 3B+ "shutdown -p" does not shut off 
Open        |    257670 | mpr(4): SAS3008 PCI-Express Fusion-MPT SAS-3: Fat

2 problems total for which you should take action.
--16895412367.93AAb.67715-- From nobody Mon Jul 17 15:50:51 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4RPp6b0kz4nXBW for ; Mon, 17 Jul 2023 15:50:54 +0000 (UTC) (envelope-from carlj@peak.org) Received: from mail.nrtc.syn-alias.com (mail.nrtc.syn-alias.com [129.213.214.220]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4RPp0VfFz3vn8 for ; Mon, 17 Jul 2023 15:50:53 +0000 (UTC) (envelope-from carlj@peak.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=peak.org header.s=synacor-nrtc header.b="FB/BAaea"; spf=pass (mx1.freebsd.org: domain of carlj@peak.org designates 129.213.214.220 as permitted sender) smtp.mailfrom=carlj@peak.org; dmarc=pass (policy=none) header.from=peak.org DKIM-Signature: v=1; a=rsa-sha1; d=peak.org; s=synacor-nrtc; c=relaxed/simple; q=dns/txt; i=@peak.org; t=1689609053; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=yz7eroDcWSnAif3hANrRwkNeFgM=; b=FB/BAaeaSCvIRFlr1Y0pbMVg/ZYQCPA53Ta7rtx7MlVHhTq9MMBvpwxAF0/5dcdW BozL/0UldGyom+rpXGb4wrP5b/8YmSCPRihFMNDm04dQ7M+QiaxMBnK2awzpWgZ/ 5ntGgBJ7kR6KehTkl7dbUzKqAePdjqAtIz28Rwed/OAaEE573gEPm146J9H1RfRs WVBA5gLe6PU+M85X0wMFffQTOq7XEw3/dc6+Fij9mDWuUyxcFgjzpSIgjmU65G4z 9pVqoHBkC21vCNsXSOVcovuIThY3l137VfTz9hxcz60cvdtuR6JIsgHMaL2lfR2n eVpGv1T8ZYqIl25fNAvvmA==; X-Authed-Username: Y2FybGpAcGVhay5vcmc= Received: from [208.79.251.72] ([208.79.251.72:33993] helo=bay.localnet) by mail.peak.org (envelope-from ) (ecelerity 4.4.0.19839 r(msys-ecelerity:tags/4.4.0.0^0)) with ESMTPA id D6/99-26575-C5365B46; Mon, 17 Jul 2023 11:50:52 -0400 Received: from carlj by bay.localnet with local (Exim 4.96 (FreeBSD)) (envelope-from ) id 1qLQUt-000AhH-1b for freebsd-arm@freebsd.org; Mon, 17 Jul 2023 08:50:51 -0700 From: Carl Johnson To: freebsd-arm@freebsd.org Subject: No packages lately for arm64? Date: Mon, 17 Jul 2023 08:50:51 -0700 Message-ID: <86r0p6v8o4.fsf@bay.localnet> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.2 (berkeley-unix) List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 Content-Type: text/plain X-Vade-Verdict: clean X-Vade-Analysis-1: gggruggvucftvghtrhhoucdtuddrgedviedrgedvgdelgecutefuodetggdotefrodftvfcurfhrohhf X-Vade-Analysis-2: ihhlvgemucfujgfpteevqfftpdfptffvvedpgffpggdqpfftvfevpdfqfgfvnecuuegrihhlohhuthem X-Vade-Analysis-3: uceftddunecunecujfgurhephffvufffkfgfgggtsehttddttddtredtnecuhfhrohhmpeevrghrlhcu X-Vade-Analysis-4: lfhohhhnshhonhcuoegtrghrlhhjsehpvggrkhdrohhrgheqnecuggftrfgrthhtvghrnhepgeeuvedt X-Vade-Analysis-5: gfdvtdekhfffgffgkedtgefgtdffjeegffdvhfdvteetffduhffffefhnecukfhppedvtdekrdejledr X-Vade-Analysis-6: vdehuddrjedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtkedrjeel X-Vade-Analysis-7: rddvhedurdejvddphhgvlhhopegsrgihrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpegtrghrlhhj X-Vade-Analysis-8: sehpvggrkhdrohhrghdprhgtphhtthhopehfrhgvvggsshguqdgrrhhmsehfrhgvvggsshgurdhorhhg X-Vade-Analysis-9: pdhmthgrhhhoshhtpehsmhhtphdtuddrnhhrthgtrdgvmhgrihhlqdgrshhhuddrshihnhgtrdhlrghn X-Vade-Analysis-10: pdhnsggprhgtphhtthhopedupdhishgpnhgrpehtrhhuvgdprghuthhhpghushgvrheptggrrhhljhes X-Vade-Analysis-11: phgvrghkrdhorhhg X-Vade-Client: NRTC X-Spamd-Result: default: False [-2.99 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.997]; NEURAL_HAM_MEDIUM(-0.99)[-0.990]; DMARC_POLICY_ALLOW(-0.50)[peak.org,none]; R_DKIM_ALLOW(-0.20)[peak.org:s=synacor-nrtc]; R_SPF_ALLOW(-0.20)[+ip4:129.213.214.220]; MIME_GOOD(-0.10)[text/plain]; MLMMJ_DEST(0.00)[freebsd-arm@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[129.213.214.220:from]; ASN(0.00)[asn:31898, ipnet:129.213.208.0/21, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; RCVD_COUNT_THREE(0.00)[3]; FROM_HAS_DN(0.00)[]; ARC_NA(0.00)[]; DKIM_TRACE(0.00)[peak.org:+]; DWL_DNSWL_NONE(0.00)[peak.org:dkim]; TO_DN_NONE(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_TRACE(0.00)[0:+]; RWL_MAILSPIKE_POSSIBLE(0.00)[129.213.214.220:from] X-Rspamd-Queue-Id: 4R4RPp0VfFz3vn8 X-Spamd-Bar: -- X-ThisMailContainsUnwantedMimeParts: N Hello, I have been watching for packages for the new quarterly port builds, but I haven't seen anything yet. I already update my amd64 system several days ago, but nothing has shown yet for arm64. I checked my logs and I installed security updates last month, but there haven't been any for the last couple of weeks. When I run pkg update, I just get the following: # pkg update Updating FreeBSD repository catalogue... FreeBSD repository is up to date. All repositories are up to date. I have compared some package versions to my amd64 system and the arm64 packages are definitely out of date. I am running FreeBSD 13.2-RELEASE and all pkg configuration files are the original defaults. Is there some web site I could look at to see the build status for packages? Thanks for any information. -- Carl Johnson carlj@peak.org From nobody Mon Jul 17 16:14:19 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4RxB5PK3z4njbf for ; Mon, 17 Jul 2023 16:14:38 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic316-54.consmr.mail.gq1.yahoo.com (sonic316-54.consmr.mail.gq1.yahoo.com [98.137.69.30]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4RxB17jTz469p for ; Mon, 17 Jul 2023 16:14:38 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1689610475; bh=RD/1U0rVzZK4lF608K2Oj9YH/62JtyNRS4Kte2iP+mM=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=Z6UjuRCxLep8D1wwdpxuZKRkJL4X+95vIxS1+5gjk4xCoYI4Y+FTF8IjrztS7HglBKkcyC0ZDSQkJzvgx/nKMBAijdOdoiDvKSWsy9hEEQQBZbMl+Qx7E7dDmC6Bx6zj98TPqbbj6pWgZSBplvJuGhZpilkbhXXCJgIaidGlEEhTxQsrVC7Uynw0kUyZPYLAg1D1r+OYYWjlBibcHfYiUvsMHL87Y9SsRzelu6SDXQc85p44GVjC+IrAMlEOK1hK+FAwNJsyfE4CPuO2MzbR/l7dkOkdTxXu0RigOgyOHMWnbLulB6EecTECgMyXPeUH4Wq39B3gvm+GrAHVlZJK0A== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1689610475; bh=wfyWlWWUNhvjgLur5+0q2wltvR49DjEyMAdEDumvBoE=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=lks4eqZI3AAe3I0YmIlqETktDUQunSCKBzFz3lUqub0Yjhcn43pz501juxpa0w6/Fv8s3He6AtCBwr21GCURiCju7mTd3L3AXjo0oL7FFug7fNNl7DayE+4FtyLurp0ye5cVJOQLCwVUCrjSVnyFtbQs+1c3SqCEJIbHRB5scbNCBE94mdx7YtAkSCO7oRjScwXge0ov7QSFMnmOLvZd8vFiHqbOloU6XLjUnPrssi3ZwHgEnhBJCj6/GyrjeKkjN/KbvYopIVTleBxqkvVjFemE7eTqCkGyiKI0txp1PKoVnP3tqNYvNOS5U0z1+a3e142+tgRpgv/7dgRNl1VZaQ== X-YMail-OSG: FdHA_VMVM1nGh6bxQEpIJxbTXgDJIozd9sNzq6EMw.M_IXMqdYD2KTq3HJ26I.d cFHqw9Yv4PDdVV7mnYLpXBeReC16YTdcCG.joig.owXIHjBkphVdK1LUuzpA2ICmBQbU0pWmFQo. fA4ZEcgnoxLwcpkfKU2Npyd5wAMPz4ber_u2ew.AOwtf6lZ9MCslplCbE8GhOeko6XO.qBEX2eD5 5GUktMW2S.QDH8COpK7rlJNUhECXnyehuiBXiLZAGuSAw2DUjfZw_SBIxBZBZlteRxfPtzoVcrc9 DOH.W4ioB_q2nJBXiKvD7.JCEIpqJGJsHDzqlEgUNYZLQEGIogiVjFXVfD20fJ283F6Z4mKrDKKb wbirvT3.5V0PjRCPorvvYxm6ieGEdoK7VtFkvUdC5Sjv5eUsr2.I_IekMGskyUfdqu3OG9QWZoeg Ou1SRUjedTFdfe6DwtbjKWZr.8rfBBzZIyZEc4HCzAy1o1NCqWmann8_b6z6Vw.VY5fCg4tr2JbQ 8IAR8ri0sMSz26FS3.ew3cThl0Kmanb5d6PDIp3xnZ2dfO6IhEUmtzOov5fNR2WjCXbq0EJSbNeV Pd3CkZbwuiOW1fdRfrhwk5LU_.qhu2HmlvbDMnb_AV5N_5tk96UftI.EipxMkJBxKkqZm5PkMude yMd7auWhFCf3Gj6lvTuMelryVb2l5ce49OB3CjZa_Lc2E09f6sLuBIU6clc7HJp4X6bZAniBBnbc 4hXku4TU_x.bsaqw6ob306wbied6TEevIw94.u4DSw1opNoJSHSWhD5KLkJnAgnFK8hRbXAF4zCi Vt472B._U3ER8vZ5dO7YLEA08wXOHnxYxdGeC6C0HJGSjNra400E157LHmLdHV4hC13WuVsx6sUZ CpvDn5nKmJallWZ71gJmnIixgz.Hd57Rc4ClaD5BW_TeFf.RfBwAYx1JMKrcIptRxma73v5M4cR9 eAdCIhoCVokHX0fYVWgd1DUIDme5h3Qi1uoxq_9.OEksA0HpFI3VqA6C3EJlRQlNkaoNsc7Zpr4x AtwRRdojqaqGJ8RTDbPhEdZCu9b8ga3wBK0btTQdrR4aydberLC3aAu4jxXG1ZxpuZOKfjRLyEqg mikk91XTHIWTZL7YyB2HBSHqM0QphrNKh7w08smPFesNKhQdFAf.jCrcJv3zb4hdFmlgf1E4tm0T 9JyT0hm_qh_KJoiXDzzQxyzK.3D8VbfYEi5jf8yC9SuQMdCFOfCg4GLNv_qt5YtDsc0AFyhEDa9g 4FUE7D_eYzhNI.PiaCP6Xeti21GMg_EYFgrEADrecBnpGJkGlREUhM_hTdJEzO6SyZBb3ojaWct7 ze7GXu3Z0jvO1O9ipsGv_WcgLERxIgNTeaiuAOBuc6gR1QTi9ILWB9Q7t7Rst2aLTxXp4bW.TEz8 7Dfzv8kYCRDh21PKJaKSiuVVS0XpkxB4sZpwC9wW8.bEsMxLZmTm_AeNDuwIMYgWGLcVwBKxfsLG POVtjw.jAcSjck.m4r9xzh8sJOaz9ovZBuRi3n2nz88RHi4D0QJrJ2vVja_Dm36myBVHiURy4Rd0 K2di9tFWc.cw8S7GPhUkvcRv32VyYoTGicdjo1ev1OBEm_L_K5FRtWhffb1aa0.f3xy0CqXL9.Z. izjjrtohAJFfggmNBtaCG4IAs.5YLVQwKVVjGY3Eat8hHkzimLoLb3vTu2YM3IPlH4E7Ykmb7Ci3 4QhNKAoViNq4l8voPd1mnSX6yOEcywUx7.WFALaqUc3u9hfAlwX0DLmi1CCACYPFblzoWd_XaUf_ j4FczSo4.FrCoveww1qPnePLwDum2GVVkvbjt_HjzRjTp02q6eYYCZPyPQEIy.PZ71AAKjRWPk3C CcejMdGpYGVAArdB0V5E63N0Q3RVbAPAwH.mP56W9k.uf6l2RMwsJdXUNUUcukuYdtj1NyVvtWI1 Mo3G35DYX5DNOIMOMmPqjpReQPR_QA6aWhMuUnIXbzIGQ0RSqa2OJ_cBzFoOhh_IpYXA0vJK7f_N DJaqChQgirCCbxdkrdVlJ8vL4M.U7N95w3TNS.AMt0Cis97n3QdgWdL32Y6kjf3VSMV9ZucpRfqd NihTZ66kPJHksCn1PILbJFw58XJb.TGVGBJKsXbMw6A.P1mA.wcS7lu0ktMppLC1dRnuR1ONdcZa 1jKrSVCHetutXTfkLqfZo135hlzaUk_XeAxH2_7YQZ.jOoAtXcPA4SEv43fyUkXfmSVPDkjq7XTX e7SeTXoMYlyKu.r.x5FgRdS17hqfy3FSjAQASDZ63T7SM51lpAW_xVrwu3VktFmdoP2c1zKRm06J cQQ-- X-Sonic-MF: X-Sonic-ID: f367de61-27d0-4726-adf7-4e94725d9901 Received: from sonic.gate.mail.ne1.yahoo.com by sonic316.consmr.mail.gq1.yahoo.com with HTTP; Mon, 17 Jul 2023 16:14:35 +0000 Received: by hermes--production-gq1-5748b5bccb-jh668 (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 618c153399fbe90341f2f3c20f33a552; Mon, 17 Jul 2023 16:14:30 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.600.7\)) Subject: Re: No packages lately for arm64? From: Mark Millard In-Reply-To: <86r0p6v8o4.fsf@bay.localnet> Date: Mon, 17 Jul 2023 09:14:19 -0700 Cc: freebsd-arm@freebsd.org Content-Transfer-Encoding: 7bit Message-Id: References: <86r0p6v8o4.fsf@bay.localnet> To: Carl Johnson X-Mailer: Apple Mail (2.3731.600.7) X-Rspamd-Queue-Id: 4R4RxB17jTz469p X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-ThisMailContainsUnwantedMimeParts: N On Jul 17, 2023, at 08:50, Carl Johnson wrote: > Hello, > I have been watching for packages for the new quarterly port builds, but > I haven't seen anything yet. I already update my amd64 system several > days ago, but nothing has shown yet for arm64. I checked my logs and I > installed security updates last month, but there haven't been any for > the last couple of weeks. When I run pkg update, I just get the > following: > > # pkg update > Updating FreeBSD repository catalogue... > FreeBSD repository is up to date. > All repositories are up to date. > > I have compared some package versions to my amd64 system and the arm64 > packages are definitely out of date. I am running FreeBSD 13.2-RELEASE > and all pkg configuration files are the original defaults. Is there > some web site I could look at to see the build status for packages? There were major problems with pkg and its performance and resource use in an update. Official builds for latest were stopped and restarted multiple times as pkg was updated to try to get past the issues. On 2023-Jul-13 9 builds were started, each on a separate server, each with 25000+ ports to build. None were quarterly. Looks like 3 are still not done, one being for arm64 on ampere2. The other of the 9 build servers are off doing other builds now. 131releng-armv7 started building on ampere3 but is not quarterly. It has 26000+ ports to build. But 131arm64's quarterly is building on ampere1 and has 12000+ of 25000+ to go. These notes do not cover distribution of built packages to the distribution servers. That adds more time after the builds and the status is not as easy to find. I used https://pkg-status.freebsd.org/?all=1&type=package to gather some of the details presented. === Mark Millard marklmi at yahoo.com From nobody Mon Jul 17 16:37:34 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4SRf40Trz4mxVB for ; Mon, 17 Jul 2023 16:37:34 +0000 (UTC) (envelope-from jwd@freebsd.org) Received: from freefall.freebsd.org (freefall.freebsd.org [IPv6:2610:1c1:1:6074::16:84]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "freefall.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4SRf3bR8z4F5k for ; Mon, 17 Jul 2023 16:37:34 +0000 (UTC) (envelope-from jwd@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689611854; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type; bh=Y5SJQxn0ZDmBRnycaaME6sZYGZHCtLOLcnUmkyH2tlU=; b=ETwQ4UG4W1ACBxpqn2T7P1OUS2DfonENenyRn+fPvpMmTO/FmvDkTRlMmt9IfvNV1Fw5UE j8+46Rb9k4DiC9NhLOehpOWsEkyxSj6U54oI3JVMb7u1tvm5zEQRGqdsS+U+N4runxyabH 6GMu+tI/sGBZBAbmFz3QXDGabOCkVPEKc+OVlxRT85YCMXSYaE0hQbKDQO1LNPnnwp1lN4 K1zpnOBq4awh5q/knpWZFYWvTEyNCDOgv7NTJ1/7olSegXwdJZwWZuuN3ZIcvpe44MpMQz KAjyLLO4s7UGaTY9VPVhNjeRTNuArF0PWUEIrImMYzk0NgwgyuLa9aZIRNytJQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689611854; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type; bh=Y5SJQxn0ZDmBRnycaaME6sZYGZHCtLOLcnUmkyH2tlU=; b=wedEpE+Wyh8DEV+gBKLNGaNgFlvOnvLH5LnD4cah5cDjAOV4/vFIUJTvh3eTH9uGqUteWU l+4rfhIJfCOrk2FwW7yHgYaAqtgr2/14HN6lAKrDo76Rf2YsOHwShnB5cBcIJwFNKhynxk kAq+R/CkQkXSpklnHl7hpqJhDhBXZNQJWq8BzTAA49YWh+7sdLTk9nNW8xfFwZpKSMZ11h Fh0RyqEZlNZVb8g+U86bbJ8P/yt1ceL70aFpewTQ3mHXTwM9flLgqkavxoiYy4bg4n+tr0 JaRknYaUear047AEatBh+VHitGsB23WKlvhdxWNN0n3EjcUwSaGhqYgAYQfQlw== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1689611854; a=rsa-sha256; cv=none; b=DaZIfatkUAQjV9Hbx1qf7BdINVaaWGmj0JKCuvYy8qmVPSYs248DrACQMMp+gG1SO2HcnE 1Wmm7dbUAQ97bVItAzr7QZdvFlfakAKmGQWxd0P7h0H4JHJ8B3rZp8kzTka1H9x6aJ0ur8 3hs+zNz/e+Y7Sd8SD9Gi0pbCKNt9LHZqHTucjGBZuvOm3vI7ct44hUlL0IcXQAlhUprKVw AU0Z1OQoZpeCMQp0pj+TIUK3K9wMVY9k8OVMPcBcHVgycszEFbB5inuWxxVHha2MbJXjf4 55eiknBYmrmbYTCLdFVkk2ejgrRCAsNVyYEMDCA6wFlT4ebpPc5eoR8GHVUNZg== Received: by freefall.freebsd.org (Postfix, from userid 821) id 5DA336E12; Mon, 17 Jul 2023 16:37:34 +0000 (UTC) Date: Mon, 17 Jul 2023 16:37:34 +0000 From: John To: FreeBSD ARM List Subject: Supermicro R12SPD Ampere Altra - No valid device tree blob found Message-ID: List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline X-ThisMailContainsUnwantedMimeParts: N Hi Folks, I have a new Supermicro system: Supermicro R12SPD BIOS Date:04/26/2023 Rev:1.1a CPU : Ampere(R) Altra(R) Max Processor Booting from the latest media (spot checking older media makes no difference): Boot Media: FreeBSD-14.0-CURRENT-arm64-aarch64-20230713-510fd8313800-264135-disc1.iso Fails here: Loading kernel... /boot/kernel/kernel text=0x2a8 text=0x8ff810 text=0x29b324 data=0x153cc8 