From nobody Sun Dec 10 13:56:25 2023 X-Original-To: stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Sp5yP717xz53rtL for ; Sun, 10 Dec 2023 13:56:29 +0000 (UTC) (envelope-from void@f-m.fm) Received: from wout5-smtp.messagingengine.com (wout5-smtp.messagingengine.com [64.147.123.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Sp5yP3tdLz4dHP for ; Sun, 10 Dec 2023 13:56:29 +0000 (UTC) (envelope-from void@f-m.fm) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=f-m.fm header.s=fm1 header.b=mKMugdFY; dkim=pass header.d=messagingengine.com header.s=fm1 header.b=bMFBNklz; spf=pass (mx1.freebsd.org: domain of void@f-m.fm designates 64.147.123.21 as permitted sender) smtp.mailfrom=void@f-m.fm; dmarc=pass (policy=none) header.from=f-m.fm Received: from compute7.internal (compute7.nyi.internal [10.202.2.48]) by mailout.west.internal (Postfix) with ESMTP id 727E13200A00 for ; Sun, 10 Dec 2023 08:56:28 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute7.internal (MEProxy); Sun, 10 Dec 2023 08:56:28 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=f-m.fm; h=cc :content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:sender :subject:subject:to:to; s=fm1; t=1702216587; x=1702302987; bh=KC RYloXFqbuTkgxLQhzcIT9FLxy4sXHskRq21ppcNx0=; b=mKMugdFY2SMzHdxNbn 5CWmiQRfBH2YAPJTS17WK9zi4jI6M77hKiWeGObI72HeYb3W/mIPaPmIZDEPWezb QsLUzMI71EckYSUDdPpvez3yJ7zoXK8BG7Ng3dh5X3XxckMpxlnZO5LcTEEjKL+B CMUf1vZ7Ohmuj7PPcNPN51RNISZPZ8AaIfYVLgMbqXeIcdCLZpq/tCuPCKYRfAIE nYNjZTVH7vALxMUkOC8X8i5HTxWhj7zEO+fwXW6LYsZSvlHd4f21nPxeVm2a6/9h 6ErPqI6d9YjidC7Ekt4eS2T7DaW7soXBzaA2n4IUfw6/gMxwuth8sdMdJ8lfzm5x FTAQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:sender:subject :subject:to:to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender :x-sasl-enc; s=fm1; t=1702216587; x=1702302987; bh=KCRYloXFqbuTk gxLQhzcIT9FLxy4sXHskRq21ppcNx0=; b=bMFBNklzM4N0eIJ702Le+phve7U8W h78Lr1UPDlNsSMCjjRLmd/Q6abUFWAlMua1tx8n22EWygZXobqD0zmgWBkd3cwKI wwj9HaIn+CaDJY7ToCMED7Xmi56hzFGm2EEnbUYSGLMPTmu4J4I3ISp8wYpr+s0a 5xPrin0pBaylLMEANPHJx5CKbvr2raihZDeKZqpQOCXSDK5N5urjPYE+6aeld67f CweKkXnx0fiY/tgWIKDxpy5n7aTw5KLLxCrC6XPclYcY6PTkdy1Qa/26XeSW+F7t WzAJ4ImArvmBTbRB4bUwKTwurEbJ0jXL0TUfJLNRVFonqS6orTRIZrYuw== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvkedrudeltddgheelucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpeffhffvuffkfhggtggujgesthdtre dttddtvdenucfhrhhomhepvhhoihguuceovhhoihgusehfqdhmrdhfmheqnecuggftrfgr thhtvghrnhepkeeluddvlefhieelfefggffhffektdehleelgfdugfdvgeekjeejuddthe ehgfeunecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhep vhhoihgusehfqdhmrdhfmh X-ME-Proxy: Feedback-ID: i2541463c:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA for ; Sun, 10 Dec 2023 08:56:27 -0500 (EST) Date: Sun, 10 Dec 2023 13:56:25 +0000 From: void To: stable@freebsd.org Subject: Re: some dirs don't get deleted with make-delete-old Message-ID: References: <87cyvgbqna.wl-herbert@gojira.at> List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline In-Reply-To: <87cyvgbqna.wl-herbert@gojira.at> X-Spamd-Result: default: False [-4.00 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; MID_RHS_NOT_FQDN(0.50)[]; DMARC_POLICY_ALLOW(-0.50)[f-m.fm,none]; RWL_MAILSPIKE_EXCELLENT(-0.40)[64.147.123.21:from]; R_DKIM_ALLOW(-0.20)[f-m.fm:s=fm1,messagingengine.com:s=fm1]; R_SPF_ALLOW(-0.20)[+ip4:64.147.123.21:c]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[64.147.123.21:from]; RCVD_TLS_LAST(0.00)[]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[stable@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; ARC_NA(0.00)[]; ASN(0.00)[asn:29838, ipnet:64.147.123.0/24, country:US]; MLMMJ_DEST(0.00)[stable@freebsd.org]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_NONE(0.00)[]; FREEMAIL_FROM(0.00)[f-m.fm]; DWL_DNSWL_NONE(0.00)[messagingengine.com:dkim]; DKIM_TRACE(0.00)[f-m.fm:+,messagingengine.com:+]; MIME_TRACE(0.00)[0:+]; FROM_EQ_ENVFROM(0.00)[]; FREEMAIL_ENVFROM(0.00)[f-m.fm]; RCVD_VIA_SMTP_AUTH(0.00)[] X-Rspamd-Queue-Id: 4Sp5yP3tdLz4dHP X-Spamd-Bar: --- On Fri, Dec 08, 2023 at 05:33:29PM +0100, Herbert J. Skuhra wrote: >Do you use WITHOUT_DEBUG_FILES= in /etc/src.conf? Bingo! % ug DEBUG /etc/src.conf 9: WITHOUT_ASSERT_DEBUG= 17: WITHOUT_DEBUG_FILES= so it's unable to be deleted because it's not there ;) (I guess? though i'd have expected a not-found or similar) >I think the problem is: > >1. etc/mtree/BSD.debug.dist >The Makefile contains the following note: "# NOTE: BSD.debug.dist is >unconditionally installed for developer ease-of-use." > >2. make delete-old does not empty and delete >/usr/lib/debug/boot/kernel and /usr/lib/debug/boot/modules. Both >directories are excluded in tools/build/mk/OptionalObsoleteFiles.inc >(lines 1336-1350). This code was commited in August 2017 by emaste >(commit 63cd05d97a6d280e280538229040537d5ac75788). I guess from this it's just noise and can be safely ignored? The system runs fine as expected; no otherwise surprises (yet). -- From nobody Mon Dec 11 00:58:18 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4SpNf955Frz53bGw for ; Mon, 11 Dec 2023 00:58:25 +0000 (UTC) (envelope-from wfc@mintsol.com) Received: from scully.mintsol.com (scully.mintsol.com [199.182.77.206]) by mx1.freebsd.org (Postfix) with ESMTP id 4SpNf871T1z4f0f for ; Mon, 11 Dec 2023 00:58:24 +0000 (UTC) (envelope-from wfc@mintsol.com) Authentication-Results: mx1.freebsd.org; dkim=none; spf=pass (mx1.freebsd.org: domain of wfc@mintsol.com designates 199.182.77.206 as permitted sender) smtp.mailfrom=wfc@mintsol.com; dmarc=none Received: from mintsol.com (officecc.mintsol.com [96.85.114.33]) by scully.mintsol.com with esmtp; Sun, 10 Dec 2023 19:58:18 -0500 id 00222417.0000000065765EAA.00011DA3 Received: from localhost (localhost [127.0.0.1]) (IDENT: uid 1002) by mintsol.com with esmtp; Sun, 10 Dec 2023 19:58:18 -0500 id 00008187.65765EAA.0000F967 Date: Sun, 10 Dec 2023 19:58:18 -0500 (EST) From: Walter Cramer To: freebsd-stable@freebsd.org Subject: Anomoly from `freebsd-update IDS` in 12.4-RELEASE-p9 - dual entries for /etc/ssh/sshd_config In-Reply-To: Message-ID: <20231210193001.S62060@mulder.mintsol.com> References: <20231201031737.DF0231B942@freefall.freebsd.org> List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [1.38 / 15.00]; NEURAL_SPAM_LONG(1.00)[1.000]; NEURAL_SPAM_MEDIUM(0.89)[0.888]; NEURAL_HAM_SHORT(-0.81)[-0.808]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+a:scully.mintsol.com]; RCVD_NO_TLS_LAST(0.10)[]; MIME_GOOD(-0.10)[text/plain]; MLMMJ_DEST(0.00)[freebsd-stable@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; R_DKIM_NA(0.00)[]; ARC_NA(0.00)[]; MID_RHS_MATCH_FROMTLD(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:22768, ipnet:199.182.77.0/24, country:US]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DMARC_NA(0.00)[mintsol.com]; TO_DN_NONE(0.00)[]; RCVD_COUNT_TWO(0.00)[2] X-Rspamd-Queue-Id: 