data=0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| Loading configured modules... can't find '/etc/hostid' can't find '/boot/entropy' No valid device tree blob found! WARNING! Trying to fire up the kernel, but no device tree blob found! EFI framebuffer information: addr, size 0x10000000, 0x300000 dimensions 1024 x 768 stride 1024 masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 If I break into the loader, the fdt command shows the same error message. OK fdt ls No device tree blob found! OK A verbose boot shows no additional information. I've poked around in the source and don't see an obvious fix for this. Web searches have also not provided any obvious solutions. Any ideas? Thoughts? Thanks, John From nobody Mon Jul 17 17:14:57 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4TH66xk8z4nHTH for ; Mon, 17 Jul 2023 17:15:14 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic304-24.consmr.mail.gq1.yahoo.com (sonic304-24.consmr.mail.gq1.yahoo.com [98.137.68.205]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4TH64brZz4SLG for ; Mon, 17 Jul 2023 17:15:14 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1689614112; bh=goBop5IXU09GnCm2zhePQgTzPuNX9gXALrCdpWBf1K0=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=HbFn5jb+E6rj2gpPTW8yUA08d7POVbW4/4CGUTifgY8B8JBwFuIgGfAFt7V6s6mUOPk9tAaZxqJoNBQWHBEy0I2XoDvjpQ/izxGR1RebrH3QfiDfI0/eLn4HgEGcG+Vifn+t6N0TA0cAKgWYcc7qvj8iAIE5rTeWoT9TbK5ftWi99Otsb4r3X3U3oion37cilbdmTBXvXwcEmBFwwZUjGGLuwWSBt1sO8Ggy92mw6lHbm4N+Jt/3Zsvpv6L8L7mY9rtJ2KvubMMV9ZRt00GaiuXiqj/46CT7OO9NMIu6DrU8MkgUqzezh1EUFwUT9kHzXUHFtOxMzPb6uSY2MP+sTg== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1689614112; bh=aT/tDMC9HdsSjGrkahJ+qc5D80e1OWi8u7qLFXQXr5r=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=LG3AS5rXrRDaygAGDmQVuypQJsS9wajgoie4D0RWqsdS8GfMSdKmVwf2EQdHWvF7R0pNqKk7nvLoH0eXqIShBh1kx3pAiy0LINlpAykZFI2I8CFiSfrF9f8w8bILoQbu/Od1fSAAyegb4MDeDMftnrpkpyLRBIDJpQ4bey7Z4Dz/lfcyayg2JoccLDLlK+JxZbx7V0HcyuB32Z5AdN/HMfVT+c7QncSN/IwCJ7XpU7+eutm2FKAE/qnNIen6szxFcOSSBc+TbRwHlFb5JgVIMLbNWRzjbRQ8fah4v9+KXvfxi/RhCGUAj7SfmYq+00gGu95Z8U/TBu78qZghVRn7xA== X-YMail-OSG: OS51oS0VM1l6x7FYO5Yl_CUjzP.65nCZtG1hx3TkkULzXLWueYp14jqZZG1g3bS 0rJ9TV9sQ06dPYjI05i73PnF6DH3E61zQkeYXhqWDLXINvPrTG3GdWsa71D6v6vaF.AuMcZUAXOS _brRZKuFTFfdDjR.bBYzMVMLHKSMjJRThl8QDV3zTWrM_1SELb48QxRHKbueq41E0aKVOtuguHdK Kx654DP5MbM0Ctv_zKZNtQLrwnsNMBrLM7zbBdTByNigsUXXCkfy9t5i2ovrTBgDZMvrCJd.ZilB 0iWNxq8VBgovCP_7vIEhsXimn23GeIMWGnHwFyK8W4AhX3oqe7_hDLpB1T6q7leiOWbr9oIPJhO7 jQxP.wB32Lk6xT_f7AnaUIvKW47w5skh22mmL12WumBCJyiuYEJ4lJAWgc5g3xIQj35vXXgzHOVt wTgk47CXkIk48Ccp8RkyTY115UiF.pwYY.g1S033hOSEaYrXevP78QtJ_aTmrKqWZmM1jzErU45d NdjaDwD1Uk_cB2Bf.jLBlMPNlftJgtZOSnxT8h11ANNBwx0vxBQEwgWMI7r0j8FXcnD1icNP8aKw gb_xVfBrbCIncJWX8ow0L6KkvWMFBB_PyWLEdRdpY50pzPihNvc18qkGyKexHXScFin2MmJmej1C xEdu39_39GqgxWNvFpUbDT.6YlxIFQN5THcvnXfRC2i88KwsM.glCtArfgEcbzZc9B7eOhznrxqa Eu5A2C99ftCoeEeNbUVejHjeHO2Bcdbu7_8DK7wBi8j4hwUg0LZZV0gjoTyCKjeT.QTnQvu.9wYb Y_cmi8BT29aqK3xyFtWNWQgH5959PyZ9UV5hAfZl3l5e363sasp7Clq4uUs96Z9DkvwGjMhXYH0S Dk6k78LWnUZMrxUZDzRJApmKa8Pw8xhRAPZFhsnEaIE35phjJwgEb_GYP45YokR4RJtQP2MZn_12 dwMPcWQV6Br9CSOg9R2rNVqfULIclYlKD6yBkYZkWoKP.tHaFOSpTiycg5K_n1rxKGwQpJktNDpf z9WK.bvF53y3ufeAHFEHtFgiX12kmE_zEc2ypk1Cckp5JZj5H3u5mMr0ER5QmJW67osI4lwXA0mc 44TMQEiVSYLK2QO5STXYuIZHhmTbQvz76TKHu7Q7ZNQxdNhOkZK6_JBZqZI5bSyKXrLJ5umhBY1O 2A5TxTsvUJzFSWEpCBNr9.P3ojymVymsnvpLXNZOsN5UbHNugsBbPQj44YRxXysR8sepQ8UcNt2n 8dVBcVL4FAJRJeXM1xi2663tpcA1sv_lJu_bT6ELDAL7q3HynSlKi8wXGioALMJCYyDrXnnIlTg_ pB_fsk.w67W8TtUBlBQ9yWmJXAmeJ4XgvRY0_.2MdnbBZLiZ1ncVg1g0VVphLdOmVol5srK6WMSY xpEDIJjx8LBj61Ic2YuKw5qsuUhSOreR2eB09OQOlk6qi1ObX4qgXyj9fg8UGY9QhjaUC2JW7YKw vCTc8BoQE7veeY9Nj30sFWrhRfFC0NAzTX8HzFd.pKGerWT3jzcRYdleutyAcAT3iYoPdcKCRFV2 MHpqSbodUh.vBapQzqgjpeCiN2Sjj6BeI7zLKKwpnWv6gAoOg7DPl7DzX7p4NAmuB_jpgeRpKs8U y_8R4a4ygJHJkwybXW4S8hD_8Tq.VGeztQj0A2GMVpa.H3UAaoVaFgK7nF1G34yGjUoVjgM1czur jjBbxj0GWYA9dk.WRS5tXdKalaFrZrFtAqzrwhHqsFVNqYlxjq_dbmDC50H9u8uGJgTwke0Bx.qE Gp3DWwD3SccUJzagwAK6umDafc8.8bx9OCS4QIuIy007R2EGhKAgE8L3F0dHiuzdKlhd.Dmete8a m870iONOgNKzDi3guO_Zk.jlnLDqAbP0P8Fi3m1zWxR6ZZvnu9TWsxGtAEGukoRgzrlhPWPDkGT4 J_fqMp5v9Fqw6pf1lYqpgNho3cl3EBFdnTivgas0z.SSDjkA1j7W4YKnlhaf0dTFHKjpq9ewa1rq 6eMuoxCdUjTpU4UNizq_wkVZJja8yYAveDAQIew6O8ptqhvXhwRUE36YzD3xqcy3N1dti2V1QHV2 AgKNwXq045lg3exEp1VblKieyG0qmKvQmi6qTOwIvJBvNxx9Y9kAEu2ke3IIUghcepCvPu.Xyz51 DJzrX8ZFydptW0fC7os5ye5SwlGv1S0T0RAW8uixd5leGDweFCBBwejmqMmud8UypHQgYhNSe2v5 10aEJnvXRzWgfgMXUK7ieonc5x7G9gKa5EJz3FkDK_Q9bg0zQtDdEYtSeGMO4x2ZzRQByk1kMCNi z X-Sonic-MF: X-Sonic-ID: b16a9524-b14a-44b7-8468-eadc038aaa2f Received: from sonic.gate.mail.ne1.yahoo.com by sonic304.consmr.mail.gq1.yahoo.com with HTTP; Mon, 17 Jul 2023 17:15:12 +0000 Received: by hermes--production-gq1-5748b5bccb-w7vn4 (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 86caacdf526d9021b76957619aae86c1; Mon, 17 Jul 2023 17:15:08 +0000 (UTC) Content-Type: text/plain; charset=us-ascii List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.600.7\)) Subject: Re: Supermicro R12SPD Ampere Altra - No valid device tree blob found From: Mark Millard In-Reply-To: Date: Mon, 17 Jul 2023 10:14:57 -0700 Cc: FreeBSD ARM List Content-Transfer-Encoding: quoted-printable Message-Id: References: To: John X-Mailer: Apple Mail (2.3731.600.7) X-Rspamd-Queue-Id: 4R4TH64brZz4SLG X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-ThisMailContainsUnwantedMimeParts: N On Jul 17, 2023, at 09:37, John wrote: > Hi Folks, >=20 > I have a new Supermicro system: >=20 > Supermicro R12SPD BIOS Date:04/26/2023 Rev:1.1a > CPU : Ampere(R) Altra(R) Max Processor >=20 > Booting from the latest media (spot checking older > media makes no difference): >=20 > Boot Media: = FreeBSD-14.0-CURRENT-arm64-aarch64-20230713-510fd8313800-264135-disc1.iso >=20 > Fails here: >=20 > Loading kernel... > /boot/kernel/kernel text=3D0x2a8 text=3D0x8ff810 text=3D0x29b324 = data=3D0x153cc8 data=3D0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| > Loading configured modules... > can't find '/etc/hostid' > can't find '/boot/entropy' > No valid device tree blob found! > WARNING! Trying to fire up the kernel, but no device tree blob found! > EFI framebuffer information: > addr, size 0x10000000, 0x300000 > dimensions 1024 x 768 > stride 1024 > masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 >=20 >=20 > If I break into the loader, the fdt command shows the > same error message. >=20 > OK fdt ls > No device tree blob found! >=20 > OK=20 >=20 > A verbose boot shows no additional information. >=20 > I've poked around in the source and don't see an obvious > fix for this. Web searches have also not provided any > obvious solutions. >=20 > Any ideas? Thoughts? UEFI/ACPI booting does not have a "device tree blob" to find but FreeBSD's UEFI laoder still puts out the "No valid device tree blob found!". I see this on all the UEFI/ACPI booting systems that I have access to --and they all boot fine, aarch64 system and the amd64 system. I expect that your boot context is UEFI/ACPI and that the message has mislead you about what to look for relative to booting. But I could be wrong and the system could be trying to boot via fdt. That is one of the problems with the way this messaging is handled. On the HoneyComb (16 Cortex-A72's), for example, there is the FreeBSD loader's configuration command: OK configuration NumberOfTableEntries=3D12 76b6bdfa-2acd-4462-9e3f-cb58c969d937 at 0xfad05b18 fc1bcdb0-7d31-49aa-936a-a4600d9dd083 at 0xfaabfd98 DXE Table at 0xfacea6b0 HOB List Table at 0xfaabd018 MemoryTypeInformation at 0xfacea338 Debug Image Info Table at 0xfad038d8 a4ee0728-e5d7-4ac5-b21e-658ed857e834 at 0xfaccea98 ACPI 2.0 Table at 0xef890018 SMBIOS3 Table at 0xfacb0000 dcfa911d-26eb-469f-a220-38b7dc461220 at 0xee5cb018 HII database at 0xee550018 HII config routing at 0xee530018 For this context, it indicates a UEFI/ACPI boot: note the "ACPI 2.0 Table at". FDT booting would refer to such instead. So you likely can check if you are UEFI/ACPI booting vs. FDT booting. It is technically possible to have an environment that could list both. I've no experience with booting such a system or other knowledge of how FreeBSD handles such. =3D=3D=3D Mark Millard marklmi at yahoo.com From nobody Mon Jul 17 17:20:50 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4TPq0kxpz4nL3Y for ; Mon, 17 Jul 2023 17:21:03 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-ed1-x52b.google.com (mail-ed1-x52b.google.com [IPv6:2a00:1450:4864:20::52b]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4TPp52H5z4Tql for ; Mon, 17 Jul 2023 17:21:02 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-ed1-x52b.google.com with SMTP id 4fb4d7f45d1cf-51e344efd75so9861991a12.1 for ; Mon, 17 Jul 2023 10:21:02 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20221208.gappssmtp.com; s=20221208; t=1689614461; x=1692206461; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=QJxO6iRrhA7GMFdBvUqTglSQ0fu923OCMz++JsfJqto=; b=rvhJayIbVFGW3sIws2Hkkdczp9sELuKt4thHC0SZ70yxn6Pukw/Pe0fe6ufAehMuNq 2LiqsP+d3omQ21B7ClXWUWGZYYjcd3wGzpP23YBU7TYklr83Xc/uAfjpiO7jxQFeo7nB Lg8KErF07bvx+3SWfSPj8pnoJYiZdl6Z7lXPmj2pgmEKZapohvPS6wmphdibTEIf12FO w3O6IUoaek5hYkVxKmaMnQf9dSq90c+3CGAonydX+El+kICvVaA2sOJFawrE+0Zl4FV5 5QCb2TWLiijU3187aP3Yr2KTdFzGqCIk+WvmM2X7NXr+sgJOFFtnrMxXAJZ22Vuvha6B WEIQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20221208; t=1689614461; x=1692206461; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=QJxO6iRrhA7GMFdBvUqTglSQ0fu923OCMz++JsfJqto=; b=O/ov4x8NoUD9ZRC9r8DJdESALINELz/de9ArFSLlSqQ1AHVaaRbC9qoDTJKJwslVqZ dNt2S2Um72fwSivTzZCf82A75dqV7KsMLz4cB4H6pInXCvCkkH9osVKOL+2RyENN9F6I sWjJpcOv6wloS+G8IYa+8/oPuFK+8lpZ/Ps0wqW/CD5ehc2wqpKAed5GTo6ohrw6MGvz LszQKD1d79Py5MkDw7escNULD0xQ9gwvS1Q8CHOta4+o5cm11cI4NydtuFxGJJXTlfTB jO+Gfs1/dwKR2aUOtxhbPtXB1UOP2ALYx9KfYzj0bFC8Wv5GyWEnDMk1EXh/y8p2n0Fl OYVA== X-Gm-Message-State: ABy/qLZdQl+ninfJruLgWUQOZBtrqkrj4app8ZPwqewVs7g1+fAMa4G8 6UpuS8SPebQq+OqXAgy1ykqKsBglwoMYgMuMRJRfTA== X-Google-Smtp-Source: APBJJlESgGnnCbvwjU6sSGQMOF4t4Myb8R+JhOFT5YhDRwHHY2HNvfkefsTAv3036R1reSWCTPrHkvGSR+kv/L+992E= X-Received: by 2002:aa7:d852:0:b0:521:6275:c9af with SMTP id f18-20020aa7d852000000b005216275c9afmr11584237eds.7.1689614460825; Mon, 17 Jul 2023 10:21:00 -0700 (PDT) List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 References: In-Reply-To: From: Warner Losh Date: Mon, 17 Jul 2023 11:20:50 -0600 Message-ID: Subject: Re: Supermicro R12SPD Ampere Altra - No valid device tree blob found To: Mark Millard Cc: John , FreeBSD ARM List Content-Type: multipart/alternative; boundary="000000000000bec7370600b2055f" X-Rspamd-Queue-Id: 4R4TPp52H5z4Tql X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-ThisMailContainsUnwantedMimeParts: N --000000000000bec7370600b2055f Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Mon, Jul 17, 2023 at 11:15=E2=80=AFAM Mark Millard w= rote: > On Jul 17, 2023, at 09:37, John wrote: > > > Hi Folks, > > > > I have a new Supermicro system: > > > > Supermicro R12SPD BIOS Date:04/26/2023 Rev:1.1a > > CPU : Ampere(R) Altra(R) Max Processor > > > > Booting from the latest media (spot checking older > > media makes no difference): > > > > Boot Media: > FreeBSD-14.0-CURRENT-arm64-aarch64-20230713-510fd8313800-264135-disc1.iso > > > > Fails here: > > > > Loading kernel... > > /boot/kernel/kernel text=3D0x2a8 text=3D0x8ff810 text=3D0x29b324 data= =3D0x153cc8 > data=3D0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| > > Loading configured modules... > > can't find '/etc/hostid' > > can't find '/boot/entropy' > > No valid device tree blob found! > > WARNING! Trying to fire up the kernel, but no device tree blob found! > > EFI framebuffer information: > > addr, size 0x10000000, 0x300000 > > dimensions 1024 x 768 > > stride 1024 > > masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 > > > > > > If I break into the loader, the fdt command shows the > > same error message. > > > > OK fdt ls > > No device tree blob found! > > > > OK > > > > A verbose boot shows no additional information. > > > > I've poked around in the source and don't see an obvious > > fix for this. Web searches have also not provided any > > obvious solutions. > > > > Any ideas? Thoughts? > > UEFI/ACPI booting does not have a "device tree blob" to find but > FreeBSD's UEFI laoder still puts out the "No valid device tree > blob found!". I see this on all the UEFI/ACPI booting systems that > I have access to --and they all boot fine, aarch64 system and the > amd64 system. > > I expect that your boot context is UEFI/ACPI and that the message > has mislead you about what to look for relative to booting. > > But I could be wrong and the system could be trying to boot via > fdt. That is one of the problems with the way this messaging is > handled. > > On the HoneyComb (16 Cortex-A72's), for example, there > is the FreeBSD loader's configuration command: > > OK configuration > NumberOfTableEntries=3D12 > 76b6bdfa-2acd-4462-9e3f-cb58c969d937 at 0xfad05b18 > fc1bcdb0-7d31-49aa-936a-a4600d9dd083 at 0xfaabfd98 > DXE Table at 0xfacea6b0 > HOB List Table at 0xfaabd018 > MemoryTypeInformation at 0xfacea338 > Debug Image Info Table at 0xfad038d8 > a4ee0728-e5d7-4ac5-b21e-658ed857e834 at 0xfaccea98 > ACPI 2.0 Table at 0xef890018 > SMBIOS3 Table at 0xfacb0000 > dcfa911d-26eb-469f-a220-38b7dc461220 at 0xee5cb018 > HII database at 0xee550018 > HII config routing at 0xee530018 > > For this context, it indicates a UEFI/ACPI boot: note the > "ACPI 2.0 Table at". FDT booting would refer to such instead. > > So you likely can check if you are UEFI/ACPI booting vs. > FDT booting. > > It is technically possible to have an environment that could > list both. I've no experience with booting such a system or > other knowledge of how FreeBSD handles such. > It's supposed to use FDT if it is present, and ACPI if not. If you have both (which kboot does for $REASONS), then you'll need to set kern.cfg.order=3D"acpi,fdt" in /boot/loader.conf which I do for kboot booted mount jade systems. Warner --000000000000bec7370600b2055f Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable


=
On Mon, Jul 17, 2023 at 11:15=E2=80= =AFAM Mark Millard <marklmi@yahoo.c= om> wrote:
To: Warner Losh Cc: Mark Millard , FreeBSD ARM List Subject: Re: Supermicro R12SPD Ampere Altra - No valid device tree blob found Message-ID: References: List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: 8bit In-Reply-To: X-ThisMailContainsUnwantedMimeParts: N ----- Warner Losh's Original Message ----- > On Mon, Jul 17, 2023 at 11:15 AM Mark Millard wrote: > > > On Jul 17, 2023, at 09:37, John wrote: > > > > > Hi Folks, > > > > > > I have a new Supermicro system: > > > > > > Supermicro R12SPD BIOS Date:04/26/2023 Rev:1.1a > > > CPU : Ampere(R) Altra(R) Max Processor > > > > > > Booting from the latest media (spot checking older > > > media makes no difference): > > > > > > Boot Media: > > FreeBSD-14.0-CURRENT-arm64-aarch64-20230713-510fd8313800-264135-disc1.iso > > > > > > Fails here: > > > > > > Loading kernel... > > > /boot/kernel/kernel text=0x2a8 text=0x8ff810 text=0x29b324 data=0x153cc8 > > data=0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| > > > Loading configured modules... > > > can't find '/etc/hostid' > > > can't find '/boot/entropy' > > > No valid device tree blob found! > > > WARNING! Trying to fire up the kernel, but no device tree blob found! > > > EFI framebuffer information: > > > addr, size 0x10000000, 0x300000 > > > dimensions 1024 x 768 > > > stride 1024 > > > masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 > > > > > > > > > If I break into the loader, the fdt command shows the > > > same error message. > > > > > > OK fdt ls > > > No device tree blob found! > > > > > > OK > > > > > > A verbose boot shows no additional information. > > > > > > I've poked around in the source and don't see an obvious > > > fix for this. Web searches have also not provided any > > > obvious solutions. > > > > > > Any ideas? Thoughts? > > > > UEFI/ACPI booting does not have a "device tree blob" to find but > > FreeBSD's UEFI laoder still puts out the "No valid device tree > > blob found!". I see this on all the UEFI/ACPI booting systems that > > I have access to --and they all boot fine, aarch64 system and the > > amd64 system. > > > > I expect that your boot context is UEFI/ACPI and that the message > > has mislead you about what to look for relative to booting. > > > > But I could be wrong and the system could be trying to boot via > > fdt. That is one of the problems with the way this messaging is > > handled. > > > > On the HoneyComb (16 Cortex-A72's), for example, there > > is the FreeBSD loader's configuration command: > > > > OK configuration > > NumberOfTableEntries=12 > > 76b6bdfa-2acd-4462-9e3f-cb58c969d937 at 0xfad05b18 > > fc1bcdb0-7d31-49aa-936a-a4600d9dd083 at 0xfaabfd98 > > DXE Table at 0xfacea6b0 > > HOB List Table at 0xfaabd018 > > MemoryTypeInformation at 0xfacea338 > > Debug Image Info Table at 0xfad038d8 > > a4ee0728-e5d7-4ac5-b21e-658ed857e834 at 0xfaccea98 > > ACPI 2.0 Table at 0xef890018 > > SMBIOS3 Table at 0xfacb0000 > > dcfa911d-26eb-469f-a220-38b7dc461220 at 0xee5cb018 > > HII database at 0xee550018 > > HII config routing at 0xee530018 > > > > For this context, it indicates a UEFI/ACPI boot: note the > > "ACPI 2.0 Table at". FDT booting would refer to such instead. > > > > So you likely can check if you are UEFI/ACPI booting vs. > > FDT booting. > > > > It is technically possible to have an environment that could > > list both. I've no experience with booting such a system or > > other knowledge of how FreeBSD handles such. > > > > It's supposed to use FDT if it is present, and ACPI if not. > If you have both (which kboot does for $REASONS), then > you'll need to set > kern.cfg.order="acpi,fdt" > in /boot/loader.conf which I do for kboot booted mount jade systems. > > Warner OK set boot_verbose OK set kern.cfg.order="acpi,fdt" OK configuration NumberOfTableEntries=12 76b6bdfa-2acd-4462-9e3f-cb58c969d937 at 0xffe88718 DXE Table at 0xffe84188 HOB List Table at 0xffc40018 MemoryTypeInformation at 0xffe865b8 Debug Image Info Table at 0xffe87380 00781ca1-5de3-405f-abb8-379c3c076984 at 0xffd0db98 ACPI 2.0 Table at 0xffc80000 a4ee0728-e5d7-4ac5-b21e-658ed857e834 at 0xffd07d18 SMBIOS3 Table at 0xf8b1ff98 dcfa911d-26eb-469f-a220-38b7dc461220 at 0xf0c78018 b122a263-3661-4f68-9929-78f8b0d62180 at 0xfa76bd98 d742672e-1918-4a66-a1aa-fda807542d81 at 0xf0be0018 OK lsdev disk devices: disk0: 1792780 X 512 blocks (removable) disk0: ISO9660 disk1: 7501476528 X 512 blocks disk2: 7501476528 X 512 blocks disk3: 7501476528 X 512 blocks disk4: 7501476528 X 512 blocks http: (unknown) net devices: net0: net1: net2: OK boot Loading kernel... /boot/kernel/kernel text=0x2a8 text=0x8ff810 text=0x29b324 data=0x153cc8 data=0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| Loading configured modules... can't find '/etc/hostid' can't find '/boot/entropy' No valid device tree blob found! WARNING! Trying to fire up the kernel, but no device tree blob found! EFI framebuffer information: addr, size 0x10000000, 0x300000 dimensions 1024 x 768 stride 1024 masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 Any suggestions to track this down? Things must be going bad pretty quickly. Thank, John It still fails to boot, no output. From nobody Mon Jul 17 20:39:33 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4YqB0bqWz4mtn5 for ; Mon, 17 Jul 2023 20:39:50 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic313-20.consmr.mail.gq1.yahoo.com (sonic313-20.consmr.mail.gq1.yahoo.com [98.137.65.83]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4Yq94Wfcz4Gtv for ; Mon, 17 Jul 2023 20:39:49 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1689626387; bh=j8HqDBm4Fva78ZC1bmum+5vGH2XfGl1iCprtSflypuw=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=HQuyPbKZrrPuk5vGfA364pQzbyn1DVQ3Lgi3m2q4zIluysMb/d6Z/tULPe0zkzCGVxW/56X+7B2aUk5C3EKBJrtxVCxfwL+aQpmiOPxdICkIXVieDNA5cZtzR8KiYuZCg93WAJesgp1lEShtOX/YDtRaI7wr45NiBxvJoxbfBTHbAL3s8/WZSnAM6bauHfgqLROL11h9j6IKJz4UsO8CZguPbGy1l7R0alb8NwA/VtInjJQIy7j9f8C+EvI2DC8lG35Bl47x0sdP7jziHKuwFgsAgJJBSVP0seYQHGJqeq4/7v0VAo/VZkp8ugTaNSiASn4127ROv2lpgv2jOxh7fA== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1689626387; bh=T8keJWswkczyfyYbyCi3HO6AzTP9WFF6J1CIiaEvsD3=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=bToDA9dEPkm02rOQAzOuewea+cqBhMgSbq03fNG4tpej05OcaVT2aendlvthEgbfw+FKhTvKz8ynFxJk5Y+JnpEc5hwPwt8VklUGC9TfiVW54eF1eIGmXnJH48zLk0UoO0nryoPMDk+APWts2q3yMl9k6uTUwN7rnJysEXCzlBX+1muYaT8bAATbFu+Fs43KsasayRc+KmqT13XEClwYbOPq/W+bELzrW+MF9QXbhu3HBDeQO7ptyYEIKNMe9CuMUfvzluVu1k4DqZb/1x/j6wyPfzPv5tWGLbRyyqp231t8Ra/VZ3N7VSLC0OJuHVH7xJ1YWLXSXMl2o1i8/QkKsg== X-YMail-OSG: 3IFfTCgVM1lWU_CYmRCQqv6yVkVjcIzg8Vlht0W9Fc062GehTfqMKyGPglYQdpm R3wZirczd0XlBAt1J6FAHtBn9VJIgvUaYfWsrn_T2RxVpvDuofPjgHrsom3dKtnB_TCHuX8HZLsM lEfT5WO2U0jBJFhB_yWgKvKqg7eX5iBli3fxwLDXb1R7_A67SKTinOFnP4AGiFqpZLHZQjsEFeEu BQmh2Fe7RjssR_AoQADZPlDq.yXfCkk2yJmU3XioSct7QEBVHXtjRfN9koHcwOh_tBFmcsZjmYgd DNtMqvw8UDWLXuC7So7i_lbFidcdtAtE5Fcp9cCVSlWj2bZPIQUcGoKdS7zh2s7Cp0tkg9GV0i.I rbb5Xjm5rBtI9ROWi3aZIHp1DKA0zJvrLR9k8N9SnFFvxmESwPb_NZOovB9FpBNrpNst395mlBAY e8kZBLJnWESCI9JNu10EX_V7ti7ax2D.pKAckD1tvJ7IfLg_lPeAOst3qJ3s4iLX_YS0oS4_lpLa 3kOx7t9aXg7UIqRXgtBHo2RYexpd4alvh2nDnHnY2u1NnOgqSdMJTtXWygtixVI6HWUbEdvB4STQ .bajAALPmPbq4Il5fEjmFbAHvW8vs_eQ2B_7HhJZDf4C0PTY0LJ0qdsk7rtmkFqpr1nMwAb.NY1S nH4iDE.OZybr8l5_8NrgZVI4Z6m2WqxW62Ficfm3YuUeDd4ImgChSld_0QxU4gi_geo4qQ5yGNV4 dE0Ot5_x6__Nktw1bBugcY39Qihb4DjAxiOmoC1y6.O3rH48x.O4b1j0NuXXBTC._a9B2pQ2ZIVd IAJ7TRu8lU5yP2MuWdOsn0ofIhgxvdG7VBNsv.0..Z2Il2G9SFS1BNSb05RFeQnzrdca9ZPtmmhS _WKjlG1.Lx19hAKUxaHN.HJ5tE0nI56Ja1mbT0bOpRhfeEq.PjyBc6dAGwpa_QZzUCsioKWYMFuo DuDi3ncnVhjIiW6wk_d1hwhMzvNYrW8Teomrpb22SUMoJMcgbOR0CQVMmnawryYIIcIl.kRXzO7f RDKPN8FIUap9Qj7QLOVMK65ddi6EWC0TFz_rijdKgSLjThzeOEHl.0wGDlcZVVzPrVXZtg5aErC1 rK4mRU39xU7lJrPXBNxuOu.3kTyHSdWk2BBTUuIAEqaVTKPwwhrd5FecNCtekeizamCTuQcTXCJX EF1pXKuBtaPXKhpRw5ZLZhoXxUhx.H7lBbopy_nTNlmq4VbdiSwPeWqA3AV7rYYOAyoe382QtiH9 Lvy4dVsk1yorsdtJWKAX6DIVC8XgSX4Pr8KE02MCd0ZXmfkH4p90kyA3QgycWfHBin_lctDyDmhP IK8JpLEgeI3miMWi8vdLTW8JUiqzbbvLPeSCjjXD8aon.h9TgPwbxJBEbEvtNvlVbeJUBeJAqsV1 6r6NgSCBAupN055giScIerlq_3VGCgWTbt.4tHXtN08GKmwmSmFRZPyKKsBQSdGgbhoNsXtEDI8V MgEEiDwpxLYgM4FTjRi_GE7vmdaIvk1uqMSwLfH9dlUH2GEeDOZTdnim0.d.wcb0leMrjLmLKTbk e18GNx9hp2deOvo4brNkDtFuuKjGEj_QNqgEWRtusBJ.v7vYBcN4XjWkTllTUWi1KVesEp.vgIMh jd_l4Ef2fVcBmva0LC4F.uAIFHHMO_gAJGSxK6l8NoEp1zT4FcDqMe8Pt19n3N4oTUFFDX61LJ9a nqEYVQ8AVPvT_TUTNlDjxdOUNFsA_45TQwe0jkHhxkIkgm0b5eo8uFXMGQ.c6zd_hsac6u0LSc0h 2JWWqFRm5MlNLMBTYaG.K4IM6NMUulfqepPhD_z0mWZvDqU_9CK_tt0S0IgEUr4oLbHcNvriMCww by70Ka7P_0nCF6awFbjC..yG8vx45vg8QO86KQjgssAVmUQguCH78T_o2sSLlsshKiziUaVL23ed 2cQ.fuoDps2OKZWI2Bj0ZR1HBRlvXfcX0RgcuF6FiWNJeOdWGSEKpR1M0INVy.br9Rm5t0HqWTAH gftqZUWZo01rgz5vw57vlvr2I7K8vRsR4xLpttAGKySBTsUZqr4QakH1_rvRcdWEkU2ydMTn_5TH p0fVgK9mUgwEb6.nH063kNgVed5PJatjuurdxLCMmnDyPdcMorv9O..jCtnI86VLZhwMtx5t_zBp oIuBkLBDKkn0neBVry1cdMd63CaOOm46MDK08pDItX9dWHeiGERkfDokQgH_2Ngj_dNCbAo0Kdrf 74ytqXh52TPLmyM4P.QtEypmKOr4QJw1ytSHSpsG_VriS5M0yrAgbFI4dh0uGOltmrk9XrdQmc3l mLe.bCQ-- X-Sonic-MF: X-Sonic-ID: e5cc5673-b9f8-4a4a-bc0d-11e506f858f6 Received: from sonic.gate.mail.ne1.yahoo.com by sonic313.consmr.mail.gq1.yahoo.com with HTTP; Mon, 17 Jul 2023 20:39:47 +0000 Received: by hermes--production-gq1-767c8cd9fb-gbtfg (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 5f329f11cd2261de4d26bd7de4f29491; Mon, 17 Jul 2023 20:39:44 +0000 (UTC) Content-Type: text/plain; charset=utf-8 List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.600.7\)) Subject: Re: Supermicro R12SPD Ampere Altra - No valid device tree blob found From: Mark Millard In-Reply-To: Date: Mon, 17 Jul 2023 13:39:33 -0700 Cc: Warner Losh , FreeBSD ARM List Content-Transfer-Encoding: quoted-printable Message-Id: References: To: John X-Mailer: Apple Mail (2.3731.600.7) X-Rspamd-Queue-Id: 4R4Yq94Wfcz4Gtv X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-ThisMailContainsUnwantedMimeParts: N On Jul 17, 2023, at 12:34, John wrote: > ----- Warner Losh's Original Message ----- >> On Mon, Jul 17, 2023 at 11:15=E2=80=AFAM Mark Millard = wrote: >>=20 >>> On Jul 17, 2023, at 09:37, John wrote: >>>=20 >>>> Hi Folks, >>>>=20 >>>> I have a new Supermicro system: >>>>=20 >>>> Supermicro R12SPD BIOS Date:04/26/2023 Rev:1.1a >>>> CPU : Ampere(R) Altra(R) Max Processor >>>>=20 >>>> Booting from the latest media (spot checking older >>>> media makes no difference): >>>>=20 >>>> Boot Media: >>> = FreeBSD-14.0-CURRENT-arm64-aarch64-20230713-510fd8313800-264135-disc1.iso >>>>=20 >>>> Fails here: >>>>=20 >>>> Loading kernel... >>>> /boot/kernel/kernel text=3D0x2a8 text=3D0x8ff810 text=3D0x29b324 = data=3D0x153cc8 >>> data=3D0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| >>>> Loading configured modules... >>>> can't find '/etc/hostid' >>>> can't find '/boot/entropy' >>>> No valid device tree blob found! >>>> WARNING! Trying to fire up the kernel, but no device tree blob = found! >>>> EFI framebuffer information: >>>> addr, size 0x10000000, 0x300000 >>>> dimensions 1024 x 768 >>>> stride 1024 >>>> masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 >>>>=20 >>>>=20 >>>> If I break into the loader, the fdt command shows the >>>> same error message. >>>>=20 >>>> OK fdt ls >>>> No device tree blob found! >>>>=20 >>>> OK >>>>=20 >>>> A verbose boot shows no additional information. >>>>=20 >>>> I've poked around in the source and don't see an obvious >>>> fix for this. Web searches have also not provided any >>>> obvious solutions. >>>>=20 >>>> Any ideas? Thoughts? >>>=20 >>> UEFI/ACPI booting does not have a "device tree blob" to find but >>> FreeBSD's UEFI laoder still puts out the "No valid device tree >>> blob found!". I see this on all the UEFI/ACPI booting systems that >>> I have access to --and they all boot fine, aarch64 system and the >>> amd64 system. >>>=20 >>> I expect that your boot context is UEFI/ACPI and that the message >>> has mislead you about what to look for relative to booting. >>>=20 >>> But I could be wrong and the system could be trying to boot via >>> fdt. That is one of the problems with the way this messaging is >>> handled. >>>=20 >>> On the HoneyComb (16 Cortex-A72's), for example, there >>> is the FreeBSD loader's configuration command: >>>=20 >>> OK configuration >>> NumberOfTableEntries=3D12 >>> 76b6bdfa-2acd-4462-9e3f-cb58c969d937 at 0xfad05b18 >>> fc1bcdb0-7d31-49aa-936a-a4600d9dd083 at 0xfaabfd98 >>> DXE Table at 0xfacea6b0 >>> HOB List Table at 0xfaabd018 >>> MemoryTypeInformation at 0xfacea338 >>> Debug Image Info Table at 0xfad038d8 >>> a4ee0728-e5d7-4ac5-b21e-658ed857e834 at 0xfaccea98 >>> ACPI 2.0 Table at 0xef890018 >>> SMBIOS3 Table at 0xfacb0000 >>> dcfa911d-26eb-469f-a220-38b7dc461220 at 0xee5cb018 >>> HII database at 0xee550018 >>> HII config routing at 0xee530018 >>>=20 >>> For this context, it indicates a UEFI/ACPI boot: note the >>> "ACPI 2.0 Table at". FDT booting would refer to such instead. >>>=20 >>> So you likely can check if you are UEFI/ACPI booting vs. >>> FDT booting. >>>=20 >>> It is technically possible to have an environment that could >>> list both. I've no experience with booting such a system or >>> other knowledge of how FreeBSD handles such. >>>=20 >>=20 >> It's supposed to use FDT if it is present, and ACPI if not. >> If you have both (which kboot does for $REASONS), then >> you'll need to set >> kern.cfg.order=3D"acpi,fdt" >> in /boot/loader.conf which I do for kboot booted mount jade systems. >>=20 >> Warner >=20 > OK set boot_verbose > OK set kern.cfg.order=3D"acpi,fdt" > OK configuration > NumberOfTableEntries=3D12 > 76b6bdfa-2acd-4462-9e3f-cb58c969d937 at 0xffe88718 > DXE Table at 0xffe84188 > HOB List Table at 0xffc40018 > MemoryTypeInformation at 0xffe865b8 > Debug Image Info Table at 0xffe87380 > 00781ca1-5de3-405f-abb8-379c3c076984 at 0xffd0db98 > ACPI 2.0 Table at 0xffc80000 > a4ee0728-e5d7-4ac5-b21e-658ed857e834 at 0xffd07d18 > SMBIOS3 Table at 0xf8b1ff98 > dcfa911d-26eb-469f-a220-38b7dc461220 at 0xf0c78018 > b122a263-3661-4f68-9929-78f8b0d62180 at 0xfa76bd98 > d742672e-1918-4a66-a1aa-fda807542d81 at 0xf0be0018 So no FDT, just "ACPI 2.0 Table at". That likely implies that set kern.cfg.order=3D"acpi,fdt" makes no difference for the actual context: Always UEFI/ACPI. > OK lsdev =20 > disk devices: > disk0: 1792780 X 512 blocks (removable) > disk0: ISO9660 > disk1: 7501476528 X 512 blocks > disk2: 7501476528 X 512 blocks > disk3: 7501476528 X 512 blocks > disk4: 7501476528 X 512 blocks > http: (unknown) > net devices: > net0: > net1: > net2: > OK boot > Loading kernel... > /boot/kernel/kernel text=3D0x2a8 text=3D0x8ff810 text=3D0x29b324 = data=3D0x153cc8 data=3D0x0+0x2c3000 0x8+0x155628+0x8+0x17e504| > Loading configured modules... > can't find '/etc/hostid' > can't find '/boot/entropy' Does the media that has the /boot/kernel/kernel that is used above also have a world? I actually have a context in which the used /boot/kernel/ is on separate media than used for the world. (The FreeBSD kernel was the earliest stage that could actually deal with the USB3 port that I wanted to use for the world.) I had to also deal with having/managing /etc/hostid and /boot/entropy on the media used for the /boot/kernel/ . /boot/loader.conf too. Keeping loadable modules uniformly matching the used kernel was also part of managing this odd context. For this context the /boot/loader.conf for the media for the used /boot/kernel/ has: vfs.root.mountfrom=3D"ufs:/dev/gpt/Rock64root" kern.cam.boot_delay=3D10000 vfs.root_mount_always_wait=3D1 The vfs.root.mountfrom redirects the world's root to load=20 from the USB3 drive's partition holding the world. I'm not claiming such notes are your overall solution. But those "can't find" messages may be a clue if they are unexepected. > No valid device tree blob found! > WARNING! Trying to fire up the kernel, but no device tree blob found! > EFI framebuffer information: > addr, size 0x10000000, 0x300000 > dimensions 1024 x 768 > stride 1024 > masks 0x00ff0000, 0x0000ff00, 0x000000ff, 0xff000000 Serial console possible? Only a video console? There likely are various ways that a video console fails to work, making it not obvious that the boot has actually progressed. Serial console's might have similar issues. Is there some independent evidence that the boot has actually failed vs. its status just not being presented via some form of console? > Any suggestions to track this down? Things must be going > bad pretty quickly. >=20 > Thank, > John >=20 >=20 > It still fails to boot, no output.=20 >=20 =3D=3D=3D Mark Millard marklmi at yahoo.com From nobody Mon Jul 17 21:35:36 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R4b3b5nq5z4nSQ0 for ; Mon, 17 Jul 2023 21:35:39 +0000 (UTC) (envelope-from carlj@peak.org) Received: from mail.nrtc.syn-alias.com (mail.nrtc.syn-alias.com [129.213.214.220]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R4b3Z40XPz3Hct for ; Mon, 17 Jul 2023 21:35:38 +0000 (UTC) (envelope-from carlj@peak.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=peak.org header.s=synacor-nrtc header.b=FB9jcibz; spf=pass (mx1.freebsd.org: domain of carlj@peak.org designates 129.213.214.220 as permitted sender) smtp.mailfrom=carlj@peak.org; dmarc=pass (policy=none) header.from=peak.org DKIM-Signature: v=1; a=rsa-sha1; d=peak.org; s=synacor-nrtc; c=relaxed/simple; q=dns/txt; i=@peak.org; t=1689629737; h=From:Subject:Date:To:MIME-Version:Content-Type; bh=SdvW4Kuu0GaAJJ4PcsCz5ap4zVE=; b=FB9jcibzFlUN31KpyB9ZfZYj7X7XpDZQGhbHICjCYuSlLfznEOZJb+TQVn8tBuvr oRAJRghHpktBa+GnE6ton7K+YvYEybWqf+7mrqqYi2njAYyJs2b61acxbBksGPa0 O+NqlpNthnMbnxBkVxhk9J8dNPoF8JFWWDGtiL9EkdC+J2iYql1DgFmuNimTqrRb bBCpke0seRIXVeTRzZN6GZjfJOwq+bjrfoGyH8JbP0buW5c1Bz5NPivhf53FycCq Kl6RAgVAq/bDuiWIjjYlNPH1JTEVwnTRaGZX+EzOcwF5QAtV7HZnoeKqDe8nX6Fp IUwQWahmsLZva70Kb+AaOA==; X-Authed-Username: Y2FybGpAcGVhay5vcmc= Received: from [208.79.251.72] ([208.79.251.72:39759] helo=bay.localnet) by mail.peak.org (envelope-from ) (ecelerity 4.4.0.19839 r(msys-ecelerity:tags/4.4.0.0^0)) with ESMTPA id 0C/4A-26575-924B5B46; Mon, 17 Jul 2023 17:35:37 -0400 Received: from carlj by bay.localnet with local (Exim 4.96 (FreeBSD)) (envelope-from ) id 1qLVsW-000AvK-08 for freebsd-arm@freebsd.org; Mon, 17 Jul 2023 14:35:36 -0700 From: Carl Johnson To: freebsd-arm@freebsd.org Subject: Re: No packages lately for arm64? References: <86r0p6v8o4.fsf@bay.localnet> Date: Mon, 17 Jul 2023 14:35:36 -0700 In-Reply-To: (Mark Millard's message of "Mon, 17 Jul 2023 09:14:19 -0700") Message-ID: <86edl6uspj.fsf@bay.localnet> User-Agent: Gnus/5.13 (Gnus v5.13) Emacs/28.2 (berkeley-unix) List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 Content-Type: text/plain X-Vade-Verdict: clean X-Vade-Analysis-1: gggruggvucftvghtrhhoucdtuddrgedviedrgeefucetufdoteggodetrfdotffvucfrrhhofhhilhgv X-Vade-Analysis-2: mecuufgjpfetvefqtfdppfftvfevpdfgpfggqdfptffvvedpqfgfvfenuceurghilhhouhhtmecufedt X-Vade-Analysis-3: udenucenucfjughrpefhvffufhffjgfkfgggtgesthdttddttdertdenucfhrhhomhepvegrrhhlucfl X-Vade-Analysis-4: ohhhnhhsohhnuceotggrrhhljhesphgvrghkrdhorhhgqeenucggtffrrghtthgvrhhnpeekieehgfej X-Vade-Analysis-5: jeevhfdvjeettddutdeugeeuueevfeekgeejleejkeduheejhfffudenucffohhmrghinhepfhhrvggv X-Vade-Analysis-6: sghsugdrohhrghenucfkphepvddtkedrjeelrddvhedurdejvdenucevlhhushhtvghrufhiiigvpedt X-Vade-Analysis-7: necurfgrrhgrmhepihhnvghtpedvtdekrdejledrvdehuddrjedvpdhhvghlohepsggrhidrlhhotggr X-Vade-Analysis-8: lhhnvghtpdhmrghilhhfrhhomheptggrrhhljhesphgvrghkrdhorhhgpdhrtghpthhtohepfhhrvggv X-Vade-Analysis-9: sghsugdqrghrmhesfhhrvggvsghsugdrohhrghdpmhhtrghhohhsthepshhmthhptddurdhnrhhttgdr X-Vade-Analysis-10: vghmrghilhdqrghshhdurdhshihntgdrlhgrnhdpnhgspghrtghpthhtohepuddpihhspghnrgepthhr X-Vade-Analysis-11: uhgvpdgruhhthhgpuhhsvghrpegtrghrlhhjsehpvggrkhdrohhrgh X-Vade-Client: NRTC X-Spamd-Result: default: False [-3.00 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[peak.org,none]; R_DKIM_ALLOW(-0.20)[peak.org:s=synacor-nrtc]; R_SPF_ALLOW(-0.20)[+ip4:129.213.214.220]; MIME_GOOD(-0.10)[text/plain]; MLMMJ_DEST(0.00)[freebsd-arm@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[129.213.214.220:from]; ASN(0.00)[asn:31898, ipnet:129.213.208.0/21, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; RCVD_COUNT_THREE(0.00)[3]; FROM_HAS_DN(0.00)[]; ARC_NA(0.00)[]; DKIM_TRACE(0.00)[peak.org:+]; DWL_DNSWL_NONE(0.00)[peak.org:dkim]; TO_DN_NONE(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_TRACE(0.00)[0:+]; RWL_MAILSPIKE_POSSIBLE(0.00)[129.213.214.220:from] X-Rspamd-Queue-Id: 4R4b3Z40XPz3Hct X-Spamd-Bar: -- X-ThisMailContainsUnwantedMimeParts: N Mark Millard writes: > On Jul 17, 2023, at 08:50, Carl Johnson wrote: > >> Hello, >> I have been watching for packages for the new quarterly port builds, but >> I haven't seen anything yet. I already update my amd64 system several >> days ago, but nothing has shown yet for arm64. I checked my logs and I >> installed security updates last month, but there haven't been any for >> the last couple of weeks. When I run pkg update, I just get the >> following: >> >> # pkg update >> Updating FreeBSD repository catalogue... >> FreeBSD repository is up to date. >> All repositories are up to date. >> >> I have compared some package versions to my amd64 system and the arm64 >> packages are definitely out of date. I am running FreeBSD 13.2-RELEASE >> and all pkg configuration files are the original defaults. Is there >> some web site I could look at to see the build status for packages? > > There were major problems with pkg and its performance and resource > use in an update. Official builds for latest were stopped and > restarted multiple times as pkg was updated to try to get past the > issues. > > On 2023-Jul-13 9 builds were started, each on a separate server, each > with 25000+ ports to build. None were quarterly. Looks like 3 > are still not done, one being for arm64 on ampere2. The other of > the 9 build servers are off doing other builds now. 131releng-armv7 > started building on ampere3 but is not quarterly. It has 26000+ ports > to build. > > But 131arm64's quarterly is building on ampere1 and has 12000+ of > 25000+ to go. > > These notes do not cover distribution of built packages to the > distribution servers. That adds more time after the builds and > the status is not as easy to find. > > I used https://pkg-status.freebsd.org/?all=1&type=package to gather > some of the details presented. Mark, Thanks for the information. I have bookmarked that so I can look it up myself in the future. -- Carl Johnson carlj@peak.org From nobody Thu Jul 20 07:09:18 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R63hq53Ckz4nWK9; Thu, 20 Jul 2023 07:09:31 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R63hq0fcDz4KH7; Thu, 20 Jul 2023 07:09:31 +0000 (UTC) (envelope-from eduardo@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689836971; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=GovoON0vwn+9tpnbOpLP6r+iB9YK768YKgOY552cQzs=; b=fw7BtUcEGxW/CbbLgpHn8EnTr+RZ/SLQo8+mFwHo3bxyTDfMQVUiK/7vgl7K+EuY8xkIhW vnqVFO2ZZyYWvz3GoNrNu0QhnM6dm55FiGQKdsahMM7rxPcRbZQ8LEdD8s5yYFTSF/sJH+ otg8JC/fEglQXHRQMPxJAqf2KS+qkrf8PIrzy8ASVLrdZwub8wXd+Rfvcl3XQSXGVzYLW0 NpNnw6QEBVPCnX5r09oSCfLNnBsml6e35wUt71Tew+DxcDynWsorq4uD81K2BGSxbyBvKV w/Bh52vZ9PCd+Ze93ElnBTL7GiJWEpOtaVJLa1oA6XExzndkM4Pr5+uYeKqLhA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689836971; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=GovoON0vwn+9tpnbOpLP6r+iB9YK768YKgOY552cQzs=; b=COcp/Vur9fyyaO1H9914d/CitksBZaaC1YVwpn429r+/70SJyXpENi842Fvv5+7df5M1GY 37zriXQS5jsFVrfL56VEREHKIcGx3IcSXStwYQAs02lJG+eHgQ/9oMAX7ndDhEt12jPi9q KOYYhrqku206PlCjnn6yKZ1I4Z9c7ev5k7gzYNVU+PRwM+36B1WhmZ9MUsPDETCzU0Ru76 gEXJ3bwjfUSp2JsAP13o1aQ6R6eW1cat8zBJ37VOL/4T4Joxo2AiR3BSCsWCEMNi/DlWjg EAWKgDAtj2fBKtMOOsnC8iu3Iui4+ZwxEN0S+dp/SdIV6+MwMMxcZDGkuk19hg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1689836971; a=rsa-sha256; cv=none; b=Eg/I8q1mdnyJKS2ovQl6D2dd738Kg5PVLXDUBjQiqfQ9Iyyw8TMWq/sDA2x1X7QYCXjZhK W8q/Uta2UiW1jvcHsTu1Dk9M9PXnF/gpAdYsmq0sSnXV0KXASCh+AvOmVYQpq4YqcZ8u/D g/XFxZ0+FUctqTvW0L6im7r/kwc2W4UGroehk7z7qYFDQk51Rw7TVx3ReKDrfeCq0Dzp4s RPSxmmXfQgYg9KDpzlXkKsSZ6syL8uapPTgof4WLwjhxqIsVYUlE8KlfT+VJqhMiw99Ynv pfBKLhxiPeGDiHPAn8kVpzYyXQksRuF2M78i/WH+CQkyPyOc3KhMjJWJMmdOFg== Received: from mail-qt1-f179.google.com (mail-qt1-f179.google.com [209.85.160.179]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) (Authenticated sender: eduardo) by smtp.freebsd.org (Postfix) with ESMTPSA id 4R63hp4b15zMsN; Thu, 20 Jul 2023 07:09:30 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: by mail-qt1-f179.google.com with SMTP id d75a77b69052e-40544d92632so283051cf.0; Thu, 20 Jul 2023 00:09:30 -0700 (PDT) X-Gm-Message-State: ABy/qLbpHeZgP9hWPpKzg1u4E7UYmcx6WbfONsk0Cd7UJBu6N/0RZeii PeS+WssmlImlYSPEKnBSEEDyu1uRhl5AvbZ2kto= X-Google-Smtp-Source: APBJJlGe2dtFrKjww+0pnp0cAM0ZVyYuMV9q0h0mWdsM9SYNtZYOLzoAIdIhZuYDzDXyIj4JNVHfqsmAHqv2Bb3b9k8= X-Received: by 2002:a05:622a:489:b0:3f5:2177:eca0 with SMTP id p9-20020a05622a048900b003f52177eca0mr5072385qtx.5.1689836969845; Thu, 20 Jul 2023 00:09:29 -0700 (PDT) List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 References: <5y6r-rus5-wny@FreeBSD.org> In-Reply-To: <5y6r-rus5-wny@FreeBSD.org> From: Nuno Teixeira Date: Thu, 20 Jul 2023 08:09:18 +0100 X-Gmail-Original-Message-ID: Message-ID: Subject: Re: build of www/chromium stops in node18 To: Jan Beich Cc: bob prohaska , freebsd-arm@freebsd.org, freebsd-ports@freebsd.org Content-Type: multipart/alternative; boundary="0000000000005105f70600e5d4ed" --0000000000005105f70600e5d4ed Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Just doing a test run on firefox. I colected this from: https://lists.freebsd.org/archives/freebsd-ports/2023-July/004123.html www/node18: # See also: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D272013 # See also: https://chromium.googlesource.com/v8/v8.git/+/d15d49b09dc7aef9edcc4cf6a0cb2= b77a0db203f .if ${OPSYS} =3D=3D FreeBSD && ${OSVERSION} >=3D 1400091 && ${ARCH} =3D=3D = aarch64 CXXFLAGS+=3D -Wno-error=3Denum-constexpr-conversion .endif Cheers, Jan Beich escreveu no dia ter=C3=A7a, 11/07/2023 =C3= =A0(s) 04:28: > bob prohaska writes: > > > While compiling www/chromium on an 8GB Pi4 poudriere seems to have > > trouble compiling www/node. > [...] > > In file included from > ../deps/v8/src/compiler/backend/instruction-scheduler.cc:5: > > In file included from > ../deps/v8/src/compiler/backend/instruction-scheduler.h:10: > > In file included from ../deps/v8/src/compiler/backend/instruction.h:13: > > In file included from ../deps/v8/src/codegen/external-reference.h:9: > > In file included from ../deps/v8/src/runtime/runtime.h:11: > > ../deps/v8/src/base/bit-field.h:43:29: error: integer value 31 is > outside the valid range of values [0, 15] for the enumeration type > 'AddressingMode' [-Wenum-constexpr-conversion] > > static constexpr T kMax =3D static_cast(kNumValues - 1); > > ^ > > See https://bugs.chromium.org/p/chromium/issues/detail?id=3D1348574#c17 > AddressingMode size depends on architecture, so the above error doesn't > show up on amd64 or i386. > > --=20 Nuno Teixeira FreeBSD Committer (ports) --0000000000005105f70600e5d4ed Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Just doing a test run on firefox.