4SpNf871T1z4f0f X-Spamd-Bar: + When running `freebsd-update IDS` on a few 12.4-RELEASE-p9 systems which have local changes in /etc/ssh/sshd_config, I get TWO separate lines of output about /etc/ssh/sshd_config: ... /etc/ssh/sshd_config has SHA256 hash XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX, but should have SHA256 hash 2e201f8c0ca677cc6b6dce2608579ed7d05262dec52b534037bf67fe0601fe68. /etc/ssh/sshd_config has SHA256 hash XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX, but should have SHA256 hash eac5adbd9571a12135c3af1c536ace0e8fd58164eec273efa9df37ab7eb941ec. ... (The two X'ed hashes are the same, and match the sha256 hash of the system's customized /etc/ssh/sshd_config.) Poking around a bit in /usr/src, and my weekly snapshots of that, I found both versions of sshd_config - SHA256 (/usr/src/crypto/openssh/sshd_config) = 2e201f8c0ca677cc6b6dce2608579ed7d05262dec52b534037bf67fe0601fe68 SHA256 (/usr/.zfs/snapshot/year_week.23w31/src/crypto/openssh/sshd_config) = eac5adbd9571a12135c3af1c536ace0e8fd58164eec273efa9df37ab7eb941ec SHA256 (/usr/.zfs/snapshot/year_week.23w32/src/crypto/openssh/sshd_config) = 2e201f8c0ca677cc6b6dce2608579ed7d05262dec52b534037bf67fe0601fe68 `diff` on those two versions of sshd_config yields: 109c109 < #VersionAddendum FreeBSD-20221019 --- > #VersionAddendum FreeBSD-20230719 So both versions of sshd_config start with these same lines, which may be the root problem: # $OpenBSD: sshd_config,v 1.104 2021/07/02 05:11:21 dtucker Exp $ # $FreeBSD: releng/12.4/crypto/openssh/sshd_config 372681 2022-10-31 17:19:41Z git2svn From nobody Wed Dec 13 04:03:02 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4SqhfY5mn1z53pYZ for ; Wed, 13 Dec 2023 04:03:17 +0000 (UTC) (envelope-from mike@jellydonut.org) Received: from mail-ed1-x534.google.com (mail-ed1-x534.google.com [IPv6:2a00:1450:4864:20::534]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4SqhfX68cZz4rLV for ; Wed, 13 Dec 2023 04:03:16 +0000 (UTC) (envelope-from mike@jellydonut.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=jellydonut.org header.s=google header.b=jIMtKdnD; spf=pass (mx1.freebsd.org: domain of mike@jellydonut.org designates 2a00:1450:4864:20::534 as permitted sender) smtp.mailfrom=mike@jellydonut.org; dmarc=none Received: by mail-ed1-x534.google.com with SMTP id 4fb4d7f45d1cf-551d5cd1c5fso1663883a12.0 for ; Tue, 12 Dec 2023 20:03:16 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=jellydonut.org; s=google; t=1702440193; x=1703044993; darn=freebsd.org; h=to:subject:message-id:date:from:mime-version:from:to:cc:subject :date:message-id:reply-to; bh=D7vrSf0E/zIRHaCX3vV63YjvhSZZEHMOSmF9qhtKiWo=; b=jIMtKdnD6jrjc0l0uAsC43+j3NTHAaA0qdIT9OS1rK1kPk2196cwAMQd8uVWT2HBLx 44aleDKAcyOSppDbz02kmkoGwpSrSrE8I9vyigiG0ZlM8kgX82WbuJetNM0tbF1DoDat RgR4Fz3jnd4YtRQ9mjpyikkPVUQ18ZQGml07s= X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1702440193; x=1703044993; h=to:subject:message-id:date:from:mime-version:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=D7vrSf0E/zIRHaCX3vV63YjvhSZZEHMOSmF9qhtKiWo=; b=tIqGocSHFTvgo3EviN9X0kTgiNm7qU+GRY5d8DGy05mV5huMq0cljA/eVOoLqKmy2i keRcNWxYtAdJZiKoALYSJGe0qGK5XJrDpLZIpjMqFF54NcoKxHvTBGvNO3WB7lOJriAW HeZdxGXsgbXlrC11PsuTZ+9T/EFeSvxDLH1TbIqscT6/12FDRitySWU7SlauwtLxiTmC 7/ngRuHVoviiD1R7bP1cS/3Nmx1pJQ5Fh3Vq5I2Y1wz1xEpahB0rc9UNE+SuHQJV6YAU ZLUaW0n8MzITqQx8WLxjkjJE5VRYDb8QWAzRCmH5pPIdtfvmiJAvuX8As9ZsN/H0hfj/ uxCQ== X-Gm-Message-State: AOJu0Yx+yXjQmlFvcmI8W04q2GF80v3oBHFEh6CLfFz79d5VK0KpQwHx 1IMJCa7eA9wL5mbFvqdOIOEmcIV2qiS6hcf8+EFF/tUH6A80OjlGueU= X-Google-Smtp-Source: AGHT+IEATlt8htTejZ8h0PPVOKuA54QgRyfdoICRhT6CRZAycZPXKL3gwoXp8GrPBl5rdb5uE8AAc4T7ufwQL6Y6nBo= X-Received: by 2002:a05:6402:430e:b0:551:9997:fae6 with SMTP id m14-20020a056402430e00b005519997fae6mr1725460edc.21.1702440193386; Tue, 12 Dec 2023 20:03:13 -0800 (PST) List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 From: Michael Proto Date: Tue, 12 Dec 2023 23:03:02 -0500 Message-ID: Subject: ntpd: leap-seconds.list expiration To: FreeBSD-STABLE Mailing List Content-Type: multipart/alternative; boundary="000000000000fa7ad7060c5c3ef5" X-Spamd-Result: default: False [-3.50 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; R_DKIM_ALLOW(-0.20)[jellydonut.org:s=google]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; MLMMJ_DEST(0.00)[freebsd-stable@freebsd.org]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::534:from]; ARC_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+,1:+,2:~]; DKIM_TRACE(0.00)[jellydonut.org:+]; RCPT_COUNT_ONE(0.00)[1]; RCVD_TLS_LAST(0.00)[]; FROM_HAS_DN(0.00)[]; FREEFALL_USER(0.00)[mike]; TO_DN_ALL(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DMARC_NA(0.00)[jellydonut.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-stable@freebsd.org]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Rspamd-Queue-Id: 4SqhfX68cZz4rLV X-Spamd-Bar: --- --000000000000fa7ad7060c5c3ef5 Content-Type: text/plain; charset="UTF-8" Noticed recently (in both my upgraded and newly-installed hosts) that the leap-seconds.list file is in danger of expiration very soon (12/28). It appears the default download location in /etc/defaults/rc.conf ( https://www.ietf.org/timezones/data/leap-seconds.list) no longer carries this file, or at least it says plainly so when I try to fetch it. I've been able to work around it locally by setting ntp_leapfile_sources=" https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list" in /etc/rc.conf from IERS, though in searching where to fetch this there are questions of copyright in regards to distribution so while this should work for end-users I don't know how applicable this would be upstream (submitted https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275737). I figured I'd throw it out here for visibility to operators as my workaround should work in that case. -Michael Proto --000000000000fa7ad7060c5c3ef5 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Noticed recently (in both my upgraded and newly-installed = hosts) that the leap-seconds.list file is in danger of expiration very soon= (12/28). It appears the default download location in /etc/defaults/rc.conf= (https:/= /www.ietf.org/timezones/data/leap-seconds.list) no longer carries this = file, or at least it says plainly so when I try to fetch it.