<= /div>
I colected this from:

= www/node18:

.if $= {OPSYS} =3D=3D FreeBSD && ${OSVERSION} >=3D 1400091 && $= {ARCH} =3D=3D aarch64
CXXFLAGS+=3D -Wno-error=3Denum-constex= pr-conversion
.endif

Cheers,

Jan Beich <jbeich@freebsd.org<= /a>> escreveu no dia ter=C3=A7a, 11/07/2023 =C3=A0(s) 04:28:
bob prohaska <fbsd@www.zefox.net> wr= ites:

> While compiling www/chromium on an 8GB Pi4 poudriere seems to have
> trouble compiling www/node.
[...]
> In file included from ../deps/v8/src/compiler/backend/instruction-sche= duler.cc:5:
> In file included from ../deps/v8/src/compiler/backend/instruction-sche= duler.h:10:
> In file included from ../deps/v8/src/compiler/backend/instruction.h:13= :
> In file included from ../deps/v8/src/codegen/external-reference.h:9: > In file included from ../deps/v8/src/runtime/runtime.h:11:
> ../deps/v8/src/base/bit-field.h:43:29: error: integer value 31 is outs= ide the valid range of values [0, 15] for the enumeration type 'Address= ingMode' [-Wenum-constexpr-conversion]
>=C2=A0 =C2=A0static constexpr T kMax =3D static_cast<T>(kNumValue= s - 1);
>=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 = =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0^

See https://bugs.chromium.org/p/c= hromium/issues/detail?id=3D1348574#c17
AddressingMode size depends on architecture, so the above error doesn't=
show up on amd64 or i386.



--
Nuno Teixeira
FreeBSD Committ= er (ports)
--0000000000005105f70600e5d4ed-- From nobody Thu Jul 20 07:12:29 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R63mS6JFGz4nY80; Thu, 20 Jul 2023 07:12:40 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R63mS5Zt3z4M51; Thu, 20 Jul 2023 07:12:40 +0000 (UTC) (envelope-from eduardo@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689837160; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=FTNHUxSVjjH/Gq9jV9WD/WPyqXhcFRSx1qLKRZCEtio=; b=l0+RyeyoOsf3ZxEVN2ynhODfimdy625HgZNWYOOhEPNdMC6OObf356oQXWHaHEwDx/D0yd SEI66/DLFiN0EApf04fWR/8brnIwMb9InnnKIqYU6PHv5LI/uYAkg4C7jjvRd6fX3Uplts 0zp8k5WD5wNc8XVniW9sqpVdoWTGcNPtJvFUJpLR3yWbGJqar3mX4xK37bjmnTtJEQ3cDM uEviIat5t7JerQGJbzhA6UOWllX2EyBL3NI7v6bEBv+ZufDXFqHVR5e8ksiP9SqSpm7hxk c197pz8vdPskagoDlh9GiY7mjKSWt7Ajy3XpLhyOg5FTVPYASpGyFEk5sz57jg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1689837160; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=FTNHUxSVjjH/Gq9jV9WD/WPyqXhcFRSx1qLKRZCEtio=; b=P69TXJPoyUN7chmmJOUOaHQBlDRT6MWgGR/qE1Zah8MNMDcYWdTdyNB5zxD5OFfRH9Lf9L zKInAgxd2a7PfRw8GXa8lSOLLvLF83PPYh5O01e350IKlPtGdRryEXooRlfsJELtdOaIy2 ZNODrCZw8lNB1ttNcRNVWVnM1X/O6Zl+8APXqfreYbP4Q0oi/xwk1oviKGguY6ELjjc64g 8ODSyktdIkRUSm8wNUOvowDFIaQYejopInj27nfPavLcHAO9jobNYdb1sFzM9U0Uu2KnzI Ch1pAqlxAAKImk2N3KiEuLYketDPPmxV/J1pQNiEh0Y78LErjnQSEWfkn4UF9Q== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1689837160; a=rsa-sha256; cv=none; b=SfFJSI8yb0VHXCCG6nLvqpwqUh5Ien9cL+r+8G1VQgFKaWfwx+Sc9aEXHLQlk8bIBhX3q0 FFzQLvcYUGEQNq6od+/hdZ9L7Y1bBpDQos/dBh45HSyckXI/FAdV7SdpVdc47cEffJ6KPA gls2kz5BV1rRMun7Ubhrb+5JwApL4UvvkZeinrKXnbaGSbAeKv6tmVlltNVPguBYYZXUzv EWzahajItv7i3zIorBNeGTdShollsnFWnAWu7AoqH7HCbFIqSitODkllz9P/s52z4YXyxy dq7w/T57+23xO4n0sr5jaoD3fh69WHRMeSR9ih3nwuj1t/wll3sqz+JjqM9CaQ== Received: from mail-qt1-f170.google.com (mail-qt1-f170.google.com [209.85.160.170]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) (Authenticated sender: eduardo) by smtp.freebsd.org (Postfix) with ESMTPSA id 4R63mS4hv8zM6S; Thu, 20 Jul 2023 07:12:40 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: by mail-qt1-f170.google.com with SMTP id d75a77b69052e-403b07cf5d0so4734731cf.2; Thu, 20 Jul 2023 00:12:40 -0700 (PDT) X-Gm-Message-State: ABy/qLb9Zb6NeckRep11bRQhbm3egGxtXhReqC0NixwepO4uVgDUN0gA 2Kmanl7IxRBd6XZTKss0O/qtNkUj33r6bjS1jlA= X-Google-Smtp-Source: APBJJlFrFbF/bflYS42kwMaA8lFSzdMZM5OODgnkyTSPcnZm9bkB3/H04m+/Z6+kIn8PJUC/tJcxl5XTU15JUfhcB04= X-Received: by 2002:ac8:5786:0:b0:403:ecf7:9c40 with SMTP id v6-20020ac85786000000b00403ecf79c40mr6161309qta.3.1689837160421; Thu, 20 Jul 2023 00:12:40 -0700 (PDT) List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 References: <5y6r-rus5-wny@FreeBSD.org> In-Reply-To: From: Nuno Teixeira Date: Thu, 20 Jul 2023 08:12:29 +0100 X-Gmail-Original-Message-ID: Message-ID: Subject: Re: build of www/chromium stops in node18 To: Jan Beich Cc: bob prohaska , freebsd-arm@freebsd.org, freebsd-ports@freebsd.org Content-Type: multipart/alternative; boundary="000000000000ad1e6f0600e5df13" --000000000000ad1e6f0600e5df13 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable (...) Temporary fix like https://cgit.freebsd.org/ports/commit/?id=3Dee3e6d5a17a0c78bb56f8d5719de82b= 8dd49950d Nuno Teixeira escreveu no dia quinta, 20/07/2023 =C3= =A0(s) 08:09: > Just doing a test run on firefox. > > I colected this from: > https://lists.freebsd.org/archives/freebsd-ports/2023-July/004123.html > > www/node18: > > # See also: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D272013 > # See also: > https://chromium.googlesource.com/v8/v8.git/+/d15d49b09dc7aef9edcc4cf6a0c= b2b77a0db203f > .if ${OPSYS} =3D=3D FreeBSD && ${OSVERSION} >=3D 1400091 && ${ARCH} =3D= =3D aarch64 > CXXFLAGS+=3D -Wno-error=3Denum-constexpr-conversion > .endif > > Cheers, > > Jan Beich escreveu no dia ter=C3=A7a, 11/07/2023 =C3= =A0(s) > 04:28: > >> bob prohaska writes: >> >> > While compiling www/chromium on an 8GB Pi4 poudriere seems to have >> > trouble compiling www/node. >> [...] >> > In file included from >> ../deps/v8/src/compiler/backend/instruction-scheduler.cc:5: >> > In file included from >> ../deps/v8/src/compiler/backend/instruction-scheduler.h:10: >> > In file included from ../deps/v8/src/compiler/backend/instruction.h:13= : >> > In file included from ../deps/v8/src/codegen/external-reference.h:9: >> > In file included from ../deps/v8/src/runtime/runtime.h:11: >> > ../deps/v8/src/base/bit-field.h:43:29: error: integer value 31 is >> outside the valid range of values [0, 15] for the enumeration type >> 'AddressingMode' [-Wenum-constexpr-conversion] >> > static constexpr T kMax =3D static_cast(kNumValues - 1); >> > ^ >> >> See https://bugs.chromium.org/p/chromium/issues/detail?id=3D1348574#c17 >> AddressingMode size depends on architecture, so the above error doesn't >> show up on amd64 or i386. >> >> > > -- > Nuno Teixeira > FreeBSD Committer (ports) > --=20 Nuno Teixeira FreeBSD Committer (ports) --000000000000ad1e6f0600e5df13 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
=
Nuno Teixeira <eduardo@freebsd.org> escreveu = no dia quinta, 20/07/2023 =C3=A0(s) 08:09:
Just doing a test run on f= irefox.

I colected this from:

www/node18:

=
.if ${OPSYS} =3D=3D FreeBSD &&a= mp; ${OSVERSION} >=3D 1400091 && ${ARCH} =3D=3D aarch64
CXXFLAGS+=3D -Wno-error=3Denum-constexpr-conversion
.endif=

Cheers,

Jan Beich <jbeich@freebsd.org> escr= eveu no dia ter=C3=A7a, 11/07/2023 =C3=A0(s) 04:28:
bob prohaska <fbsd@www.zefox.net> writes:

> While compiling www/chromium on an 8GB Pi4 poudriere seems to have
> trouble compiling www/node.
[...]
> In file included from ../deps/v8/src/compiler/backend/instruction-sche= duler.cc:5:
> In file included from ../deps/v8/src/compiler/backend/instruction-sche= duler.h:10:
> In file included from ../deps/v8/src/compiler/backend/instruction.h:13= :
> In file included from ../deps/v8/src/codegen/external-reference.h:9: > In file included from ../deps/v8/src/runtime/runtime.h:11:
> ../deps/v8/src/base/bit-field.h:43:29: error: integer value 31 is outs= ide the valid range of values [0, 15] for the enumeration type 'Address= ingMode' [-Wenum-constexpr-conversion]
>=C2=A0 =C2=A0static constexpr T kMax =3D static_cast<T>(kNumValue= s - 1);
>=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0 = =C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0^

See https://bugs.chromium.org/p/c= hromium/issues/detail?id=3D1348574#c17
AddressingMode size depends on architecture, so the above error doesn't=
show up on amd64 or i386.



--
Nuno Teixeira
FreeBSD Committ= er (ports)


--
Nuno Teixeira
FreeBSD Committ= er (ports)
--000000000000ad1e6f0600e5df13-- From nobody Thu Jul 20 09:40:19 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R672z01gYz4dYXQ for ; Thu, 20 Jul 2023 09:40:27 +0000 (UTC) (envelope-from prvs=1565e86074=weike_chen@dell.com) Received: from mx0b-00154904.pphosted.com (mx0b-00154904.pphosted.com [148.163.137.20]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R672x5f5Jz47h0 for ; Thu, 20 Jul 2023 09:40:25 +0000 (UTC) (envelope-from prvs=1565e86074=weike_chen@dell.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=dell.com header.s=smtpout1 header.b=olRy2ZXp; spf=pass (mx1.freebsd.org: domain of "prvs=1565e86074=weike_chen@dell.com" designates 148.163.137.20 as permitted sender) smtp.mailfrom="prvs=1565e86074=weike_chen@dell.com"; dmarc=pass (policy=reject) header.from=dell.com; arc=reject ("signature check failed: fail, {[1] = sig:microsoft.com:reject}") Received: from pps.filterd (m0170397.ppops.net [127.0.0.1]) by mx0b-00154904.pphosted.com (8.17.1.19/8.17.1.19) with ESMTP id 36K5wBkY023651 for ; Thu, 20 Jul 2023 05:40:23 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=dell.com; h=from : to : subject : date : message-id : content-type : mime-version; s=smtpout1; bh=rPTI3qtjcKnBPdeW5JYNwtvRgYlyWgS8bFF9q97ZroQ=; b=olRy2ZXpSPbZF7awjA2UBDKkgNy45+87cYDX2MUGHpm5flb6PDRuncJSH5N0EFkRkIi9 WMM0cWa2LHyG52LvHqBQhInqpLTIsHktyj4AMpBDl1QF4x+DbmjSu/PxtrQFrzRALKuN dVaYY1sQbdumr+QxqroqeUJrf6hvGrpP8YqIPpq8BLMlFui/jSBGZpQUqdP9PnjhPHIG D6fP3HLHwOMkX0fjhgBJ7uJ32fOCMtxeyIo/82ADT31Mc3ZB+8xFB1fiTP/aa0zh0cw8 /QRtjZ+RUnXkpS5zb8xzHHTzmEFt+5slNf174anNT6gQeh8zdvUZxzZVE8dS4Swl5zNW ew== Received: from mx0b-00154901.pphosted.com (mx0b-00154901.pphosted.com [67.231.157.37]) by mx0b-00154904.pphosted.com (PPS) with ESMTPS id 3rxy8b0srr-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Thu, 20 Jul 2023 05:40:23 -0400 Received: from pps.filterd (m0089483.ppops.net [127.0.0.1]) by mx0b-00154901.pphosted.com (8.17.1.19/8.17.1.19) with ESMTP id 36K9B9dN031767 for ; Thu, 20 Jul 2023 05:40:23 -0400 Received: from nam11-bn8-obe.outbound.protection.outlook.com (mail-bn8nam11lp2169.outbound.protection.outlook.com [104.47.58.169]) by mx0b-00154901.pphosted.com (PPS) with ESMTPS id 3rxnse85vv-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=OK) for ; Thu, 20 Jul 2023 05:40:22 -0400 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=RwNBOmNxh664hlN7NpgiUInP6PvSYa4mPMJJP4ug/TR/xbS89Oqx9Bviyt0ouUeU1Ojf8gARpR932qDJKFfRdDf0w1eqgjLGitviJB9nlmWNdv6Xh9IDPRQ7rnZBpeYUcU07dB59j3NsgqGKsgNfNHOM2PL44qBo0eUUVK/dMgWo0tc7bgjXpfY9X3GdbSwy8AWQuefYKA33nIydilfFCM0QNx/Wi6TpbC6XA+Uq4rtwh7i4nt7wKcnJ3hsSkhXjWu8Bv1cYKToQ/AZtdmCkUop0jYMDXTaarYDNDAM+0fNzNZ/p0IzqFa5gtIJjrOkoQznwr3B0fS6RksyuEU6tsQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=rPTI3qtjcKnBPdeW5JYNwtvRgYlyWgS8bFF9q97ZroQ=; b=cXySfsZTiXuKr8RiUM7zHhldJ5v6CdD1FPF73tz97r2MCi+mjtI+yS24sFU3SA8b/RnW3PgcTbQrPpCgB01s/wHLeJG10iRuHdOeH2Odm/AitRlPHuMqfrwPHjDugqw34irCewAD3MSE9tiCQd1BdBprbiJpq1xznFcdhzn2QVSyECpFpr8oNkzXOVY7R87bw5B1b88g7jypXrrc+ApixHRIHckSy2q/4R4BbTmU2iFhJI8CthjuiMRWAVFLswmzuUbl2ActGbQeEA86r6g3uLnEg9Kx6+bsJMgNUgaHUQf+wzC7j8OCg7/LxUqvHxV6kYMPaiLFyFMxqxaWi2iBfg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=dell.com; dmarc=pass action=none header.from=dell.com; dkim=pass header.d=dell.com; arc=none Received: from PH0PR19MB4938.namprd19.prod.outlook.com (2603:10b6:510:94::9) by MN0PR19MB6017.namprd19.prod.outlook.com (2603:10b6:208:380::10) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.6588.31; Thu, 20 Jul 2023 09:40:19 +0000 Received: from PH0PR19MB4938.namprd19.prod.outlook.com ([fe80::b559:5f89:649b:9fa9]) by PH0PR19MB4938.namprd19.prod.outlook.com ([fe80::b559:5f89:649b:9fa9%4]) with mapi id 15.20.6588.031; Thu, 20 Jul 2023 09:40:19 +0000 From: "Chen, Alvin W" To: "freebsd-arm@freebsd.org" Subject: FreeBSD Arm Image can be installed on Qualcomm Snapdragon. Thread-Topic: FreeBSD Arm Image can be installed on Qualcomm Snapdragon. Thread-Index: Adm67jEehnQ6LqHFSYaDkAYaj8qJYg== Date: Thu, 20 Jul 2023 09:40:19 +0000 Message-ID: Accept-Language: zh-CN, en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Enabled=true; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_SetDate=2023-07-20T09:40:17Z; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Method=Standard; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Name=No Protection (Label Only) - Internal Use; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_SiteId=945c199a-83a2-4e80-9f8c-5a91be5752dd; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_ActionId=b131f878-16ce-4c62-8bf0-622c32073dd0; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_ContentBits=2 x-ms-publictraffictype: Email x-ms-traffictypediagnostic: PH0PR19MB4938:EE_|MN0PR19MB6017:EE_ x-ms-office365-filtering-correlation-id: 4c1ce54a-1663-4cb6-4817-08db89055514 x-exotenant: 2khUwGVqB6N9v58KS13ncyUmMJd8q4 x-ms-exchange-senderadcheck: 1 x-ms-exchange-antispam-relay: 0 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: I0GAFVcdmKPHb/8GKQgLDrECFpYzzn3RzTPVbUFUdcuZ7MQZg024DHmmRHf3ceE+TCu/NQQYtfVEboUrPbQSgXyD9Tk6FBItrRb8tCHGWT2A/XxH+cnyeFeAXDoHch2gb2m/AqaQHQSLpXfOQJO3DaBMik/GQw8ONiAYZ3fVSr1hBxEK4DyRIjEMcD8AWUL1QbI0zvagbpDEvhLkdY7m4gmv/J0GefSQoQRS+Q40hIlrq96uoJpFveN7inJQva5dawtUmgtPMdFCydNnhYmBRX2q/zBHx2gEUSetyU3lKDf/ruoTu7T4m5d0mgvA3Ff1GMz5c/ZG4cn9hVzM24dpFY1/xt4IoaOQVVRGQkXPVampsScGwqbCOZF11XZHQU1xXOWNLramofe8qxjBcui02L4/vSfiw8TbCcMw9tkQVcrWuhb+EVfp4LeZP+9ugkYtx06pNSWiXLQJfGSlbdIyL0bFOM2GrZtRQaqocxXdtjn1epc7ncad4leLJ42FWldsDSOUI6zRlK7tXszFuyYTEC6K72sffisPj0e3K34k/K1/exP1Bbr1VfdtXfPCtdS6WRfuENx+Dbqukf/exWQrXVLsHkeOcDrhW827oDIkXjc= x-forefront-antispam-report: CIP:255.255.255.255;CTRY:;LANG:en;SCL:1;SRV:;IPV:NLI;SFV:NSPM;H:PH0PR19MB4938.namprd19.prod.outlook.com;PTR:;CAT:NONE;SFS:(13230028)(4636009)(376002)(39860400002)(346002)(136003)(396003)(366004)(451199021)(478600001)(2906002)(122000001)(38100700002)(6506007)(186003)(966005)(166002)(55016003)(9686003)(52536014)(83380400001)(26005)(33656002)(86362001)(38070700005)(5660300002)(8676002)(4744005)(71200400001)(7696005)(316002)(786003)(8936002)(66946007)(66556008)(66476007)(76116006)(82960400001)(66446008)(41300700001)(64756008)(6916009);DIR:OUT;SFP:1101; x-ms-exchange-antispam-messagedata-chunkcount: 1 x-ms-exchange-antispam-messagedata-0: =?us-ascii?Q?H8SUdL4eQRzQZsNTPWv8nwBtHm+Ngw5dskErJ1SmiYBQPFd4MwgaolyPXsbB?= =?us-ascii?Q?QL5MmX2Qo4E6Nx40dpfNM7RjycOo1eTJ0jmqly1qiGnMmumvTZHUaKjCuGFG?= =?us-ascii?Q?9JV1ftAYyuqgTeXKyjf6pJO7QomifDa/9zoOnNPQUhQmMazJZhc/+X2Adk9V?= =?us-ascii?Q?hBG1PglbHvXN5ZGNkgcVp+w2ALoGMNrUlczbHYz9ygpX6GjH20xp9yNI+kfq?= =?us-ascii?Q?9/a2Ac3JW1Z2kpZmeHjIzz67xLpPUqUEbrdHI7D9LE6IF9tFVXwPXuUUIl+c?= =?us-ascii?Q?NtEVbY2kn0ijkCRarTZH174857T41b/HWBuwudIlQHwDDo7zZL4TCyg9xuf8?= =?us-ascii?Q?RhtdGSVt0yE0KvN0FJ827ZvDBbmmL5bEYgw9WORcIPFVVXpZMrdwmgQjrgXb?= =?us-ascii?Q?ipIOkGGew5VNc/rBK8mEAclK2pTNoowTelNzcUhi5biVdc0ubwNPc1R0D3uU?= =?us-ascii?Q?CSTEuZL35bGDHUQj0eprjZDnAMIQcDvBRvzg61L+pMC0OuiK9CXgj4TmzMjz?= =?us-ascii?Q?elSv+TsiqjKNio9BVCzRIwbRdBBLDoHLWoRwaD3y73UmmXmz6NaxcmdrFaqB?= =?us-ascii?Q?AZcIA2xrGQeogFGJIwIWOWBQBzkehNErDIfkAMlFtdF/MJ9UEPd+VtGTqA8s?= =?us-ascii?Q?7FDmvunVgJilQ5SIWzzE48ckjJS1U2OUOXSAZFcvlimZNFyj7sqHMS4+Eqnz?= =?us-ascii?Q?CCElOAaPpJ8aIaDfazW5apksEy7v2YOKqiBg32DFT31pwCwweGqTlhvDsVbq?= =?us-ascii?Q?YFuL1bWg+eOMS59uObmIF1kwdQhBAZrGMvQlNomV31Xe8JDjYP731NxLzLon?= =?us-ascii?Q?W6G3Rfep4gGiSndsGz71DzSrw5hN5lbnQfcL1vKOt+ZNHVrxKhEUuwgwA6Zo?= =?us-ascii?Q?yMpgkW4vS6vtXo7xbYxWCSGZOjygyP2zb993mQDIPXF64giz2PY2PFSy/IiR?= =?us-ascii?Q?FFY2H83d9lXRoP+sWH9RhR30jLE7siGxCBQtVZEYEqjBFoSLX4SkmzbLphNn?= =?us-ascii?Q?GZ3w4NKEKc5vbwGhxfgoCIHnVue5SRIPgkxAAALkdrITKZ5rkdGIzr+MLeuU?= =?us-ascii?Q?D527n4CYGQTBOKWPQjXqKAEv3Z8i5MEflPf4acyQIAsT8x4af1dki7kPsKNC?= =?us-ascii?Q?1wCKoujI82D6FIbLYgwm8WAHZT1B1CYS9OmMwOrQMg/jZ6xZGtVLXlTwiP6K?= =?us-ascii?Q?lL495I21rHksggmwCrv19Ih0tscJp5IwGoaqRE7/MCfYZAFCpW2wwwHNJjSX?= =?us-ascii?Q?FZD3dHeJq2+/B11fexvx6gzO7jmOVOL0nIe6jl/wGHUPOCPSEBckdDNe36js?= =?us-ascii?Q?FjZKhJ/DmUlq35IwVdNGGHT5nVL83Zh95onOmbAIwn7MSewdYbgbsOEOA2Pu?= =?us-ascii?Q?ZMCCKYR5sniciFmb/JdrQSodc+0RwOrvJFuTKxSU62dYUGzUeFI+k9VPmiVt?= =?us-ascii?Q?SoGSMrhPnsJoGACkI5bBiLtwIki042a9YndnXdEB4OY/diDPRC6Uq4RfLxyc?= =?us-ascii?Q?ckbfOeDHUF10rKwqzx1z7r0ejSuQVrcPYPFE8IvVCxtW9I9kqlqSSVgn06h0?= =?us-ascii?Q?vCqFwbTFqArpURiganV8nFjeQd00tBIsohuPLuuO?= Content-Type: multipart/alternative; boundary="_000_PH0PR19MB49380DF45B2F05C6CDFF39119E3EAPH0PR19MB4938namp_" List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 X-OriginatorOrg: Dell.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: PH0PR19MB4938.namprd19.prod.outlook.com X-MS-Exchange-CrossTenant-Network-Message-Id: 4c1ce54a-1663-4cb6-4817-08db89055514 X-MS-Exchange-CrossTenant-originalarrivaltime: 20 Jul 2023 09:40:19.7724 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 945c199a-83a2-4e80-9f8c-5a91be5752dd X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: mIuDUfjrqaDccQk8I9pbg50vfjxbILS8YFnoOpnu3G0Tm/f0Fm55ayeK0RdAWBUIDTpQbskV8X68fF+kxuIhVQ== X-MS-Exchange-Transport-CrossTenantHeadersStamped: MN0PR19MB6017 X-Proofpoint-Virus-Version: vendor=baseguard engine=ICAP:2.0.254,Aquarius:18.0.957,Hydra:6.0.591,FMLib:17.11.176.26 definitions=2023-07-20_03,2023-07-19_01,2023-05-22_02 X-Proofpoint-Spam-Details: rule=outbound_notspam policy=outbound score=0 mlxscore=0 clxscore=1011 lowpriorityscore=0 mlxlogscore=551 malwarescore=0 spamscore=0 adultscore=0 bulkscore=0 impostorscore=0 phishscore=0 suspectscore=0 priorityscore=1501 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2306200000 definitions=main-2307200080 X-Proofpoint-ORIG-GUID: TDDGMkd5bwBejyDViT_WT6f2sezU6jkU X-Proofpoint-GUID: TDDGMkd5bwBejyDViT_WT6f2sezU6jkU X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 bulkscore=0 phishscore=0 adultscore=0 lowpriorityscore=0 priorityscore=1501 suspectscore=0 mlxlogscore=597 impostorscore=0 clxscore=1011 spamscore=0 malwarescore=0 mlxscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2306200000 definitions=main-2307200080 X-Spamd-Result: default: False [-6.88 / 15.00]; WHITELIST_SPF_DKIM(-3.00)[dell.com:d:+,dell.com:s:+]; NEURAL_HAM_LONG(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[dell.com:dkim]; ARC_REJECT(1.00)[signature check failed: fail, {[1] = sig:microsoft.com:reject}]; NEURAL_HAM_MEDIUM(-1.00)[-0.999]; NEURAL_HAM_SHORT(-0.88)[-0.885]; DMARC_POLICY_ALLOW(-0.50)[dell.com,reject]; FORGED_SENDER(0.30)[Weike.Chen@Dell.com,prvs=1565e86074=weike_chen@dell.com]; RWL_MAILSPIKE_VERYGOOD(-0.20)[148.163.137.20:from]; R_SPF_ALLOW(-0.20)[+ip4:148.163.137.20]; R_DKIM_ALLOW(-0.20)[dell.com:s=smtpout1]; RCVD_IN_DNSWL_LOW(-0.10)[67.231.157.37:received]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_IN_DNSWL_NONE(0.00)[104.47.58.169:received]; ASN(0.00)[asn:22843, ipnet:148.163.137.0/24, country:US]; TO_DN_EQ_ADDR_ALL(0.00)[]; DKIM_TRACE(0.00)[dell.com:+]; MLMMJ_DEST(0.00)[freebsd-arm@freebsd.org]; FROM_NEQ_ENVFROM(0.00)[Weike.Chen@Dell.com,prvs=1565e86074=weike_chen@dell.com]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-arm@freebsd.org]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_COUNT_SEVEN(0.00)[7] X-Rspamd-Queue-Id: 4R672x5f5Jz47h0 X-Spamd-Bar: ------ --_000_PH0PR19MB49380DF45B2F05C6CDFF39119E3EAPH0PR19MB4938namp_ Content-Type: text/plain; charset="us-ascii" Content-Transfer-Encoding: quoted-printable Hi all, I get one laptop based on Qualcomm Snapdragon 8cx Gen 2, and Qualcomm Snapd= ragon is in FreeBSD Arm supported list. I want to install FreeBSD on it and= download the image from: https://download.freebsd.org/releases/arm64/aarch64/ISO-IMAGES/13.2/FreeBSD= -13.2-RELEASE-arm64-aarch64-memstick.img And make a pendrive installer by dd. The USB boot entry can be detected by = arm BIOS, but it can't boot. I try Ubuntu 22.04 arm ISO, and make the pendr= ive, it can boot well. Is FreeBSD arm image also depended on other HW components but not only SOC? Internal Use - Confidential --_000_PH0PR19MB49380DF45B2F05C6CDFF39119E3EAPH0PR19MB4938namp_ Content-Type: text/html; charset="us-ascii" Content-Transfer-Encoding: quoted-printable

Hi all,

I get one laptop based on Qualcomm Snapdragon 8cx Ge= n 2, and Qualcomm Snapdragon is in FreeBSD Arm supported list. I want to in= stall FreeBSD on it and download the image from:

https://download.freebsd.org/releases/arm64/aarch64/ISO-IMAGES/13.2/FreeBS= D-13.2-RELEASE-arm64-aarch64-memstick.img

 

And make a pendrive installer by dd. The USB boot en= try can be detected by arm BIOS, but it can’t boot. I try Ubuntu 22.0= 4 arm ISO, and make the pendrive, it can boot well.

 

Is FreeBSD arm image also depended on other HW compo= nents but not only SOC?