=
I've been able to work around it locally by setting=C2=A0ntp_leapf= ile_sources=3D"https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.lis= t" in /etc/rc.conf from IERS, though=C2=A0in searching where to fe= tch this there are questions of copyright in regards to distribution so whi= le this should work for end-users I don't know how applicable this woul= d be upstream (submitted https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D27= 5737). I figured I'd throw it out here for visibility to operators = as my workaround should work in that case.


-Michael Proto
--000000000000fa7ad7060c5c3ef5-- From nobody Wed Dec 13 22:46:30 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Sr9Zq4Gqhz54Qnc for ; Wed, 13 Dec 2023 22:46:43 +0000 (UTC) (envelope-from SRS0=tILD=HY=quip.cz=000.fbsd@elsa.codelab.cz) Received: from elsa.codelab.cz (elsa.codelab.cz [94.124.105.4]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Sr9Zq1zVQz3WTH for ; Wed, 13 Dec 2023 22:46:43 +0000 (UTC) (envelope-from SRS0=tILD=HY=quip.cz=000.fbsd@elsa.codelab.cz) Authentication-Results: mx1.freebsd.org; none Received: from elsa.codelab.cz (localhost [127.0.0.1]) by elsa.codelab.cz (Postfix) with ESMTP id 23D3FD788F; Wed, 13 Dec 2023 23:46:34 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1702507594; bh=oJ80+N0KBWLEWVCVG1UN9XBjn0JNq8RhZTRXxP3eOvU=; h=Date:Subject:To:References:From:In-Reply-To; b=HAnHoEChmUvNrAlAT7VMLo1ONgF8nSzw2PmErFrA5jd9kB+u6/d/M6rLl9+2XbEwC yOq3RIl/alQm1yZtCwn5Jrrzh7CX8orVxicoEl2TZARSX80X/RiJu3RKLc6x4wxqXi nVVmSd2WcBj9SBGaLPAybFFBgnSlL5lpa5LPaTnE= Received: from [192.168.145.49] (ip-89-177-27-225.bb.vodafone.cz [89.177.27.225]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by elsa.codelab.cz (Postfix) with ESMTPSA id 5F8CCD788E; Wed, 13 Dec 2023 23:46:30 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1702507591; bh=oJ80+N0KBWLEWVCVG1UN9XBjn0JNq8RhZTRXxP3eOvU=; h=Date:Subject:To:References:From:In-Reply-To; b=CWfMvhm3N2GBy6y8wysg8SaGHMHuuOX4b0pQnd3KsJPUvVAvF0CmL+idfjHikplFC GNgi/uf/5EzKeZGcxOyPoUfvu8hqoPi3vmGOx6Bhkt47old7jtt0kyGJzP7AJiJnjL KxA3CmemhEJ1U/KGzlI9RBH9+TJiDneYXyskgllI= Message-ID: <51e78f56-b5f1-4910-b217-fdeef0d95bd7@quip.cz> Date: Wed, 13 Dec 2023 23:46:30 +0100 List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: ntpd: leap-seconds.list expiration To: Michael Proto , FreeBSD-STABLE Mailing List References: Content-Language: cs-Cestina, en-US From: Miroslav Lachman <000.fbsd@quip.cz> In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:42000, ipnet:94.124.104.0/21, country:CZ] X-Spamd-Bar: ---- X-Rspamd-Queue-Id: 4Sr9Zq1zVQz3WTH On 13/12/2023 05:03, Michael Proto wrote: > Noticed recently (in both my upgraded and newly-installed hosts) that > the leap-seconds.list file is in danger of expiration very soon (12/28). > It appears the default download location in /etc/defaults/rc.conf > (https://www.ietf.org/timezones/data/leap-seconds.list > ) no longer > carries this file, or at least it says plainly so when I try to fetch it. > > I've been able to work around it locally by > setting ntp_leapfile_sources="https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list " in /etc/rc.conf from IERS, though in searching where to fetch this there are questions of copyright in regards to distribution so while this should work for end-users I don't know how applicable this would be upstream (submitted https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275737 ). I figured I'd throw it out here for visibility to operators as my workaround should work in that case. Thank you for this link! I tried to find actual file yesterday. Now I fixed it in ntp_leapfile_sources on all my machines. Best regards Miroslav Lachman From nobody Wed Dec 13 22:56:11 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Sr9p15T1Rz54S8K for ; Wed, 13 Dec 2023 22:56:25 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-lj1-x22a.google.com (mail-lj1-x22a.google.com [IPv6:2a00:1450:4864:20::22a]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Sr9p151Gxz3YQV for ; Wed, 13 Dec 2023 22:56:25 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-lj1-x22a.google.com with SMTP id 38308e7fff4ca-2c9f8faf57bso96125731fa.3 for ; Wed, 13 Dec 2023 14:56:25 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20230601.gappssmtp.com; s=20230601; t=1702508183; x=1703112983; darn=freebsd.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=ap81MLYlaSvs4YwcR2P1n9fjxhf5mzIHXXyCGOWg9u4=; b=xhX7oD2YlxxsGqDQxvfsK7CFywb4e+rj69tDemXGUL+CgpbkEvU3L6R4dTTQUJ2dQl IGHat7SFXX/HniDToF7vBng8fpdT2DaDoTjMy1FDJwmzw6pDFftd8zeh3FVYB7X+NykT 6zGryaljvLeDC2zOHr2YKfkYVx3r3sKUIL49Uz3VMZmhobkLYEDUPd0sxXDBZvuz7Tgl jCjbie+VHMsrro6XOPg2atwnmGqT6Ifzx0FOZY4luSBQhxXde8GXSpxx890HS/hCNwqs 29oUR0jPchTodqkhmEaMWPPPV1GhbvNLW7UU82sc8AsM0786HC502D9ghh6EYi1rcMQg vu8Q== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1702508183; x=1703112983; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=ap81MLYlaSvs4YwcR2P1n9fjxhf5mzIHXXyCGOWg9u4=; b=oSsL2qvPLohCm6sZee5Z7rd5g2BJBM7a5tGJrc6gX5iVNJUK4k3fY3RYbjlGNgFSYG rSKAPypxaGsJcOyUWIGDKle9vM11p7lZvWcJD2U+17NOTYZpX+igt5I7wiKje6O0m94q QgDbcV6Eg2xFtBCAwqA9RY3swgZlU72Vbt+uq/30Nq6OUic4TSfyFO0xD4GQ1RSsEnWY NbqMZs7OlcaoVMeL7dYK61DHuAOyNmc9fgTuV3kW7qM+PrLIM4wJvtJvxmMiA1ybfyL5 LusPfYJOXsCQG4kRAXdM14nNQFS9pRQY+duIS+BXMByZ1s1EKmtKGIKliBKShCvYHGh/ Ubjw== X-Gm-Message-State: AOJu0YxNGV7FUgyVd+QC7xBSlaTnCdktYfUNmN0w1+Px+t1AO85BAxwZ EJHwcMsdJKQYf1W6e6eDduj/0yRs8W8FnIFYlkJVuHyl7Mp8oRcade0= X-Google-Smtp-Source: AGHT+IGLvPvZ4VXwz/9qvQt6FflPy/4mRM0LtjnnMBZ/KRp7FeCUg6kT4tR2T7FtTAdsfaYAz4zqwlJc/c2P5h2eGlU= X-Received: by 2002:a05:651c:2111:b0:2cc:1fae:e3e1 with SMTP id a17-20020a05651c211100b002cc1faee3e1mr3725426ljq.24.1702508183255; Wed, 13 Dec 2023 14:56:23 -0800 (PST) List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 References: <51e78f56-b5f1-4910-b217-fdeef0d95bd7@quip.cz> In-Reply-To: <51e78f56-b5f1-4910-b217-fdeef0d95bd7@quip.cz> From: Warner Losh Date: Wed, 13 Dec 2023 15:56:11 -0700 Message-ID: Subject: Re: ntpd: leap-seconds.list expiration To: Miroslav Lachman <000.fbsd@quip.cz> Cc: Michael Proto , FreeBSD-STABLE Mailing List Content-Type: multipart/alternative; boundary="0000000000007d9663060c6c1346" X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Spamd-Bar: ---- X-Rspamd-Queue-Id: 4Sr9p151Gxz3YQV --0000000000007d9663060c6c1346 Content-Type: text/plain; charset="UTF-8" On Wed, Dec 13, 2023, 3:47 PM Miroslav Lachman <000.fbsd@quip.cz> wrote: > On 13/12/2023 05:03, Michael Proto wrote: > > Noticed recently (in both my upgraded and newly-installed hosts) that > > the leap-seconds.list file is in danger of expiration very soon (12/28). > > It appears the default download location in /etc/defaults/rc.conf > > (https://www.ietf.org/timezones/data/leap-seconds.list > > ) no longer > > carries this file, or at least it says plainly so when I try to fetch it. > > > > I've been able to work around it locally by > > setting ntp_leapfile_sources=" > https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list < > https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list>" in > /etc/rc.conf from IERS, though in searching where to fetch this there are > questions of copyright in regards to distribution so while this should work > for end-users I don't know how applicable this would be upstream (submitted > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275737 < > https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275737>). I figured I'd > throw it out here for visibility to operators as my workaround should work > in that case. > It's not at all clear there are issues with redistribution. Any files that require a license or purchase are locked down at the web server level. The issues sound more on the FUD end of the scale. BIPM has never tried to enforce any ip claims to this file. They have, many years ago, displayed an ignorance of what people want in terms of a clear grant... the bipm, or it's subsidiaries, has published all kinds of other data that's clearly more valuable. Leap seconds are a fact that has low to no creative content. It's not even clear you could copyright it... the comments maybe... but I'm not seeing any kind of real risk here. Warner Thank you for this link! I tried to find actual file yesterday. Now I > fixed it in ntp_leapfile_sources on all my machines. > > Best regards > Miroslav Lachman > > --0000000000007d9663060c6c1346 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable


On Wed, Dec 13, 2023, 3:47 PM Miroslav Lachman <000.fbsd@quip.cz> wrote:
<= blockquote class=3D"gmail_quote" style=3D"margin:0 0 0 .8ex;border-left:1px= #ccc solid;padding-left:1ex">On 13/12/2023 05:03, Michael Proto wrote:
> Noticed recently (in both my upgraded and newly-installed hosts) that =
> the leap-seconds.list file is in danger of expiration very soon (12/28= ).
> It appears the default download location in /etc/defaults/rc.conf
> (https://www.ietf.org/timezones= /data/leap-seconds.list
> <https://www.ietf.org/timezo= nes/data/leap-seconds.list>) no longer
> carries this file, or at least it says plainly so when I try to fetch = it.
>
> I've been able to work around it locally by
> setting=C2=A0ntp_leapfile_sources=3D"https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.lis= t <https://hpiers.obspm= .fr/iers/bul/bulc/ntp/leap-seconds.list>" in /etc/rc.conf from = IERS, though=C2=A0in searching where to fetch this there are questions of c= opyright in regards to distribution so while this should work for end-users= I don't know how applicable this would be upstream (submitted https://bugs.freebsd.org/bugzilla/show= _bug.cgi?id=3D275737 <ht= tps://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D275737>). I figure= d I'd throw it out here for visibility to operators as my workaround sh= ould work in that case.

<= /div>
It's not at all clear there are issues with redi= stribution. Any files that require a license or purchase are locked down at= the web server level. The issues sound more on the FUD end of the scale. B= IPM has never tried to enforce any ip claims to this file. They have, many = years ago, displayed an ignorance of what people want in terms of a clear g= rant... the bipm, or it's subsidiaries, has published all kinds of othe= r data that's clearly more valuable. Leap seconds are a fact that has l= ow to no creative content. It's not even clear you could copyright it..= . the comments maybe... but I'm not seeing any kind of real risk here.<= /div>

Warner


Thank you for this link! I tried to find actual file yesterday. Now I
fixed it in ntp_leapfile_sources on all my machines.