Internal Use - Con= fidential

--_000_PH0PR19MB49380DF45B2F05C6CDFF39119E3EAPH0PR19MB4938namp_-- From nobody Thu Jul 20 09:44:03 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R677J6Mqcz4dZsT for ; Thu, 20 Jul 2023 09:44:12 +0000 (UTC) (envelope-from prvs=1565e86074=weike_chen@dell.com) Received: from mx0a-00154904.pphosted.com (mx0a-00154904.pphosted.com [148.163.133.20]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R677J1Fh8z49VP for ; Thu, 20 Jul 2023 09:44:12 +0000 (UTC) (envelope-from prvs=1565e86074=weike_chen@dell.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=dell.com header.s=smtpout1 header.b=gX7cmvFY; spf=pass (mx1.freebsd.org: domain of "prvs=1565e86074=weike_chen@dell.com" designates 148.163.133.20 as permitted sender) smtp.mailfrom="prvs=1565e86074=weike_chen@dell.com"; dmarc=pass (policy=reject) header.from=dell.com; arc=reject ("signature check failed: fail, {[1] = sig:microsoft.com:reject}") Received: from pps.filterd (m0170390.ppops.net [127.0.0.1]) by mx0a-00154904.pphosted.com (8.17.1.19/8.17.1.19) with ESMTP id 36K52JXS031611 for ; Thu, 20 Jul 2023 05:44:11 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=dell.com; h=from : to : subject : date : message-id : references : in-reply-to : content-type : mime-version; s=smtpout1; bh=bZiet2FiRaNppe8b+ROTbRgW4H4KJUT/iFFWLbVCyFw=; b=gX7cmvFYRdx7v4OGEm8GK/SpwKF83o2jT+ciKiSvQc7XsD+EEY2OLxlfTPcB1GMAmiED jsQQjvDU631DUoCQ+Nbic+4a0ULbzfBVt6prU+oCD8MG5ZQJfvu/wApp2rttxUEgFZ8L COfekJS6/7R8ZG+U8x7lwhVZdfPHD3Hqf4oVWMHXYGcKQl2inqOGDXTvMX30ThucNomu /VgsmNVrdolFMCiC5tQptnpLCWA6OqHRK+D8o24Bl3TYUK7BWTJqMeGaPLAtUE/VUxU3 1RdOkMMyVTqu2GRPZPOdyhjC5r5+Y9+e+5PuCnpIrMHliZmQ0Obx2B9NB+t3ZHbvlY9o yA== Received: from mx0a-00154901.pphosted.com (mx0a-00154901.pphosted.com [67.231.149.39]) by mx0a-00154904.pphosted.com (PPS) with ESMTPS id 3ruvjfnppj-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Thu, 20 Jul 2023 05:44:10 -0400 Received: from pps.filterd (m0090351.ppops.net [127.0.0.1]) by mx0b-00154901.pphosted.com (8.17.1.19/8.17.1.19) with ESMTP id 36K9Aamr018350 for ; Thu, 20 Jul 2023 05:44:10 -0400 Received: from nam10-bn7-obe.outbound.protection.outlook.com (mail-bn7nam10lp2106.outbound.protection.outlook.com [104.47.70.106]) by mx0b-00154901.pphosted.com (PPS) with ESMTPS id 3ry18thbub-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=OK) for ; Thu, 20 Jul 2023 05:44:09 -0400 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=HkmY5BCRGTWqWmBHXkbcBEYv251t2Kn6+wylKJq+aIvNTMo9ooSJid2hRDLM7D35aMTjnngpz3ifAdZrJTX8/JGgfv7yZzWbiHOn4ikKsKc/TpirVrbN4Ax3XEwT4e+GUIXDWYkKjFUpvCGP3VSgGIuRgILJW8mfcdZwBGr1rp2czn2AwCDN5rzP3mZR+aVJkgUwIGJckZyxoGI9DMum2sd2xG5k53KciQKoYJ8spG/lk6cZ8kcztSYCQru/2P+lO5aK2eweVHq3+QRuGAY1gMVL7mKQIQmgXtNYTlx3vVYJUWNo7SJ++TQocgba4DYy4KZWyi0C1QAcAjIVCZ3Ghw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=bZiet2FiRaNppe8b+ROTbRgW4H4KJUT/iFFWLbVCyFw=; b=ezuQdnypB62GBX0yWFpHRZ2raDM8Q93fgsFz981zeDodGo4yLe0UM8gp1TESoAnHPaGBt5BH3BE90V59w0YGIPq0sMC3Gz293+hLASTLqs6kHLDeC3l0201vIzCUuUISIMIyhxUL+AVIbfcwv76yX11ffzR4QajjB5+fI/N2QIs0Mq5a0cTSpA9Auz2U/gGWmr2p/zYz0NjeyX+ELMb6yUQSnqcWfj4ViISVF08N2oKrI3Dlevl6bjWsR8hPemVE4GQOXfau97qZf8mxW2VX5wO1KQS4dTwXfENzvDb6SPtiBNSuhRaz05uRABHsT+ouOOchDV4wLT02iBc5F3Mi0Q== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=dell.com; dmarc=pass action=none header.from=dell.com; dkim=pass header.d=dell.com; arc=none Received: from PH0PR19MB4938.namprd19.prod.outlook.com (2603:10b6:510:94::9) by BLAPR19MB4387.namprd19.prod.outlook.com (2603:10b6:208:286::18) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.6609.24; Thu, 20 Jul 2023 09:44:04 +0000 Received: from PH0PR19MB4938.namprd19.prod.outlook.com ([fe80::b559:5f89:649b:9fa9]) by PH0PR19MB4938.namprd19.prod.outlook.com ([fe80::b559:5f89:649b:9fa9%4]) with mapi id 15.20.6588.031; Thu, 20 Jul 2023 09:44:03 +0000 From: "Chen, Alvin W" To: "freebsd-arm@freebsd.org" Subject: FreeBSD Arm Image can NOT be installed on Qualcomm Snapdragon. Thread-Topic: FreeBSD Arm Image can NOT be installed on Qualcomm Snapdragon. Thread-Index: AQHZuu64jNdxAy8MeEyDDDuRK0Etkw== Date: Thu, 20 Jul 2023 09:44:03 +0000 Message-ID: References: In-Reply-To: Accept-Language: zh-CN, en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Enabled=true; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_SetDate=2023-07-20T09:44:02Z; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Method=Standard; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Name=No Protection (Label Only) - Internal Use; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_SiteId=945c199a-83a2-4e80-9f8c-5a91be5752dd; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_ActionId=c8e1f282-a329-4cbf-a830-93e6bc95b7eb; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_ContentBits=2 x-ms-publictraffictype: Email x-ms-traffictypediagnostic: PH0PR19MB4938:EE_|BLAPR19MB4387:EE_ x-ms-office365-filtering-correlation-id: 0080893c-8c44-495d-f54e-08db8905da9f x-exotenant: 2khUwGVqB6N9v58KS13ncyUmMJd8q4 x-ms-exchange-senderadcheck: 1 x-ms-exchange-antispam-relay: 0 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: rtrRq0AS2qH0NH6l6OqI+StXyw/VB9YrJbXP9f6M9KU6Hw+jJuwFcGqPi0oYOR6E/f7GjfOjz0rE0kGFLjUa0QJM95olXaKZCh8VxHWbBu38NViqKiIwxWYiiZVo5EA39/cifO7a28vAGzjsKgfGP951942qOtt6Pv0Z5GGP06iShUQTqFSomX7qs8Ob9sqkWfpKpwOW9FdkuyT23sMzxNVawQhht+N4seivDV6CQ3pswtiTbfbV1rby6+1TYliJapWultqsi6SufH4nIyL31dbXbh74jk/7euERtxEVQLy9/UCuXeIKgFNsHMpVL53WnfXfZz6J4bJl2/UAj3JrBjO9X9u6S8s+/x9Prz1iC5F2tno3SSURlPI783l0P4u7V2kcvASoYKqDI/5ealffOpBlKBKUf1CuZJ5IWNGGs6SqBGxv6v7tZka9ahwd9JERS7+8odCpAHAOHZQ3Jv03iUr8F8gDdmQrr4UqIoYEytApUXJ2gW9nmUhmQoDtAl8Zt+jpz5+5LpQRQWrbL8a/gjALv9/fcAnuNx937DK6tei3y1JBqnWWq6kUmMUNyjbugLgpANo5F1wDIrk6Uw7okT3wzLUD1SwR2vXEi4navKU= x-forefront-antispam-report: CIP:255.255.255.255;CTRY:;LANG:en;SCL:1;SRV:;IPV:NLI;SFV:NSPM;H:PH0PR19MB4938.namprd19.prod.outlook.com;PTR:;CAT:NONE;SFS:(13230028)(4636009)(136003)(376002)(39860400002)(396003)(366004)(346002)(451199021)(55016003)(26005)(6506007)(186003)(53546011)(2940100002)(83380400001)(71200400001)(52536014)(5660300002)(8676002)(66946007)(8936002)(6916009)(64756008)(76116006)(316002)(66476007)(66446008)(786003)(66556008)(41300700001)(966005)(9686003)(2906002)(478600001)(4744005)(7696005)(122000001)(33656002)(166002)(82960400001)(38070700005)(86362001)(38100700002)(66899021);DIR:OUT;SFP:1101; x-ms-exchange-antispam-messagedata-chunkcount: 1 x-ms-exchange-antispam-messagedata-0: =?iso-2022-jp?B?aWkyU1NGN3hWVWtpNFdqK0NuYkNGMUU2TGZseGtwb0UxTDZyb3dldUFB?= =?iso-2022-jp?B?QXpWTDd4aTQxTlRxczBuN1J3M0hzK1p6YUpWNEFLTFdVRE1uL20rTHpK?= =?iso-2022-jp?B?cXpzOEJUMlp4eWpLYkFRSEdCWmtxdXRKOWluMUFGTDJiSjdYeWNPeVZu?= =?iso-2022-jp?B?UmxSbGt4NVZGK1h4bmh1dWd0a205MXkzemlmcjQ1WWVTbjBZcS9aRWtp?= =?iso-2022-jp?B?RTdsUklDVWovU3k4MHBacFA2cnhPMTFiVytwYUNDaVhjd0cyanNpSjBW?= =?iso-2022-jp?B?ODI1Z21ieUp3cHh4cldlT1JSNFhNN2VLYUZQSVJyN3hFYjhPVjA2bXZG?= =?iso-2022-jp?B?MjNCYmRIeGViazhVUmxURnNPRkN1YzlZdVdTVW5VemVLMjZXRXN4Qnlk?= =?iso-2022-jp?B?dVBCSU5ZVGZ2YUR5V0pZbW44Vzl1bWlHNXRqNUxGWmhqRkJyV3hOZzhZ?= =?iso-2022-jp?B?dGRlRzMxWnd1d2w1azFST1BiSitlZVExNWVzaEQ0UjJ1SFo2T1B2aXVw?= =?iso-2022-jp?B?ZnBMaURRRm1NSGIyelpnNjhqUk5GL3FiRGY0ZHdWdnFSOHlORzlqVWFC?= =?iso-2022-jp?B?WUFqVnE3SjlhSmxHQXRIWloySU9UeEszcHdYTk8raVFjRFk1TVBSMTdO?= =?iso-2022-jp?B?Um5TODJNK3B0UWYzeVZtanhtQnBscWFZVURuSjAxMWdTVzFUWlY1RFRy?= =?iso-2022-jp?B?akptaXREeTUvak0rQisvU21HQlozc2ZjS203dS9OK2x5dytzZ1BRK0Ux?= =?iso-2022-jp?B?RXRheXdwM2JSV2VNR0RmaDZiRDRDYmRVcGNoQXhtMldyVTE5MStKd1F2?= =?iso-2022-jp?B?SC9zSlpKZloxSHByd1FvY3FzRE5Yb1A5MTZkeUtCajRhR2p1TkVid203?= =?iso-2022-jp?B?dGFkNmVmRW5IeWhSaSs5NnlHMEZFYzg2ZUhpQmorSG9zUll3SlkrVzBz?= =?iso-2022-jp?B?aTdOcnEwL3hMUi9LNExXWVFZOUNqYVpuSm5pTWZCTUtvaTNDWjFBVDVz?= =?iso-2022-jp?B?dUl5dkJFeVVSMWtQWkJyd042M044YnIxei9LbXo2bG9yeHd6cUg0WUVQ?= =?iso-2022-jp?B?YnllY1M2cTZVOEREOFB5S3JFazdRUEgxUkJmcVo4K2I1MFM4MXZPc0M4?= =?iso-2022-jp?B?Zm1HZXNVUEZmNmpzMmU0c3RrRUJvbUIyZ1pHL3RkVXIyQnd0UGtqUmF2?= =?iso-2022-jp?B?VTViUnlYeFc1WVEzaXRyNENweHZmQlVuMmxsRlg5K0ZVQ1JudWwyOEFD?= =?iso-2022-jp?B?NFJxVldtQzFkYmxVY0c5RTJkZFBJWUhUQk5xVVVlQXZZT0RVQXhjcG04?= =?iso-2022-jp?B?alZyNGlYU05uY3N5U2Vzc3EyNTVEMjMwWnBOSTd0Y2t2bUw3THA5aGFM?= =?iso-2022-jp?B?UTZ4dmJLRER5VlJxNFQ1Z1FvRjFBd2prTzNIczFuWWNQKyswWEp3OENr?= =?iso-2022-jp?B?Nk4vTkFOVmxTUytERDczaDFkNmF2R2NQc3p4dHVHN1dmV0tpQUs5akR5?= =?iso-2022-jp?B?MysxL2Z5V3dBWlhHandoSHVxVXZQL0lPeXJVU2diVjBLSk5IaGViQ20x?= =?iso-2022-jp?B?bUJnMWRyaE16V0xlNzZlRGxaKzUvcnhQWDRnYjJXQXJPbms5Q0NzUjgw?= =?iso-2022-jp?B?MGh6dnlMbWlLZ1F1SEpWWThEZldiYkVPcG9VS01ZbTJqbFRQSDRldzNo?= =?iso-2022-jp?B?elhiMUFDRUlmWTlsN0k1ejRlVEJyUnVjMldtVm9PZlhraVNzRlpnekJ4?= =?iso-2022-jp?B?N3dUVHNzNTl0YUFvUzFJN3ovVlVHNEdnZ0JQRFdVaE5WU3EyaGtpd29F?= =?iso-2022-jp?B?UG5yZlZOSnd3b2E1TmhjZzBFMDJZQVc2TlM4c2xsTldtVW5NZ0xEcUdK?= =?iso-2022-jp?B?NkVRd0l5SlM4L041Zno5MnFINFh6ZFJZSHJzdS96cjVGZXBLTXBhWjZn?= =?iso-2022-jp?B?VmJBMjhjeWFPK2ZqTDQ4NkRibXQ4S3AwL0dPMWFDWWRtdlMxbDZEbHls?= =?iso-2022-jp?B?R0FZWXJ2U1B3MXVzbFBkRXZ0RS95TnZQUUR5UVpiN3ZkSzgrUy81MHJy?= =?iso-2022-jp?B?anhXcnVlMDhCZC81eEI1RitpOTZPSGtadC92WDlyY3NSbzAvVjFYb2Ev?= =?iso-2022-jp?B?Zjd1S01wc1NrUnJLaWVsUG51SXI2UkJEOFdBQ1ozSk1HZWZWTHdienpq?= =?iso-2022-jp?B?QW0vTCswaDF3Q2ZTYmg5U2VKcDZQd2VvZXV6ZGl5TERETWtGeTJPSTRH?= =?iso-2022-jp?B?OHlKZ2tINVdCL3ZJSmtQZ05sTnlERVVnUnIxMDRwRGE1MlBWdDlaeWdj?= =?iso-2022-jp?B?TDdoeg==?= Content-Type: multipart/alternative; boundary="_000_PH0PR19MB4938DED4A2F093C6533EF2D99E3EAPH0PR19MB4938namp_" List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 X-OriginatorOrg: Dell.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: PH0PR19MB4938.namprd19.prod.outlook.com X-MS-Exchange-CrossTenant-Network-Message-Id: 0080893c-8c44-495d-f54e-08db8905da9f X-MS-Exchange-CrossTenant-originalarrivaltime: 20 Jul 2023 09:44:03.8796 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 945c199a-83a2-4e80-9f8c-5a91be5752dd X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: yem8IkOIsNuloMk6N6Y3wft+Qo1MRkg3ZQTWTjzJaP4mM0FQCCRxYXQSw/4UlENi2Sy/ebluZoWIpUFDAG6Gvw== X-MS-Exchange-Transport-CrossTenantHeadersStamped: BLAPR19MB4387 X-Proofpoint-Virus-Version: vendor=baseguard engine=ICAP:2.0.254,Aquarius:18.0.957,Hydra:6.0.591,FMLib:17.11.176.26 definitions=2023-07-20_03,2023-07-19_01,2023-05-22_02 X-Proofpoint-Spam-Details: rule=outbound_notspam policy=outbound score=0 lowpriorityscore=0 phishscore=0 mlxscore=0 bulkscore=0 priorityscore=1501 malwarescore=0 mlxlogscore=770 clxscore=1015 impostorscore=0 suspectscore=0 spamscore=0 adultscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2306200000 definitions=main-2307200080 X-Proofpoint-GUID: o-UmCAlZj1WyykQ0QyaDL-VIk3diaJZ0 X-Proofpoint-ORIG-GUID: o-UmCAlZj1WyykQ0QyaDL-VIk3diaJZ0 X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 bulkscore=0 adultscore=0 suspectscore=0 phishscore=0 lowpriorityscore=0 impostorscore=0 malwarescore=0 priorityscore=1501 clxscore=1015 mlxscore=0 spamscore=0 mlxlogscore=844 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2306200000 definitions=main-2307200081 X-Spamd-Result: default: False [-7.06 / 15.00]; WHITELIST_SPF_DKIM(-3.00)[dell.com:d:+,dell.com:s:+]; NEURAL_HAM_LONG(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[dell.com:dkim]; ARC_REJECT(1.00)[signature check failed: fail, {[1] = sig:microsoft.com:reject}]; NEURAL_HAM_MEDIUM(-1.00)[-0.999]; NEURAL_HAM_SHORT(-0.96)[-0.957]; DMARC_POLICY_ALLOW(-0.50)[dell.com,reject]; FORGED_SENDER(0.30)[Weike.Chen@Dell.com,prvs=1565e86074=weike_chen@dell.com]; RWL_MAILSPIKE_VERYGOOD(-0.20)[148.163.133.20:from]; R_SPF_ALLOW(-0.20)[+ip4:148.163.133.20]; R_DKIM_ALLOW(-0.20)[dell.com:s=smtpout1]; RCVD_IN_DNSWL_LOW(-0.20)[148.163.133.20:from,67.231.149.39:received]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_IN_DNSWL_NONE(0.00)[104.47.70.106:received]; ASN(0.00)[asn:26211, ipnet:148.163.133.0/24, country:US]; TO_DN_EQ_ADDR_ALL(0.00)[]; DKIM_TRACE(0.00)[dell.com:+]; MLMMJ_DEST(0.00)[freebsd-arm@freebsd.org]; FROM_NEQ_ENVFROM(0.00)[Weike.Chen@Dell.com,prvs=1565e86074=weike_chen@dell.com]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-arm@freebsd.org]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_COUNT_SEVEN(0.00)[7] X-Rspamd-Queue-Id: 4R677J1Fh8z49VP X-Spamd-Bar: ------- --_000_PH0PR19MB4938DED4A2F093C6533EF2D99E3EAPH0PR19MB4938namp_ Content-Type: text/plain; charset="iso-2022-jp" Content-Transfer-Encoding: quoted-printable Sorry, change the mail title. Regards, Alvin Chen Dell ThinOS | Dell - Commercial Client Group Teams/Zoom: weike_chen@dell.com Internal Use - Confidential From: Chen, Alvin W Sent: 2023=1B$BG/=1B(B7=1B$B7n=1B(B20=1B$BF|=1B(B 17:40 To: freebsd-arm@freebsd.org Subject: FreeBSD Arm Image can be installed on Qualcomm Snapdragon. Hi all, I get one laptop based on Qualcomm Snapdragon 8cx Gen 2, and Qualcomm Snapd= ragon is in FreeBSD Arm supported list. I want to install FreeBSD on it and= download the image from: https://download.freebsd.org/releases/arm64/aarch64/ISO-IMAGES/13.2/FreeBSD= -13.2-RELEASE-arm64-aarch64-memstick.img And make a pendrive installer by dd. The USB boot entry can be detected by = arm BIOS, but it can=1B$B!G=1B(Bt boot. I try Ubuntu 22.04 arm ISO, and mak= e the pendrive, it can boot well. Is FreeBSD arm image also depended on other HW components but not only SOC? Internal Use - Confidential --_000_PH0PR19MB4938DED4A2F093C6533EF2D99E3EAPH0PR19MB4938namp_ Content-Type: text/html; charset="iso-2022-jp" Content-Transfer-Encoding: quoted-printable

Sorry, change the mail title.

 

 

 

Regards,

Alvin Chen

Dell ThinOS | Dell - Commercial Client Group

Teams/Zoom: w= eike_chen@dell.com

 

 

Internal Use - Confidential

From: Chen, Alvin W
Sent: 2023=1B$BG/=1B(B7=1B$B7n=1B(B20=1B$BF|=1B(B 17:40
To: freebsd-arm@freebsd.org
Subject: FreeBSD Arm Image can be installed on Qualcomm Snapdragon.<= o:p>

 

Hi all,

I get one laptop based on Qualcomm Snapdragon 8cx Ge= n 2, and Qualcomm Snapdragon is in FreeBSD Arm supported list. I want to in= stall FreeBSD on it and download the image from:

https://download.freebsd.org/releases/arm64/aarch64/ISO-IMAGES/13.2/FreeBS= D-13.2-RELEASE-arm64-aarch64-memstick.img

 

And make a pendrive installer by dd. The USB boot en= try can be detected by arm BIOS, but it can=1B$B!G=1B(Bt boot. I try Ubuntu= 22.04 arm ISO, and make the pendrive, it can boot well.

 

Is FreeBSD arm image also depended on other HW compo= nents but not only SOC?

 