Best regards
Miroslav Lachman

--0000000000007d9663060c6c1346-- From nobody Thu Dec 14 01:43:13 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4SrFVp5WWFz52dvr for ; Thu, 14 Dec 2023 01:43:30 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Received: from mail-ed1-x531.google.com (mail-ed1-x531.google.com [IPv6:2a00:1450:4864:20::531]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4SrFVn66Gnz4PTX for ; Thu, 14 Dec 2023 01:43:29 +0000 (UTC) (envelope-from wlosh@bsdimp.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=bsdimp-com.20230601.gappssmtp.com header.s=20230601 header.b=V0jSC5wb; spf=none (mx1.freebsd.org: domain of wlosh@bsdimp.com has no SPF policy when checking 2a00:1450:4864:20::531) smtp.mailfrom=wlosh@bsdimp.com; dmarc=none Received: by mail-ed1-x531.google.com with SMTP id 4fb4d7f45d1cf-551ee7d5214so271021a12.0 for ; Wed, 13 Dec 2023 17:43:29 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bsdimp-com.20230601.gappssmtp.com; s=20230601; t=1702518206; x=1703123006; darn=freebsd.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=lhOlhWnFtOqF++5UJQ3yxHYCK/5J4mNhqAOozhoXRe0=; b=V0jSC5wbLN+jCgQCh0eL23ntlgkmOMAyoPBm+GXtiwIEVMInfUVbx5cMWIDQWLLxBM 0EJIzTZNjDTrHNe060D//S3hyNHlnrgkRXoctdr3n5K8xxR7rEqJtmor2E6UdWEdsCFK qwsVYzE+V5e8ZzZEM0vBkC3ZoYYu6QT1gA/sQUmhJrNKKNXacPBcQXSgjGm6hUAFUM/E lkmbOV976+peDwvHj/7rCvJ5esZysNqJ6eb3i65tbQpNwM4EDI9TBRVDDgguzrw4X5Sw g2Yx24m7FVwcTgc6DiFWe+zLGwk74nVSt6fqKGPXw0zp5pHfBQu/Ox/7OmqMwYbhRCYE z9Fw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1702518206; x=1703123006; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=lhOlhWnFtOqF++5UJQ3yxHYCK/5J4mNhqAOozhoXRe0=; b=bjE5/ojBIKMP62FJ56lpoHtW6dptpycPHgFrGMOxILptQcNEMSNbR65U53ECypKyIU 42uWy6L4CRTH8/9ZuIy2VZ68crawT3Dw/RfHJ82/mI8abdDRRf8/sfK2W4HqYvjUQnKn PcWE33/RMcnpIp23DL7saXFngQH6IdnIAVoeV4GP08qk+4fJaEPWWnxXikUZ/WI+HeVq q5W0ey/k+TCpbOK3x37ZYUq7ufR8pV+/cDOcLiOLOL+eQ/xn8ZTI0btcOeIzhCS/eKR+ YNf551sKy0RIxqtZoYZgT9j38lVR6ERXQwmjClLXBbiHkLUUn3ec1/XL4ijiHV3ttUyG FfaA== X-Gm-Message-State: AOJu0YxW67BuxCe+MGcviNOitvOfd9jSfYESyze3mVZOKxvZwfKbaNR5 rhv5+GUFsbfhBPFLpIsrSNc45Ek9DWg92DYFAQ9oPQ== X-Google-Smtp-Source: AGHT+IHwHHmW6UastzP5bAQeGCy1072vryCDq43/GlT6kg3mbsUCMN7S5VjiuAEkb2Mra5zyOMSK4o4L8oe203lyD9c= X-Received: by 2002:a50:c942:0:b0:552:3598:367d with SMTP id p2-20020a50c942000000b005523598367dmr1257038edh.26.1702518205303; Wed, 13 Dec 2023 17:43:25 -0800 (PST) List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 References: <51e78f56-b5f1-4910-b217-fdeef0d95bd7@quip.cz> In-Reply-To: From: Warner Losh Date: Wed, 13 Dec 2023 18:43:13 -0700 Message-ID: Subject: Re: ntpd: leap-seconds.list expiration To: Miroslav Lachman <000.fbsd@quip.cz> Cc: Michael Proto , FreeBSD-STABLE Mailing List Content-Type: multipart/alternative; boundary="000000000000d9dd0b060c6e68f2" X-Spamd-Result: default: False [-2.95 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.95)[-0.949]; FORGED_SENDER(0.30)[imp@bsdimp.com,wlosh@bsdimp.com]; R_DKIM_ALLOW(-0.20)[bsdimp-com.20230601.gappssmtp.com:s=20230601]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::531:from]; MLMMJ_DEST(0.00)[freebsd-stable@freebsd.org]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_COUNT_ONE(0.00)[1]; R_SPF_NA(0.00)[no SPF record]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; TO_DN_ALL(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCPT_COUNT_THREE(0.00)[3]; FROM_HAS_DN(0.00)[]; DKIM_TRACE(0.00)[bsdimp-com.20230601.gappssmtp.com:+]; PREVIOUSLY_DELIVERED(0.00)[freebsd-stable@freebsd.org]; TO_MATCH_ENVRCPT_SOME(0.00)[]; DMARC_NA(0.00)[bsdimp.com]; FROM_NEQ_ENVFROM(0.00)[imp@bsdimp.com,wlosh@bsdimp.com] X-Rspamd-Queue-Id: 4SrFVn66Gnz4PTX X-Spamd-Bar: -- --000000000000d9dd0b060c6e68f2 Content-Type: text/plain; charset="UTF-8" On Wed, Dec 13, 2023, 3:56 PM Warner Losh wrote: > > > On Wed, Dec 13, 2023, 3:47 PM Miroslav Lachman <000.fbsd@quip.cz> wrote: > >> On 13/12/2023 05:03, Michael Proto wrote: >> > Noticed recently (in both my upgraded and newly-installed hosts) that >> > the leap-seconds.list file is in danger of expiration very soon >> (12/28). >> > It appears the default download location in /etc/defaults/rc.conf >> > (https://www.ietf.org/timezones/data/leap-seconds.list >> > ) no longer >> > carries this file, or at least it says plainly so when I try to fetch >> it. >> > >> > I've been able to work around it locally by >> > setting ntp_leapfile_sources=" >> https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list < >> https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list>" in >> /etc/rc.conf from IERS, though in searching where to fetch this there are >> questions of copyright in regards to distribution so while this should work >> for end-users I don't know how applicable this would be upstream (submitted >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275737 < >> https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275737>). I figured >> I'd throw it out here for visibility to operators as my workaround should >> work in that case. >> > > It's not at all clear there are issues with redistribution. Any files that > require a license or purchase are locked down at the web server level. The > issues sound more on the FUD end of the scale. BIPM has never tried to > enforce any ip claims to this file. They have, many years ago, displayed an > ignorance of what people want in terms of a clear grant... the bipm, or > it's subsidiaries, has published all kinds of other data that's clearly > more valuable. Leap seconds are a fact that has low to no creative content. > It's not even clear you could copyright it... the comments maybe... but I'm > not seeing any kind of > https://ggos.org/terms-of-use/#copyright Text Content Text content of the GGOS website is generally under the CC BY-SA license. So you are free to share (copy, redistribute) and modify (remix, transform and rebuild) website materials, but with the condition to give an appropriate credit (cite GGOS and place a link to the GGOS Website) and if you remix, transform, or rebuilt the material, you must distribute your contributions under the same license as the original. IERS is under GGOS organizationally. https://ggos.org/item/iers/ absent a different license in the leap seconds file, this seems clear to me. Warner Warner > > > Thank you for this link! I tried to find actual file yesterday. Now I >> fixed it in ntp_leapfile_sources on all my machines. >> >> Best regards >> Miroslav Lachman >> >> --000000000000d9dd0b060c6e68f2 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable


On Wed, Dec 13, 2023, 3:56 PM Warner Losh <imp@bsdimp.com> wrote:


On Wed, Dec 13, 2023, 3:47 PM Mi= roslav Lachman <000.fbsd@quip.cz> wrote:
On 13/12/2023 05:03, Michael Proto wrote:
> Noticed recently (in both my upgraded and newly-installed hosts) that =
> the leap-seconds.list file is in danger of expiration very soon (12/28= ).
> It appears the default download location in /etc/defaults/rc.conf
> (https://www.ietf.or= g/timezones/data/leap-seconds.list
> <https://www.ietf= .org/timezones/data/leap-seconds.list>) no longer
> carries this file, or at least it says plainly so when I try to fetch = it.
>
> I've been able to work around it locally by
> setting=C2=A0ntp_leapfile_sources=3D"https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-= seconds.list <https://hpiers.obspm.fr/iers/bul/bulc/ntp/leap-seconds.list>"= in /etc/rc.conf from IERS, though=C2=A0in searching where to fetch this th= ere are questions of copyright in regards to distribution so while this sho= uld work for end-users I don't know how applicable this would be upstre= am (submitted https= ://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D275737 <https://bugs.freebsd.org/bugzilla= /show_bug.cgi?id=3D275737>). I figured I'd throw it out here for= visibility to operators as my workaround should work in that case.

It's= not at all clear there are issues with redistribution. Any files that requ= ire a license or purchase are locked down at the web server level. The issu= es sound more on the FUD end of the scale. BIPM has never tried to enforce = any ip claims to this file. They have, many years ago, displayed an ignoran= ce of what people want in terms of a clear grant... the bipm, or it's s= ubsidiaries, has published all kinds of other data that's clearly more = valuable. Leap seconds are a fact that has low to no creative content. It&#= 39;s not even clear you could copyright it... the comments maybe... but I&#= 39;m not seeing any kind of=C2=A0


Text Content
Text content of the GGOS website is generally under the CC BY-SA license. = So you are free to share (copy, redistribute) and modify (remix, transform = and rebuild) website materials, but with the condition to give an appropria= te credit (cite GGOS and place a link to the GGOS Website) and if you remix= , transform, or rebuilt the material, you must distribute your contribution= s under the same license as the original.

=
IERS is under GGOS organizationally.=C2=A0
https://ggos.org/item/ier= s/ absent a different license in the leap seconds file, this seems clea= r to me.

Warner=C2= =A0

Warner


Thank you for this link! I tried to find actual file yesterday. Now I
fixed it in ntp_leapfile_sources on all my machines.

Best regards
Miroslav Lachman

--000000000000d9dd0b060c6e68f2-- From nobody Thu Dec 14 06:32:45 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4SrMwf5J80z53W66 for ; Thu, 14 Dec 2023 06:32:50 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4SrMwf4mnPz3Zrr; Thu, 14 Dec 2023 06:32:50 +0000 (UTC) (envelope-from philip@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1702535570; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=YFtpfafHOCvT2aF1J94CCHf9m63wyRwFU7i7oig7Xj4=; b=lMArsvjXeZASxV6rO2It3uhDpaKe7uEDIlm+n0Zwpcl57M9N+meRwGqVxfhpl26SRArQ09 weDu0D3gUiPJlxkHPpyMC2Zn9+sJDkZ67RAlkSePmTKrYoeI7Ml3eIfEQS0xkrkzkMQT5r HoPtOvomTx80YZaflHtBy1nFq//uuMQeotSQ0GymGZklv+9iz1Hn8DdRLVzy1JakE0LnrL cAjvk8Fiq30l1CzMHlPHluvAvQu3fVIYbpKx83LTJqIkVGaJVGn7o8ArPga3P+AajB6gd6 lFy5vnX3UcPCSlN1e89gqOHGEu0Fc/cyu42MYqvMvi7Pk5d3cmvFNc0DT/mdVw== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1702535570; a=rsa-sha256; cv=none; b=EthyCo+Pma3KYgKQNFIS84Gha+LvIogIIwGKUhHlRxtFV7s6TZzyFGSLkBWc2zlk+7uzlu +7fI/oKn0m4W6frvH8pWbqhIw67CeewHVVtvFB5Na5MoGP9rNIUxdBTJB3LY3PWCHZI0KR jJ+hnh9++1lRs8hqBKlb4TZJGIguzDpcWhJ9BKK7SWokbZefYxNXZaMl3ZbILj2ZOdwqZB CVMmdSb+IhuABHznOa0gY85hkNfTlO01wCBn9DwjnSLAAqzot7TlTYLUrpXrefEP8TRljK Ixxr6OX3UWtJNSnO/CghT0BwnljUwTNYMPUWSgisgC/U2ie8nZT+XIAcg+5hFQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1702535570; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=YFtpfafHOCvT2aF1J94CCHf9m63wyRwFU7i7oig7Xj4=; b=xplm/evQQiRTIW1PkysK+W8XKighU+F1T3cpkDbBOQ413BzuCrk8P5OpsGzqvTFaY+WT+C DlGePBn85R4EljbQBoT+Dxr+iRWAXWsXrF6tah89MuWnZOrTFq5rMyVq6aGkzPw++ixGMP jfgtk+T+G2hpCOmotjizu7bmMYqRAYElPnCy1BuQmyat2xa9DMLtTw6CQr981CG4pkSeYv QJ1LT9guVDpSVR68OEEeKRSx1tL9cLKnV0uTY2y59LHP9KBS4+GrbTD2GpJ6HGY7YAnGnd WZ3TZZ4dsP+kEeozY6yqoisooGcaGYz7w9uW/TAaHTC6VaXckrUEm+cRfZw3/w== Received: from auth1-smtp.messagingengine.com (auth1-smtp.messagingengine.com [66.111.4.227]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: philip/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4SrMwf3lhzz7jV; Thu, 14 Dec 2023 06:32:50 +0000 (UTC) (envelope-from philip@freebsd.org) Received: from compute6.internal (compute6.nyi.internal [10.202.2.47]) by mailauth.nyi.internal (Postfix) with ESMTP id 04CB227C0054; Thu, 14 Dec 2023 01:32:50 -0500 (EST) Received: from mailfrontend1 ([10.202.2.162]) by compute6.internal (MEProxy); Thu, 14 Dec 2023 01:32:50 -0500 X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvkedrudelkedgleeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvvefufffokfgjfhggtgesthdtmhdtredttdenucfhrhhomheprfhhihhl ihhpucfrrggvphhsuceophhhihhlihhpsehfrhgvvggsshgurdhorhhgqeenucggtffrrg htthgvrhhnpefggfefieegtedtledtgfevtdfftdegvdehueeiteehteefieefveevtedv vdekgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpe hphhhilhhiphdomhgvshhmthhprghuthhhphgvrhhsohhnrghlihhthidqudduieeivdei vdegkedqvdefhedukedttdekqdhphhhilhhipheppehfrhgvvggsshgurdhorhhgsehtrh houhgslhgvrdhish X-ME-Proxy: Feedback-ID: ia691475d:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Thu, 14 Dec 2023 01:32:48 -0500 (EST) From: Philip Paeps To: Michael Proto Cc: FreeBSD-STABLE Mailing List Subject: Re: ntpd: leap-seconds.list expiration Date: Thu, 14 Dec 2023 14:32:45 +0800 X-Mailer: MailMate (1.14r6010) Message-ID: <4669E676-0F2F-49AE-8783-422D6A6353E9@freebsd.org> In-Reply-To: References: List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; format=flowed On 2023-12-13 12:03:02 (+0800), Michael Proto wrote: > Noticed recently (in both my upgraded and newly-installed hosts) that > the > leap-seconds.list file is in danger of expiration very soon (12/28). Note that there is no actual "danger" here. No leap second will be introduced at the end of 2023, so the contents of the current leap-seconds.list are accurate. Nothing bad will happen. Moreover, ntpd only uses leap-seconds.list as a last resort. If peers have leap second information, ntpd will pick that up. Having said that, we should do something about the scary warning. Xin submitted a draft EN. The security-officer team will pick that up. Philip -- Philip Paeps Senior Reality Engineer Alternative Enterprises From nobody Fri Dec 15 07:38:32 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Ss1LF6Wtfz54QVD for ; Fri, 15 Dec 2023 07:38:45 +0000 (UTC) (envelope-from gerrit.kuehn@aei.mpg.de) Received: from umail2.aei.mpg.de (umail2.aei.mpg.de [194.94.224.8]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Ss1LD3sbLz4drs for ; Fri, 15 Dec 2023 07:38:44 +0000 (UTC) (envelope-from gerrit.kuehn@aei.mpg.de) Authentication-Results: mx1.freebsd.org; dkim=none; spf=pass (mx1.freebsd.org: domain of gerrit.kuehn@aei.mpg.de designates 194.94.224.8 as permitted sender) smtp.mailfrom=gerrit.kuehn@aei.mpg.de; dmarc=none Received: from arc.aei.uni-hannover.de (ahgate1.aei.uni-hannover.de [130.75.117.49]) by umail2.aei.mpg.de (Postfix) with ESMTPS id 18C6E1F988BA for ; Fri, 15 Dec 2023 08:38:40 +0100 (CET) Date: Fri, 15 Dec 2023 08:38:32 +0100 From: Gerrit =?UTF-8?B?S8O8aG4=?= To: FreeBSD-STABLE Mailing List Subject: high interrupt rate on ichsmb0 Message-ID: <20231215083832.685aceec@arc.aei.uni-hannover.de> Organization: MPG X-Mailer: Claws Mail 3.19.0 (GTK+ 2.24.33; amd64-portbld-freebsd13.1) List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; boundary="Sig_/E_tMNBVBTwoJ4PMG6Rn0hE4"; protocol="application/pkcs7-signature"; micalg=SHA384 X-Spamd-Result: default: False [-5.10 / 15.00]; SIGNED_SMIME(-2.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.93)[-0.926]; R_MIXED_CHARSET(0.63)[subject]; R_SPF_ALLOW(-0.20)[+ip4:194.94.224.8]; RCVD_IN_DNSWL_MED(-0.20)[194.94.224.8:from]; RWL_MAILSPIKE_VERYGOOD(-0.20)[194.94.224.8:from]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; MLMMJ_DEST(0.00)[freebsd-stable@freebsd.org]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:680, ipnet:194.94.0.0/15, country:DE]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; TO_DN_ALL(0.00)[]; HAS_ATTACHMENT(0.00)[]; DMARC_NA(0.00)[mpg.de]; PREVIOUSLY_DELIVERED(0.00)[freebsd-stable@freebsd.org]; RCPT_COUNT_ONE(0.00)[1]; RCVD_TLS_ALL(0.00)[] X-Rspamd-Queue-Id: 4Ss1LD3sbLz4drs X-Spamd-Bar: ----- --Sig_/E_tMNBVBTwoJ4PMG6Rn0hE4 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable Hello, I have a system running 13.2 that shows a high interrupt rate on "ichsmb0 16". vmstat -i reports --- irq16: ichsmb0 72353386 148839 --- I cannot really find out what is causing this. Unloading the ichsmb module is possible, but the system reloads it again automatically, still showing the same issue. I don't see any error messages. Rebooting doesn't help, the newly booted system shows the same issue. I would think that this wasn't there some time ago, so there are good chances that it appeared with the upgrade to 13.2 I did a few days ago. --- ichsmb0: port 0x780-0x79f at device 31.4 numa-domain 0 on pci0 smbus0: numa-domain 0 on ichsmb0 --- This is on a Supermicro X11DPH-T mainboard. Any suggestions how to find out more about the reason for this, and maybe fix it? cu Gerrit --Sig_/E_tMNBVBTwoJ4PMG6Rn0hE4 Content-Type: application/pkcs7-signature; name=smime.p7s Content-Transfer-Encoding: base64 Content-Disposition: attachment; filename=smime.p7s MIAGCSqGSIb3DQEHAqCAMIACAQExDzANBglghkgBZQMEAgIFADCABgkqhkiG9w0B BwEAAKCCF/QwggQyMIIDGqADAgECAgEBMA0GCSqGSIb3DQEBBQUAMHsxCzAJBgNV