Internal Use - Confidential

--_000_PH0PR19MB4938DED4A2F093C6533EF2D99E3EAPH0PR19MB4938namp_-- From nobody Thu Jul 20 12:21:35 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R6Bd71W3qz4ndQB for ; Thu, 20 Jul 2023 12:21:47 +0000 (UTC) (envelope-from samm@freebsd.org) Received: from reindeer.net-art.cz (reindeer.net-art.cz [IPv6:2001:15e8:110:513c::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "reindeer.net-art.cz", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R6Bd649NFz43st for ; Thu, 20 Jul 2023 12:21:46 +0000 (UTC) (envelope-from samm@freebsd.org) Authentication-Results: mx1.freebsd.org; dkim=none; spf=softfail (mx1.freebsd.org: 2001:15e8:110:513c::1 is neither permitted nor denied by domain of samm@freebsd.org) smtp.mailfrom=samm@freebsd.org; dmarc=none Received: by reindeer.net-art.cz (Postfix, from userid 65534) id 3DB4F5F116; Thu, 20 Jul 2023 13:21:35 +0100 (BST) X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on reindeer X-Spam-Level: X-Spam-Status: No, score=-6.2 required=10.0 tests=BAYES_00,RCVD_IN_DNSWL_HI, SPF_HELO_NONE,SPF_SOFTFAIL,T_SCC_BODY_TEXT_LINE,URIBL_BLOCKED autolearn=ham autolearn_force=no version=3.4.2 Received: from owl.net-art.cz (unknown [IPv6:2a03:6920:0:10::101]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "owl.net-art.cz", Issuer "R3" (not verified)) by reindeer.net-art.cz (Postfix) with ESMTPS id E21FE5EEB9 for ; Thu, 20 Jul 2023 13:21:34 +0100 (BST) Received: from [::1] (account samm@net-art.cz HELO webmail.net-art.cz) by owl.net-art.cz (CommuniGate Pro SMTP 6.1.20) with ESMTPA id 1981175 for freebsd-arm@freebsd.org; Thu, 20 Jul 2023 14:21:35 +0200 List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 Date: Thu, 20 Jul 2023 14:21:35 +0200 From: Alex Samorukov To: freebsd-arm@freebsd.org Subject: Upgrading FreeBSD on armv6 - my notes Message-ID: X-Sender: samm@freebsd.org Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-3.09 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.99)[-0.995]; MIME_GOOD(-0.10)[text/plain]; FROM_EQ_ENVFROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-arm@freebsd.org]; ARC_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; R_DKIM_NA(0.00)[]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:24806, ipnet:2001:15e8::/32, country:CZ]; DMARC_NA(0.00)[freebsd.org]; RCVD_COUNT_THREE(0.00)[4]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; FREEFALL_USER(0.00)[samm]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-arm@freebsd.org]; R_SPF_SOFTFAIL(0.00)[~all:c]; TO_DOM_EQ_FROM_DOM(0.00)[] X-Rspamd-Queue-Id: 4R6Bd649NFz43st X-Spamd-Bar: --- Hi, Mostly to not forget next time I did a small note about upgrading FreeBSD on the armv6 board (RPI-B in my case) [1]. Comments/suggestions are welcome. P.S. Thank you to all RPI/Arm FreeBSD developers, the board still works like a charm with the latest FreeBSD release. [1] https://smallhacks.wordpress.com/2023/07/20/updating-freebsd-on-armv6-board-rpi-b/ From nobody Thu Jul 20 18:42:03 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R6M485V8tz4dPpW for ; Thu, 20 Jul 2023 18:42:16 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from mail.nomadlogic.org (mail.nomadlogic.org [66.165.241.226]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mail.nomadlogic.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R6M482mkwz3whT for ; Thu, 20 Jul 2023 18:42:16 +0000 (UTC) (envelope-from pete@nomadlogic.org) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=nomadlogic.org; s=04242021; t=1689878526; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=U81WDWNip4NKK/Xl7oUd0OWPkwFNOFNDjWWXxiqOnbU=; b=lf831HueZtuq4iKOoVMB6CFlyswMlO4AOTk0jIwKu6xbMisio2P/dfx4atg2jwHzWW0TAR ImaYSBqWXadhUPmC/s+/uCMGF82dlrG/acb9kF6Bi6FcHKQWV2LH1iVFd9b3Y/zx6gkJQ9 qkTd4H4wPw4nVcMgNTr61v/OygjreMM= Received: from [192.168.1.160] (cpe-24-24-168-214.socal.res.rr.com [24.24.168.214]) by mail.nomadlogic.org (OpenSMTPD) with ESMTPSA id 2a395d98 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Thu, 20 Jul 2023 18:42:05 +0000 (UTC) Message-ID: Date: Thu, 20 Jul 2023 11:42:03 -0700 List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:102.0) Gecko/20100101 Thunderbird/102.13.0 Subject: Re: FreeBSD Arm Image can be installed on Qualcomm Snapdragon. To: "Chen, Alvin W" , "freebsd-arm@freebsd.org" References: Content-Language: en-US From: Pete Wright In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 4R6M482mkwz3whT X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:29802, ipnet:66.165.240.0/22, country:US] X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated On 7/20/23 02:40, Chen, Alvin W wrote: > Hi all, > > I get one laptop based on Qualcomm Snapdragon 8cx Gen 2, and Qualcomm > Snapdragon is in FreeBSD Arm supported list. I want to install FreeBSD > on it and download the image from: > > https://download.freebsd.org/releases/arm64/aarch64/ISO-IMAGES/13.2/FreeBSD-13.2-RELEASE-arm64-aarch64-memstick.img > > And make a pendrive installer by dd. The USB boot entry can be detected > by arm BIOS, but it can’t boot. I try Ubuntu 22.04 arm ISO, and make the > pendrive, it can boot well. > > Is FreeBSD arm image also depended on other HW components but not only SOC? > > how far into the boot process do you get? does it just not detect the boot media at all, or does it fail at some other point? also - are you able to access the system via serial console? -pete -- Pete Wright pete@nomadlogic.org @nomadlogicLA From nobody Fri Jul 21 05:53:41 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R6dzX3NJ9z4nHP2 for ; Fri, 21 Jul 2023 05:54:16 +0000 (UTC) (envelope-from prvs=15668281d3=weike_chen@dell.com) Received: from mx0a-00154904.pphosted.com (mx0a-00154904.pphosted.com [148.163.133.20]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4R6dzX0zptz4JL2 for ; Fri, 21 Jul 2023 05:54:15 +0000 (UTC) (envelope-from prvs=15668281d3=weike_chen@dell.com) Authentication-Results: mx1.freebsd.org; none Received: from pps.filterd (m0170391.ppops.net [127.0.0.1]) by mx0a-00154904.pphosted.com (8.17.1.19/8.17.1.19) with ESMTP id 36KMBbRd003387; Fri, 21 Jul 2023 01:54:14 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=dell.com; h=from : to : subject : date : message-id : references : in-reply-to : content-type : content-transfer-encoding : mime-version; s=smtpout1; bh=wkIWC3fYofU7pW5C6+oYU627hyay2ewrYrh/uubfG1E=; b=bjkc98yZ+PXZAGEj5OGSSfnwJeOofXsKKrPvNElQb3NVgcIU3zSM0LLOTOE3p3tq4t8W oUq5LUx3vFEQ7v0hQAoxAT4ktQlmwg4E81/U/ZF5NVkL35t14RZ+nwGroUs8aOcQdwl+ qLkXqcxFy54dbQ5FZTqMPXZpwsssKmYObbQBNpX0dipepuB0ledtbUq0h2TVW4aQVQjS w4UCD7LF1r0qAt67VDz7L4iB688PxSBiS+mS4yZjcbe4Ebpj3+5XNwpHfGh+HwnOrDFG VhANqnVnFZCkjwFL9d7vZkItB3Z6nlgvGmSaJ52LMbcZaY/gtjyr5iAJFgVVXN3lK7Dr Og== Received: from mx0a-00154901.pphosted.com (mx0a-00154901.pphosted.com [67.231.149.39]) by mx0a-00154904.pphosted.com (PPS) with ESMTPS id 3rwyur5rfn-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT); Fri, 21 Jul 2023 01:54:13 -0400 Received: from pps.filterd (m0142693.ppops.net [127.0.0.1]) by mx0a-00154901.pphosted.com (8.17.1.19/8.17.1.19) with ESMTP id 36L2fRHm025426; Fri, 21 Jul 2023 01:54:13 -0400 Received: from nam10-mw2-obe.outbound.protection.outlook.com (mail-mw2nam10lp2106.outbound.protection.outlook.com [104.47.55.106]) by mx0a-00154901.pphosted.com (PPS) with ESMTPS id 3rydd7ct9u-1 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=OK); Fri, 21 Jul 2023 01:54:12 -0400 ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=lOdGq7zaTyVDbuyjEB+Xje8p67QNa56JoJ+oCKryxODHl+1zIE6WsDYKyV0iQsCkhIV1R5ooY/KH2EvZzL7QtLJv6iXGvyt+3HT9MdeoyKRDXLRQ5alkO12nM3+qOjI1njj9TP/n8lGJZliC7fEA9rOUSvFrs1jlmpkbNELF6Nk48H/OARMBmUaiydrjxoPM9lv+Ew1hhn3ariWqOhZCaHqvasmmdNySZCzjCNSZb5Sj4n8NtLWKfXO1uIMLOJNqeMyzXfuADu6WIgtQhsKJS78cz176iRrgMM/TNzj8p2SWxN85IccDy7H/4Nsf1bpTYZKVvxxCrIS7iW456lZ36A== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=wkIWC3fYofU7pW5C6+oYU627hyay2ewrYrh/uubfG1E=; b=PBces/qraRbxyf8oeaih4EPhmq+mrKrqgtcNH2F3aONNodlmbDErjEzslFGGAW24A9vhAZpeVld0cacleA4BCekljll8mYd71B+nf0GL1Yqki4YK1KZguSG0V5DS6zC2TaoC8KbllIUaGhaboKz+oEloPmX8l/ja5jBeh5QiTj0uRZab9t0ljSAQuRDCk3JMeoM2Wv0hi1tsySoa7lcXCZxVbBO8gLRIiYlwPaQBTaEHu4z/7QNoBrHX/GEAQbJn6fTyooLxj6NvXDaCB0cdUugC4xjcL8u87EuyEvTClfh58s3HXTliToEuvMpmh3SfsnXDtB1JP5PIk1rY52zSQw== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=dell.com; dmarc=pass action=none header.from=dell.com; dkim=pass header.d=dell.com; arc=none Received: from PH0PR19MB4938.namprd19.prod.outlook.com (2603:10b6:510:94::9) by CY5PR19MB6145.namprd19.prod.outlook.com (2603:10b6:930:2f::16) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.6609.28; Fri, 21 Jul 2023 05:53:42 +0000 Received: from PH0PR19MB4938.namprd19.prod.outlook.com ([fe80::b559:5f89:649b:9fa9]) by PH0PR19MB4938.namprd19.prod.outlook.com ([fe80::b559:5f89:649b:9fa9%4]) with mapi id 15.20.6609.026; Fri, 21 Jul 2023 05:53:42 +0000 From: "Chen, Alvin W" To: Pete Wright , "freebsd-arm@freebsd.org" Subject: RE: FreeBSD Arm Image can be installed on Qualcomm Snapdragon. Thread-Topic: FreeBSD Arm Image can be installed on Qualcomm Snapdragon. Thread-Index: Adm67jEehnQ6LqHFSYaDkAYaj8qJYgAS67mAABBMKeA= Date: Fri, 21 Jul 2023 05:53:41 +0000 Message-ID: References: In-Reply-To: Accept-Language: zh-CN, en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Enabled=true; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_SetDate=2023-07-21T05:53:39Z; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Method=Standard; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_Name=No Protection (Label Only) - Internal Use; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_SiteId=945c199a-83a2-4e80-9f8c-5a91be5752dd; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_ActionId=d2389c4f-8f9e-46ca-b4b3-c522222a795a; MSIP_Label_73dd1fcc-24d7-4f55-9dc2-c1518f171327_ContentBits=2 x-ms-publictraffictype: Email x-ms-traffictypediagnostic: PH0PR19MB4938:EE_|CY5PR19MB6145:EE_ x-ms-office365-filtering-correlation-id: 1b8c39cf-6bb7-4124-5f02-08db89aed691 x-exotenant: 2khUwGVqB6N9v58KS13ncyUmMJd8q4 x-ms-exchange-senderadcheck: 1 x-ms-exchange-antispam-relay: 0 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: w1grEFDX9VGnxDIG0AcFp6QlMgqBTaYrYCozhFdGNssoLD2oXy5tOofSQlQ/2a2kW1RwG7MqAAePFDJBeOD4f9bvD4SO4IpA+XbWTXOJ4IdvpZLaaOisXAWQI4ayGQkZjeW0AkSgDqxxQCuqpWdQTuJXnnxcJdJ/Tj/Y23mzlX3i7MVAETxFAPz0O/exRIE7r+Hht/A2zbzYWwIbsP1fnbEKcO5Y1sHcAZzhjg2Mu8wDTqeHaloNSbAuuBg88ThQOotZlyBIwCw7XdZv92GrV4fP6PK5qg5W1mvTuotnTVPWEinYmThGzFQm2kY1zfxgzKYvh8cGmSjF1BeQqVqYbhWl8szVfM25al5XV7P5C3ngyETcfablkZPNhrJK7TRFM71fui+P4tuO7i5ymYOT9InhlftYP5wjy7AdVegzrXZCow1bAF0ahOR0SmF4e/DpZVSp96Mw7d2DZqzmbCFvxYg5a0ecQpJJNLLbnMg6m3yY6DW0jUjtsRltxLoa077d+Ixgn5DcwsRI7kDsKywbh2lxgkKMPm0ttWUAMkp9Ut4l4wvCxjLXiDtwXgOsOtRudU+RUxajAiKUsy+nbemT0XG7Ur6MpqFFK+DYMceqfPoKeQ4jQ5vltWXDTweVx94V/bkAe0A4j5M69+KeX97LFA== x-forefront-antispam-report: CIP:255.255.255.255;CTRY:;LANG:en;SCL:1;SRV:;IPV:NLI;SFV:NSPM;H:PH0PR19MB4938.namprd19.prod.outlook.com;PTR:;CAT:NONE;SFS:(13230028)(4636009)(39860400002)(396003)(366004)(136003)(376002)(346002)(451199021)(966005)(55016003)(9686003)(7696005)(478600001)(38070700005)(71200400001)(316002)(66946007)(19627235002)(64756008)(66446008)(66476007)(66556008)(41300700001)(786003)(86362001)(110136005)(76116006)(6506007)(53546011)(186003)(82960400001)(38100700002)(83380400001)(122000001)(8936002)(33656002)(2906002)(8676002)(5660300002)(52536014)(26005);DIR:OUT;SFP:1101; x-ms-exchange-antispam-messagedata-chunkcount: 1 x-ms-exchange-antispam-messagedata-0: =?utf-8?B?Z3ZuMXByZWFMNUZEbzVkRk9tVWxZeWRXMmFhMzJqSG5sYm1KUzFGeEl6YnBo?= =?utf-8?B?M0ZTcE1qTWhmUlRUUHZUK20rZWF2NTdIRE01VHJsUXp6K0J4MkxPbUtyc0pY?= =?utf-8?B?MTBISk1DYXQyc1lZckxPOEFRU2toYm56U3hWR01MRkp6OHJaOVRtWkdwUC9H?= =?utf-8?B?eUVydGF3WFl1ZFlKaWxFL2ZFTkVNNUJISFU4Z2hvRi80Rk85aHJtejZ1OExp?= =?utf-8?B?YjkvYUNKQTFHemRkcXhOeGJXRnc0ZUxqa2wxZjVFdmg5dFgzZXl0UWZhdTRv?= =?utf-8?B?SEMwZEIvaEdkQzU1MHBmV08rUWRwZGF3NSt5MkNGbjBjMURkRmxpQjJrL25k?= =?utf-8?B?WWtZQWZjSnN1RE9mV3N3YjAzakJJbXdwWDF3Yk1QUjA0YjM4dzllSjBvNW1v?= =?utf-8?B?elQ3dGJtUzhUdHV6cjZvb2g4eEdVejVyc05Ec1IvVktSa3BzVFJkeVovVzJt?= =?utf-8?B?bnJzWllsRHJFOHlBcXl6ajRjNDNNZjlqc3R4d3I2RWhIS3NLQ0Rnd1pDeUYy?= =?utf-8?B?akprTWJlbEd6TWJ4blpYMnhNcFBlbkVrNEI1ZmFycy9OMFYrL09sVXM1V0tw?= =?utf-8?B?VkdLdEhlSkROS2wxaEF4bXVxTHJZRjU5WXcwMTBvUUZPb3ZVRjJYTWZuYThU?= =?utf-8?B?bW4rQWo4azhpMFJsaWhWcEZyVW54T0ozNWwvQXB2dkNUdmZuNDhFYUprcy9E?= =?utf-8?B?RkEzWE9QOTZIUGMxN2VTY3B1YUw2bFZGMUw2dG5lek4zZWxDT0VZNGYzMzJT?= =?utf-8?B?SVFidERQejQwOU5UYVZRQ2J2clNJa1hXdTBXRVVZU1hPSWJFYllUUllTVVJ3?= =?utf-8?B?eHZiK1dQVnI0Ym5ER3Q2TmV3aHlMQ0piR3dsTjAzSkNvRTNYQzM1WXd0L1Nm?= =?utf-8?B?MndBaE80Um8zWktJWWp2S2w3U0luMlBMYlRYNXBmdmI0R216L2VrN0t1RXFV?= =?utf-8?B?d2JqUUZBV1R1am5ZSjJWN3hCRkowWW9BNVBSak5BOHkxRzdQL2N6NXFFeER6?= =?utf-8?B?RU9LSmV3Q2dQQkRTckVJWHU1dVBrYTZNYVRnNU5rTytnVTNJeUg5OVZFMEl6?= =?utf-8?B?bjVWcnV5MlI4R05yU3p4UFM0UmZMWk10QmNSR2tQSTR6L1piT1hXd2htalRv?= =?utf-8?B?VnluZ2xrbUJyMUZwTkNWOFViYWtMWUVrT0JzdnlJQTN2L1RKek5PMlF5RFV5?= =?utf-8?B?Z0NqRFBkV2ZQemhBblBWWWpyMHUyK2tLczRrWnlqRWRuZHVHSzBMakRVODVW?= =?utf-8?B?elp1bkt5WUVva0FWSm03Q1p0akt3WHBFYUw5VXE1WmkxbVBxZExieFIxK0VN?= =?utf-8?B?bE12bXlJWm1DRlBueXlQQVNCR2cvMGxSUUpzaXRhM3J5eWQyZGFuUGNWUTNq?= =?utf-8?B?bXFCYnBkUUVKMUR5OVRhTWo1eHhLN1dhQ2pHUFY1QVlaSHU3VmVnMFJsWmpB?= =?utf-8?B?bXVVOWVsWkFPMXovbGZ4MndRekhuR1V0TU8zUFU3TXVBM05aeUhiS0JvNi9O?= =?utf-8?B?NkhHdjBVVE1qZDI4MzU2b01jdHQyYzY0eFdTM01SQWxOVS92Vk1TS1lCMlZU?= =?utf-8?B?b1hwSHcrYllaRm5hMWc1YVZ6b28wRjVlaXpTRVpMa2pxMk1jNHh3NHpleDFo?= =?utf-8?B?VDBOK1ZOdGh0RnFBWjhTVWFXT1hHcnl4NW4vc0ZjQml0cEFoV0pTdVlpVTdq?= =?utf-8?B?bnNzZ3YyTUQ4QW1vVHFIZXZCajJZRkMvYTBnWC90Y05Bbk8wNDRtaE91UHJj?= =?utf-8?B?VkVJUlc3Z3IzbTlEcDkxeGJhUjh4cHNNMHQvZDN4clgzNW1jTTVGOERvZ1FY?= =?utf-8?B?Y0tuRTh4K3FLbzFyVVlmajRUT00vc0h6UXljMm0zbmc5emM5eDJvMmE3bzVU?= =?utf-8?B?azNnMTk4cG9kODNUZmFCVndCNW9xSlJ5ZFlzWDhERlZlekhTWjA3OU9sa0Vz?= =?utf-8?B?WmhmNUhUMkhjNks3ZjFjZzVJQk80ODRlZW5wMjAyU2IvaHI2b1J1NVZCOXZ0?= =?utf-8?B?Z1k5empHZjRBaFlId1pTSUpheWw5VUhEdjkySlplNnpyTmhaVFpKR0kreWUw?= =?utf-8?B?QmloaW1Id3NqRmlJazFpeXR2Nkg3N1dHQjZ2TnE0Z1dwdHNMdDk2OWxteVZz?= =?utf-8?Q?FTytUYsiPEI/0jcBbE5oZJ0p2?= Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: base64 List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 X-OriginatorOrg: Dell.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: PH0PR19MB4938.namprd19.prod.outlook.com X-MS-Exchange-CrossTenant-Network-Message-Id: 1b8c39cf-6bb7-4124-5f02-08db89aed691 X-MS-Exchange-CrossTenant-originalarrivaltime: 21 Jul 2023 05:53:42.0049 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 945c199a-83a2-4e80-9f8c-5a91be5752dd X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: +eGD/7nHiN/tRuacWr2DCF4zwC2X4pqGNt7b7kY5GESCqlYA665Y1fqD6zwABJVU0NCBcCuxyGPzeq0v1b96Mw== X-MS-Exchange-Transport-CrossTenantHeadersStamped: CY5PR19MB6145 X-Proofpoint-Virus-Version: vendor=baseguard engine=ICAP:2.0.254,Aquarius:18.0.957,Hydra:6.0.591,FMLib:17.11.176.26 definitions=2023-07-21_02,2023-07-20_01,2023-05-22_02 X-Proofpoint-Spam-Details: rule=outbound_notspam policy=outbound score=0 impostorscore=0 bulkscore=0 clxscore=1011 mlxscore=0 adultscore=0 phishscore=0 malwarescore=0 lowpriorityscore=0 priorityscore=1501 spamscore=0 suspectscore=0 mlxlogscore=814 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2306200000 definitions=main-2307210053 X-Proofpoint-ORIG-GUID: kUhi-GqBtietTnyU7wHRYQkm5fYSqGrk X-Proofpoint-GUID: kUhi-GqBtietTnyU7wHRYQkm5fYSqGrk X-Proofpoint-Spam-Details: rule=notspam policy=default score=0 suspectscore=0 lowpriorityscore=0 priorityscore=1501 impostorscore=0 phishscore=0 mlxlogscore=888 adultscore=0 spamscore=0 malwarescore=0 bulkscore=0 clxscore=1011 mlxscore=0 classifier=spam adjust=0 reason=mlx scancount=1 engine=8.12.0-2306200000 definitions=main-2307210052 X-Rspamd-Queue-Id: 4R6dzX0zptz4JL2 X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:26211, ipnet:148.163.133.0/24, country:US] X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated DQoNCkludGVybmFsIFVzZSAtIENvbmZpZGVudGlhbA0KDQo+IC0tLS0tT3JpZ2luYWwgTWVzc2Fn ZS0tLS0tDQo+IEZyb206IFBldGUgV3JpZ2h0IDxwZXRlQG5vbWFkbG9naWMub3JnPg0KPiBTZW50 OiAyMDIz5bm0N+aciDIx5pelIDI6NDINCj4gVG86IENoZW4sIEFsdmluIFc7IGZyZWVic2QtYXJt QGZyZWVic2Qub3JnDQo+IFN1YmplY3Q6IFJlOiBGcmVlQlNEIEFybSBJbWFnZSBjYW4gYmUgaW5z dGFsbGVkIG9uIFF1YWxjb21tIFNuYXBkcmFnb24uDQo+IA0KPiANCj4gW0VYVEVSTkFMIEVNQUlM XQ0KPiANCj4gDQo+IA0KPiBPbiA3LzIwLzIzIDAyOjQwLCBDaGVuLCBBbHZpbiBXIHdyb3RlOg0K PiA+IEhpIGFsbCwNCj4gPg0KPiA+IEkgZ2V0IG9uZSBsYXB0b3AgYmFzZWQgb24gUXVhbGNvbW0g U25hcGRyYWdvbiA4Y3ggR2VuIDIsIGFuZCBRdWFsY29tbQ0KPiA+IFNuYXBkcmFnb24gaXMgaW4g RnJlZUJTRCBBcm0gc3VwcG9ydGVkIGxpc3QuIEkgd2FudCB0byBpbnN0YWxsIEZyZWVCU0QNCj4g PiBvbiBpdCBhbmQgZG93bmxvYWQgdGhlIGltYWdlIGZyb206DQo+ID4NCj4gPiBodHRwczovL3Vy bGRlZmVuc2UuY29tL3YzL19faHR0cHM6Ly9kb3dubG9hZC5mcmVlYnNkLm9yZy9yZWxlYXNlcy9h cm02DQo+ID4gNC9hYXJjaDY0L0lTTy1JTUFHRVMvMTMuMi9GcmVlQlNELTEzLjItUkVMRUFTRS1h cm02NC1hYXJjaDY0LQ0KPiBtZW1zdGljay4NCj4gPiBpbWdfXzshIUxwS0khaHdQRENQa1oyLUht aEtZYU42ZzA4YW1RSVl5S3VJUmxheHktDQo+IEFfZmltNThYdUF3OFM1TlVDenpYMQ0KPiA+IEtj WldXb3YzYXF1NEJWNk1TaWpkMm8kIFtkb3dubG9hZFsuXWZyZWVic2RbLl1vcmddDQo+ID4gPGh0 dHBzOi8vdXJsZGVmZW5zZS5jb20vdjMvX19odHRwczovL2Rvd25sb2FkLmZyZWVic2Qub3JnL3Jl bGVhc2VzL2FybQ0KPiA+IDY0L2FhcmNoNjQvSVNPLUlNQUdFUy8xMy4yL0ZyZWVCU0QtMTMuMi1S RUxFQVNFLWFybTY0LWFhcmNoNjQtDQo+IG1lbXN0aWNrDQo+ID4gLmltZ19fOyEhTHBLSSFod1BE Q1BrWjItSG1oS1lhTjZnMDhhbVFJWXlLdUlSbGF4eS0NCj4gQV9maW01OFh1QXc4UzVOVUN6elgN Cj4gPiAxS2NaV1dvdjNhcXU0QlY2TVNpamQybyQgW2Rvd25sb2FkWy5dZnJlZWJzZFsuXW9yZ10+ DQo+ID4NCj4gPiBBbmQgbWFrZSBhIHBlbmRyaXZlIGluc3RhbGxlciBieSBkZC4gVGhlIFVTQiBi b290IGVudHJ5IGNhbiBiZQ0KPiA+IGRldGVjdGVkIGJ5IGFybSBCSU9TLCBidXQgaXQgY2Fu4oCZ dCBib290LiBJIHRyeSBVYnVudHUgMjIuMDQgYXJtIElTTywNCj4gPiBhbmQgbWFrZSB0aGUgcGVu ZHJpdmUsIGl0IGNhbiBib290IHdlbGwuDQo+ID4NCj4gPiBJcyBGcmVlQlNEIGFybSBpbWFnZSBh bHNvIGRlcGVuZGVkIG9uIG90aGVyIEhXIGNvbXBvbmVudHMgYnV0IG5vdCBvbmx5DQo+IFNPQz8N Cj4gPg0KPiA+DQo+IA0KPiBob3cgZmFyIGludG8gdGhlIGJvb3QgcHJvY2VzcyBkbyB5b3UgZ2V0 PyAgZG9lcyBpdCBqdXN0IG5vdCBkZXRlY3QgdGhlIGJvb3QNCj4gbWVkaWEgYXQgYWxsLCBvciBk b2VzIGl0IGZhaWwgYXQgc29tZSBvdGhlciBwb2ludD8gIGFsc28gLSBhcmUgeW91IGFibGUgdG8g YWNjZXNzDQo+IHRoZSBzeXN0ZW0gdmlhIHNlcmlhbCBjb25zb2xlPw0KPiANClRoZSBsYXB0b3Ag aXMgaW5zdGFsbGVkIHdpdGggd2luMTEsIGFuZCBJIGRpc2FibGVkIHRoZSBzZWN1cmUgYm9vdC4g VGhlIEJJT1MgY2FuIGRldGVjdCB0aGUgcGVuZHJpdmUgYm9vdCBlbnRyeS4gSSBzZWxlY3QgdG8g Ym9vdCBmcm9tIHBlbmRyaXZlLCBhbmQgaXQgaXMgYmxhY2sgc2NyZWVuLiBGb3IgYSB3aGlsZSwg aXQgYm9vdCBmcm9tIHdpbjExLg0KSXQgaXMgbGFwdG9wLCBzbyBubyBzZXJpYWwgcG9ydC4NCg== From nobody Sat Jul 22 08:45:07 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R7KkD1rDKz4dbcs for ; Sat, 22 Jul 2023 08:45:08 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R7KkC3LfLz450t for ; Sat, 22 Jul 2023 08:45:07 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1690015507; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=adkjgVleif+GtoeqbGv0nxNwJkRCH5QrIbSvqZPza+c=; b=oymQzBm240Ds48nJukGg17/geaG5hSujLEfSVFb4u+RppozbyrrWF7w7jHfc+ug77KdVuG PA02AA0ZT2LQ02sv/jXNoTd+TOlOjEoBad5Nn02f4vDwK5JNt7pe/wrhIiPpUwrhckL7y+ WXJ1S5EE5fM+Rz35V+xcUV/oMw5JqHIPGXQXgcUdkP26wNCtHgbdhdW3yQ5GlnlBZOLD7r 4XRRi6g2vc3z+8YOpxT20mUW1UQi/pZht4MBGm7Ba7xr6N/iqtwe8sfynP/5/qqYAsC5Tb t6wrInoR05mpcmmb48ag6eWVrsXwKwA1wO7UZB8f+HUiaEbFZTDwoaQIXq6glQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1690015507; a=rsa-sha256; cv=none; b=DjersoUY6QTouIcBULwkIO3a6qynPbCw+yO/xAA1YI4BUJbWc23VfLpS1xGxK59Psj3RpU jplV+g+/b9AjcoGxH66DJ2xK0h7I1aLsIOezFq0iQO25ABYNQN5liX2siPgcMitrb1+sLT 3xRmpV89mcgqJXPIGi+brEK5saLwBZNkEwOCrUNaXFDOyZC+6y77lM0pcH8ykoLYnPvPMu CIejakmVWVUQ2Oll3PlHolcXq1R2Q9YPWiYJWRI02mm0Zq0nhkrO5yDUHtG8+TyPPRkjzR cpHkziemJW+/3bK5G0rKgadlGgSfbcN4njxX9lgWir0LTvNzvk8Q/phnnIZEFQ== Received: from kenobi.freebsd.org (kenobi.freebsd.org [IPv6:2610:1c1:1:606c::50:1d]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4R7KkC2S4WzpG8 for ; Sat, 22 Jul 2023 08:45:07 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) Received: from kenobi.freebsd.org ([127.0.1.5]) by kenobi.freebsd.org (8.15.2/8.15.2) with ESMTP id 36M8j7Ls070804 for ; Sat, 22 Jul 2023 08:45:07 GMT (envelope-from bugzilla-noreply@freebsd.org) Received: (from www@localhost) by kenobi.freebsd.org (8.15.2/8.15.2/Submit) id 36M8j7bP070803 for freebsd-arm@FreeBSD.org; Sat, 22 Jul 2023 08:45:07 GMT (envelope-from bugzilla-noreply@freebsd.org) X-Authentication-Warning: kenobi.freebsd.org: www set sender to bugzilla-noreply@freebsd.org using -f From: bugzilla-noreply@freebsd.org To: freebsd-arm@FreeBSD.org Subject: [Bug 272653] [aarch64] Huawei qingyun and kunpeng stop at SAS pci4: at device 0.0 (no driver attached). Date: Sat, 22 Jul 2023 08:45:07 +0000 X-Bugzilla-Reason: AssignedTo X-Bugzilla-Type: new X-Bugzilla-Watch-Reason: None X-Bugzilla-Product: Base System X-Bugzilla-Component: arm X-Bugzilla-Version: 13.1-RELEASE X-Bugzilla-Keywords: X-Bugzilla-Severity: Affects Only Me X-Bugzilla-Who: yklaxds@gmail.com X-Bugzilla-Status: New X-Bugzilla-Resolution: X-Bugzilla-Priority: --- X-Bugzilla-Assigned-To: freebsd-arm@FreeBSD.org X-Bugzilla-Flags: X-Bugzilla-Changed-Fields: bug_id short_desc product version rep_platform op_sys bug_status bug_severity priority component assigned_to reporter Message-ID: Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Bugzilla-URL: https://bugs.freebsd.org/bugzilla/ Auto-Submitted: auto-generated List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D272653 Bug ID: 272653 Summary: [aarch64] Huawei qingyun and kunpeng stop at SAS pci4: at device 0.0 (no driver attached). Product: Base System Version: 13.1-RELEASE Hardware: Any OS: Any Status: New Severity: Affects Only Me Priority: --- Component: arm Assignee: freebsd-arm@FreeBSD.org Reporter: yklaxds@gmail.com Huawei qingyun and kunpeng stop at SAS pci4: at device = 0.0 (no driver attached). ----------- SAS pci4: at device 0.0 (no driver attached). --------- ---------- Serial Attached SCSI controller: Huawei Technologies Co., Ltd. HiSilicon SAS 3.0 HBA (rev 21) ---------- qingyun w510 : ---------- pci 00:00.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 00:08.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 00:0a.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 00:0c.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 00:0d.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 00:0e.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 00:0f.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCIe Root Port = with Gen4 (rev 21) 01:00.0 VGA compatible controller: Advanced Micro Devices, Inc. [AMD/ATI] O= land [Radeon HD 8570 / R5 430 OEM / R7 240/340 / Radeon 520 OEM] (rev 87) 01:00.1 Audio device: Advanced Micro Devices, Inc. [AMD/ATI] Oland/Hainan/C= ape Verde/Pitcairn HDMI Audio [Radeon HD 7000 Series] 03:00.0 Non-Volatile memory controller: Samsung Electronics Co Ltd NVMe SSD Controller SM981/PM981/PM983 04:00.0 Network controller: Huawei Technologies Co., Ltd. Device 1103 (rev = 02) 05:00.0 USB controller: Renesas Technology Corp. uPD720202 USB 3.0 Host Controller (rev 02) 74:00.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCI-PCI Bridge = (rev 20) 74:01.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCI-PCI Bridge = (rev 20) 74:02.0 Serial Attached SCSI controller: Huawei Technologies Co., Ltd. HiSilicon SAS 3.0 HBA (rev 21) 74:03.0 SATA controller: Huawei Technologies Co., Ltd. HiSilicon AHCI HBA (= rev 21) 74:04.0 Serial Attached SCSI controller: Huawei Technologies Co., Ltd. HiSilicon SAS 3.0 HBA (rev 21) 76:00.0 Network and computing encryption device: Huawei Technologies Co., L= td. HiSilicon SEC Engine (rev 21) 78:00.0 PCI bridge: Huawei Technologies Co., Ltd. HiSilicon PCI-PCI Bridge = (rev 20) 78:01.0 RAID bus controller: Huawei Technologies Co., Ltd. HiSilicon RDE En= gine (rev 21) 7a:00.0 USB controller: Huawei Technologies Co., Ltd. HiSilicon USB 1.1 Host Controller (rev 21 ------------- --=20 You are receiving this mail because: You are the assignee for the bug.= From nobody Sat Jul 22 17:48:59 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R7Ynq5LPMz4pT4n for ; Sat, 22 Jul 2023 17:49:03 +0000 (UTC) (envelope-from samm@freebsd.org) Received: from reindeer.net-art.cz (reindeer.net-art.cz [IPv6:2001:15e8:110:513c::1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) client-signature RSA-PSS (2048 bits)) (Client CN "reindeer.net-art.cz", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R7Ynq1P7Jz3Dh0 for ; Sat, 22 Jul 2023 17:49:03 +0000 (UTC) (envelope-from samm@freebsd.org) Authentication-Results: mx1.freebsd.org; dkim=none; spf=softfail (mx1.freebsd.org: 2001:15e8:110:513c::1 is neither permitted nor denied by domain of samm@freebsd.org) smtp.mailfrom=samm@freebsd.org; dmarc=none Received: by reindeer.net-art.cz (Postfix, from userid 65534) id D491A5F1E7; Sat, 22 Jul 2023 18:49:00 +0100 (BST) X-Spam-Checker-Version: SpamAssassin 3.4.2 (2018-09-13) on reindeer X-Spam-Level: X-Spam-Status: No, score=-1.2 required=10.0 tests=BAYES_00, RCVD_IN_DNSWL_BLOCKED,SPF_HELO_NONE,SPF_SOFTFAIL,T_SCC_BODY_TEXT_LINE autolearn=no autolearn_force=no version=3.4.2 Received: from owl.net-art.cz (unknown [IPv6:2a03:6920:0:10::101]) (using TLSv1 with cipher ECDHE-RSA-AES256-SHA (256/256 bits)) (Client CN "owl.net-art.cz", Issuer "R3" (not verified)) by reindeer.net-art.cz (Postfix) with ESMTPS id 7A0E95EFB6 for ; Sat, 22 Jul 2023 18:49:00 +0100 (BST) Received: from [185.71.233.107] (account samm@net-art.cz HELO [192.168.101.108]) by owl.net-art.cz (CommuniGate Pro SMTP 6.1.20) with ESMTPSA id 1982043 for freebsd-arm@freebsd.org; Sat, 22 Jul 2023 19:49:01 +0200 Received-SPF: softfail receiver=owl.net-art.cz; client-ip=185.71.233.107; envelope-from=samm@freebsd.org Message-ID: <3867e009-5ecb-4ed1-737e-ac5112aa4b5d@freebsd.org> Date: Sat, 22 Jul 2023 19:48:59 +0200 List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:102.0) Gecko/20100101 Thunderbird/102.13.0 From: Alex Samorukov Subject: FreeBSD on azure/arm To: "freebsd-arm@freebsd.org" Content-Language: en-US Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-3.10 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; MIME_GOOD(-0.10)[text/plain]; MLMMJ_DEST(0.00)[freebsd-arm@freebsd.org]; TO_DN_EQ_ADDR_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; ASN(0.00)[asn:24806, ipnet:2001:15e8::/32, country:CZ]; R_DKIM_NA(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; FREEFALL_USER(0.00)[samm]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DMARC_NA(0.00)[freebsd.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-arm@freebsd.org]; R_SPF_SOFTFAIL(0.00)[~all]; TO_DOM_EQ_FROM_DOM(0.00)[] X-Rspamd-Queue-Id: 4R7Ynq1P7Jz3Dh0 X-Spamd-Bar: --- Hi, Recently i decided to play with FreeBSD/arm on azure and found that official images are done only for x86_64. Eventually i found in community image one for 14-CURRENT/arm64 which seems to work. Is anyone working to make this supported in official images? Any help needed? I think it would be nice to have. From nobody Sat Jul 22 17:50:34 2023 X-Original-To: freebsd-arm@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4R7Yqc0CC3z4pTws for ; Sat, 22 Jul 2023 17:50:36 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4R7YqZ5ZHDz3FHd for ; Sat, 22 Jul 2023 17:50:34 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1690048234; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=aTv3gwTATfdcooWQ9adcVoYXDtgkgynDNvOV8yMb/5g=; b=DFQrnGUh+2BVLjQWjUIw0n+Qv1y2JNXa89bdH1cVYoFC0qS++YOpO4fmcBzayUUnCDYi+7 aDeFtYxnFIcPPerS9JgDf7W4zmlenXe4NiwTj7f1xAa4ygfDRAAniA6AbS5UZGPDZZ8TpN V7kiOCWLbNdsUMC46uSve8bShHmDzuNKBUaaVoxSVtqiprcDw7rEgxe3TWPN7N2QuETd5f Vxxhr3lNOMA0GuWF4eDVOhwjl0oq8NRD0OqF5lsjBFUoIqjscB7zuADgFlsEqILQzWTbi7 zOnKtdU++dJ9DHu+VbDy8X6y/RoiAoGwNWubzO5V5WyZ7bLSxFEXneVSborb/Q== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1690048234; a=rsa-sha256; cv=none; b=JP8hip2DjDR9g1aAT33oU8D+Tgzfy0d0mkBnLgxG8ku7Bm+n8dit3o16O1pDPeS6xOfzyx KWaPzOFYlJlm4yEMBRDqYVnn/5v6qeux2WSzcyxJc9V7Tpd1by+EH3V6OwOTK0ek2dlRtx f7jyMxL6UGe1y5lEz0oM369xIfTuxvwwFwPs7NgyOBgTETnw5zL4qqQL5/8i1/bY9VdaQt imdbLNAO7tmwD5wDb7sWD89PvJwZeHO0nGH1y1u58If/pRAq6PieRgc0+UOcl2PWCWGafL fvps+pEMSVlESGKBoSdEpE2FqKgHS329STwpGH0xVc7/xjBUQmpP3XSof8O7eA== Received: from kenobi.freebsd.org (kenobi.freebsd.org [IPv6:2610:1c1:1:606c::50:1d]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4R7YqZ4Z5Sz146x for ; Sat, 22 Jul 2023 17:50:34 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) Received: from kenobi.freebsd.org ([127.0.1.5]) by kenobi.freebsd.org (8.15.2/8.15.2) with ESMTP id 36MHoYuE080288 for ; Sat, 22 Jul 2023 17:50:34 GMT (envelope-from bugzilla-noreply@freebsd.org) Received: (from www@localhost) by kenobi.freebsd.org (8.15.2/8.15.2/Submit) id 36MHoY4G080287 for freebsd-arm@FreeBSD.org; Sat, 22 Jul 2023 17:50:34 GMT (envelope-from bugzilla-noreply@freebsd.org) X-Authentication-Warning: kenobi.freebsd.org: www set sender to bugzilla-noreply@freebsd.org using -f From: bugzilla-noreply@freebsd.org To: freebsd-arm@FreeBSD.org Subject: [Bug 272666] FreeBSD arm64 Azure panic in add_route Date: Sat, 22 Jul 2023 17:50:34 +0000 X-Bugzilla-Reason: AssignedTo X-Bugzilla-Type: new X-Bugzilla-Watch-Reason: None X-Bugzilla-Product: Base System X-Bugzilla-Component: arm X-Bugzilla-Version: CURRENT X-Bugzilla-Keywords: X-Bugzilla-Severity: Affects Some People X-Bugzilla-Who: schakrabarti@microsoft.com X-Bugzilla-Status: New X-Bugzilla-Resolution: X-Bugzilla-Priority: --- X-Bugzilla-Assigned-To: freebsd-arm@FreeBSD.org X-Bugzilla-Flags: X-Bugzilla-Changed-Fields: bug_id short_desc product version rep_platform op_sys bug_status bug_severity priority component assigned_to reporter Message-ID: Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Bugzilla-URL: https://bugs.freebsd.org/bugzilla/ Auto-Submitted: auto-generated List-Id: Porting FreeBSD to ARM processors List-Archive: https://lists.freebsd.org/archives/freebsd-arm List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-arm@freebsd.org MIME-Version: 1.0 https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D272666 Bug ID: 272666 Summary: FreeBSD arm64 Azure panic in add_route Product: Base System Version: CURRENT Hardware: Any OS: Any Status: New Severity: Affects Some People Priority: --- Component: arm Assignee: freebsd-arm@FreeBSD.org Reporter: schakrabarti@microsoft.com In the recent FreeBSD arm64 community preview image in Azure, during reboot= , I am seeing this panic sometime: . ELF ldconfig path: /lib /usr/lib /usr/lib/compat /usr/local/lib /usr/local/lib/compat/pkg /usr/local/lib/compat/pkg lo0: link state changed to UP Kernel page fault with the following non-sleepable locks held: exclusive rm rib head lock (rib head lock) r =3D 0 (0xffffa000012278e0) loc= ked @ /usr/src/sys/net/route/route_ctl.c:797 stack backtrace: #0 0xffff0000004d2af4 at witness_debugger+0x5c #1 0xffff0000004d3cf8 at witness_warn+0x400 #2 0xffff0000007f7310 at data_abort+0xa0 #3 0xffff0000007d3014 at handle_el1h_sync+0x14 x0: 0x0000000000000001 x1: 0x0000000000000100 x2: 0xffffa00001ae7000 x3: 0xffff00004031af40 ($d.2 + 0x3efee96f) x4: 0x0000000000000100 x5: 0x0000000000000000 x6: 0x000000000000003f x7: 0x0000000000000000 x8: 0xffff000132c76c40 x9: 0x0000000000000000 x10: 0x0000000000000008 x11: 0x0000000000000000 x12: 0x000000000000003e x13: 0xffffa00001ae70fc x14: 0x0000000000000000 x15: 0x0000000000000001 x16: 0x0000000000010000 x17: 0x0000000000000005 x18: 0xffff00012d2f7e60 x19: 0xffff00012d2f8080 x20: 0xffffa00001227800 x21: 0x0000000000000000 x22: 0xdeadc0dedeadc0de x23: 0xffffa000012278e0 x24: 0xffffa00001227800 x25: 0xffffa0000c93ba00 x26: 0xffff000000960582 (digits + 0x12fbf) x27: 0xffffa0000c9338f0 x28: 0x0000000000000000 x29: 0xffff00012d2f7e60 sp: 0xffff00012d2f7e60 lr: 0xffff0000005bf63c (rib_notify + 0x50) elr: 0xffffa0000c93bb00 spsr: 0x0000000060400045 far: 0xffffa0000c93bb00 esr: 0x000000008600000e panic: data abort in critical section or under mutex cpuid =3D 3 time =3D 1690047394 KDB: stack backtrace: db_trace_self() at db_trace_self db_trace_self_wrapper() at db_trace_self_wrapper+0x30 vpanic() at vpanic+0x13c panic() at panic+0x44 data_abort() at data_abort+0x30c handle_el1h_sync() at handle_el1h_sync+0x14 --- exception, esr 0x8600000e (null)() at 0xffffa0000c93bb00 add_route() at add_route+0xc4 add_route_flags() at add_route_flags+0x1b0 rib_add_route() at rib_add_route+0x324 ifa_maintain_loopback_route() at ifa_maintain_loopback_route+0xf4 in6_update_ifa() at in6_update_ifa+0x994 in6_ifattach() at in6_ifattach+0x1bc in6_if_up() at in6_if_up+0x90 if_up() at if_up+0xd8 ifhwioctl() at ifhwioctl+0xb7c ifioctl() at ifioctl+0x860 kern_ioctl() at kern_ioctl+0x2dc sys_ioctl() at sys_ioctl+0x118 do_el0_sync() at do_el0_sync+0x520 handle_el0_sync() at handle_el0_sync+0x44 --- exception, esr 0x56000000 KDB: enter: panic [ thread pid 203 tid 100109 ] Stopped at kdb_enter+0x44: str xzr, [x19, #3328] db> bt Tracing pid 203 tid 100109 td 0xffff000132c76c40 db_trace_self() at db_trace_self db_stack_trace() at db_stack_trace+0x11c db_command() at db_command+0x2d8 db_command_loop() at db_command_loop+0x54 db_trap() at db_trap+0xf8 kdb_trap() at kdb_trap+0x20c handle_el1h_sync() at handle_el1h_sync+0x14 --- exception, esr 0xf2000000 kdb_enter() at kdb_enter+0x44 vpanic() at vpanic+0x178 panic() at panic+0x44 data_abort() at data_abort+0x30c handle_el1h_sync() at handle_el1h_sync+0x14 --- exception, esr 0x8600000e (null)() at 0xffffa0000c93bb00 add_route() at add_route+0xc4 add_route_flags() at add_route_flags+0x1b0 rib_add_route() at rib_add_route+0x324 ifa_maintain_loopback_route() at ifa_maintain_loopback_route+0xf4 in6_update_ifa() at in6_update_ifa+0x994 in6_ifattach() at in6_ifattach+0x1bc in6_if_up() at in6_if_up+0x90 if_up() at if_up+0xd8 ifhwioctl() at ifhwioctl+0xb7c ifioctl() at ifioctl+0x860 kern_ioctl() at kern_ioctl+0x2dc sys_ioctl() at sys_ioctl+0x118 do_el0_sync() at do_el0_sync+0x520 handle_el0_sync() at handle_el0_sync+0x44 --- exception, esr 0x56000000 db>=20 The uname details: 14.0-CURRENT FreeBSD 14.0-CURRENT #1 main-n263931-5aee3e14d491-dirty: Mon J= ul=20 3 14:15:14 UTC 2023=20=20=20=20 root@poudriere:/usr/obj/usr/src/arm64.aarch64/sys/GENERIC arm64 And ifconfig details : schakrabarti@schakrabarti-freebsd-arm:~ $ ifconfig -a lo0: flags=3D1008049 metric 0 mtu 1= 6384 options=3D680003 inet 127.0.0.1 netmask 0xff000000 inet6 ::1 prefixlen 128 inet6 fe80::1%lo0 prefixlen 64 scopeid 0x1 groups: lo nd6 options=3D21 hn0: flags=3D1008843 metri= c 0 mtu 1500 options=3D0 ether 00:0d:3a:1b:a5:92 inet 10.0.0.4 netmask 0xffffff00 broadcast 10.0.0.255 media: Ethernet 100GBase-CR4 status: active nd6 options=3D29 mce0: flags=3D1008a43 metric 0 mtu 1500 =20=20=20=20=20=20=20 options=3D18a00a8 ether 00:0d:3a:1b:a5:92 media: Ethernet 100GBase-CR4 status: active nd6 options=3D29 --=20 You are receiving this mail because: You are the assignee for the bug.=