BAYTAkdCMRswGQYDVQQIDBJHcmVhdGVyIE1hbmNoZXN0ZXIxEDAOBgNVBAcMB1Nh bGZvcmQxGjAYBgNVBAoMEUNvbW9kbyBDQSBMaW1pdGVkMSEwHwYDVQQDDBhBQUEg Q2VydGlmaWNhdGUgU2VydmljZXMwHhcNMDQwMTAxMDAwMDAwWhcNMjgxMjMxMjM1 OTU5WjB7MQswCQYDVQQGEwJHQjEbMBkGA1UECAwSR3JlYXRlciBNYW5jaGVzdGVy MRAwDgYDVQQHDAdTYWxmb3JkMRowGAYDVQQKDBFDb21vZG8gQ0EgTGltaXRlZDEh MB8GA1UEAwwYQUFBIENlcnRpZmljYXRlIFNlcnZpY2VzMIIBIjANBgkqhkiG9w0B AQEFAAOCAQ8AMIIBCgKCAQEAvkCd9G7h6naHHE1FRI6+RsiDBp3BKv4YH47kAvrz q11QihYxC5oG0MVwIs1JLVRjzLZuaEYLU+rLTCTAvHJO6vEVrvRUmhIKw3qyM2Di 2olV8yJY897cz++DhqKMlE+faPKYkEaEJ8d2v+PMNSyLXgdkZYLASLCokflhn3Yg UKiRx2a163hiA1bwihoT6jGjHqCZ/Tj29icyWG8H9Wu4+xQrr7eqzNZjX3OM2gWZ qDioyxd4NlGs6Z70eDqNzw/ZQuKYDKsvnw4B3u+fmUnxLd+sdE0bmLVHxeUp0fmQ GMdinL6DxyZ7Poolx8DdneY1aBAgnY/Y3tLDhJwNXugvyQIDAQABo4HAMIG9MB0G A1UdDgQWBBSgEQojPpbxB+zirynvgqV/0DCktDAOBgNVHQ8BAf8EBAMCAQYwDwYD VR0TAQH/BAUwAwEB/zB7BgNVHR8EdDByMDigNqA0hjJodHRwOi8vY3JsLmNvbW9k b2NhLmNvbS9BQUFDZXJ0aWZpY2F0ZVNlcnZpY2VzLmNybDA2oDSgMoYwaHR0cDov L2NybC5jb21vZG8ubmV0L0FBQUNlcnRpZmljYXRlU2VydmljZXMuY3JsMA0GCSqG SIb3DQEBBQUAA4IBAQAIVvwC8Jvo/6T61nvGRIDOT8TF9gBYzKa2vBRJaAR26Obu XewCD2DWjVAYTyZOAePmsKXuv7x0VEG//fwSuMdPWvSJYAV/YLcFSvP28cK/xLl0 hrYtfWvM0vNG3S/G4GrDwzQDLH2W3VrCDqcKmcEFi6sML/NcOs9sN1UJh95TQGxY 7/y2q2VuBPYb3DzgWhXGntnxWUgwIWUDbOzpIXPsmwOh4DetoBUYj/q6As6nLKkQ EyzU5QgmqyKXYPiQXnTUoppTvfKpaOCibsLXbLGjD56/62jnVvKu8uMrODoJgbVr hde+Le0/GreyY+L1YiyC1GoAQVDxOYOflek2lphuMIIFgTCCBGmgAwIBAgIQOXJE Ovkit1HX02wQ3TE1lTANBgkqhkiG9w0BAQwFADB7MQswCQYDVQQGEwJHQjEbMBkG A1UECAwSR3JlYXRlciBNYW5jaGVzdGVyMRAwDgYDVQQHDAdTYWxmb3JkMRowGAYD VQQKDBFDb21vZG8gQ0EgTGltaXRlZDEhMB8GA1UEAwwYQUFBIENlcnRpZmljYXRl IFNlcnZpY2VzMB4XDTE5MDMxMjAwMDAwMFoXDTI4MTIzMTIzNTk1OVowgYgxCzAJ BgNVBAYTAlVTMRMwEQYDVQQIEwpOZXcgSmVyc2V5MRQwEgYDVQQHEwtKZXJzZXkg Q2l0eTEeMBwGA1UEChMVVGhlIFVTRVJUUlVTVCBOZXR3b3JrMS4wLAYDVQQDEyVV U0VSVHJ1c3QgUlNBIENlcnRpZmljYXRpb24gQXV0aG9yaXR5MIICIjANBgkqhkiG 9w0BAQEFAAOCAg8AMIICCgKCAgEAgBJlFzYOw9sIs9CsVw127c0n00ytUINh4qog TQktZAnczomfzD2p7PbPwdzx07HWezcoEStH2jnGvDoZtF+mvX2do2NCtnbyqTsr kfjib9DsFiCQCT7i6HTJGLSR1GJk23+jBvGIGGqQIjy8/hPwhxR79uQfjtTkUcYR Z0YIUcuGFFQ/vDP+fmyc/xadGL1RjjWmp2bIcmfbIWax1Jt4A8BQOujM8Ny8nkz+ rwWWNR9XWrf/zvk9tyy29lTdyOcSOk2uTIq3XJq0tyA9yn8iNK5+O2hmAUTnAU5G U5szYPeUvlM3kHND8zLDU+/bqv50TmnHa4xgk97Exwzf4TKuzJM7UXiVZ4vuPVb+ DNBpDxsP8yUmazNt925H+nND5X4OpWaxKXwyhGNVicQNwZNUMBkTrNN9N6frXTps NVzbQdcS2qlJC9/YgIoJk2KOtWbPJYjNhLixP6Q5D9kCnusSTJV882sFqV4Wg8y4 Z+LoE53MW4LTTLPtW//e5XOsIzstAL81VXQJSdhJWBp/kjbmUZIO8yZ9HE0XvMns QybQv0FfQKlERPSZ51eHnlAfV1SoPv10Yy+xUGUJ5lhCLkMaTLTwJUdZ+gQek9Qm RkpQgbLevni3/GcV4clXhB4PY9bpYrrWX1Uu6lzGKAgEJTm4Diup8kyXHAc/DVL1 7e8vgg8CAwEAAaOB8jCB7zAfBgNVHSMEGDAWgBSgEQojPpbxB+zirynvgqV/0DCk tDAdBgNVHQ4EFgQUU3m/WqorSs9UgOHYm8Cd8rIDZsswDgYDVR0PAQH/BAQDAgGG MA8GA1UdEwEB/wQFMAMBAf8wEQYDVR0gBAowCDAGBgRVHSAAMEMGA1UdHwQ8MDow OKA2oDSGMmh0dHA6Ly9jcmwuY29tb2RvY2EuY29tL0FBQUNlcnRpZmljYXRlU2Vy dmljZXMuY3JsMDQGCCsGAQUFBwEBBCgwJjAkBggrBgEFBQcwAYYYaHR0cDovL29j c3AuY29tb2RvY2EuY29tMA0GCSqGSIb3DQEBDAUAA4IBAQAYh1HcdCE9nIrgJ7cz 0C7M7PDmy14R3iJvm3WOnnL+5Nb+qh+cli3vA0p+rvSNb3I8QzvAP+u431yqqcau 8vzY7qN7Q/aGNnwU4M309z/+3ri0ivCRlv79Q2R+/czSAaF9ffgZGclCKxO/WIu6 pKJmBHaIkU4MiRTOok3JMrO66BQavHHxW/BBC5gACiIDEOUMsfnNkjcZ7Tvx5Dq2 +UUTJnWvu6rvP3t3O9LEApE9GQDTF1w52z97GA1FzZOFli9d31kWTz9RvdVFGD/t So7oBmF0Ixa1DVBzJ0RHfxBdiSprhTEUxOipakyAvGp4z7h/jnZymQyd/teRCBah o1+VMIIG5jCCBM6gAwIBAgIQMQJw1DW+mySa+FbQ4eKFSTANBgkqhkiG9w0BAQwF ADCBiDELMAkGA1UEBhMCVVMxEzARBgNVBAgTCk5ldyBKZXJzZXkxFDASBgNVBAcT C0plcnNleSBDaXR5MR4wHAYDVQQKExVUaGUgVVNFUlRSVVNUIE5ldHdvcmsxLjAs BgNVBAMTJVVTRVJUcnVzdCBSU0EgQ2VydGlmaWNhdGlvbiBBdXRob3JpdHkwHhcN MjAwMjE4MDAwMDAwWhcNMzMwNTAxMjM1OTU5WjBGMQswCQYDVQQGEwJOTDEZMBcG A1UEChMQR0VBTlQgVmVyZW5pZ2luZzEcMBoGA1UEAxMTR0VBTlQgUGVyc29uYWwg Q0EgNDCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBALNK4iJeJ1vpBFsU BDUyIBSutNIxQMbNUMAeoUTKr55KYX8tkN5imzNqLaRCypYBPP9wED2AaO6e8njk bjzJwLgPqDBkW9sG3kmi3GW6cF4Hwr5ysZqve/5EJDhV+9OhfTu/4dMnoR4Q41Hc jMk9MzLOADAQ0awBZ/29r0d49AUmIKELNeqEqmnTN6fndL7x/2K0TLToZLxqS7sy /Jvi0wEFr0CfdjcAsioh7KaD+Jizyb1aRKQzJ6Q20VEHX7UqWc1SkzTkbz6xj0S5 ydBBFQh0fNiy+qM/deVpK4HgmPSJrrpQZ+LlbHfWabmwoDPxF71QZVYiqrrAoUrG RJ+47iLBiIg8miIYS7Hd2ppvAUt24CugMXUjETjQ+oYh09fNi5n/AvoER8UBvTHL xt+blL0bvL+2z2YiUWk+2Qtn+dD+JU5Z2y71qV7+cr+4YXjvGzF5bYsi8HiwflTb 4Php3y+k1twKtchdcq2QGc0eDG6Y01nRHUiyr8/PtMAsLHEPNZ2wzsA7fb8mftHi V20ZFmYqknJ8AIOfwdTVA+E62JayOJ+sxadqcmFDorsz/mrPwGZ8+txr4xSuvVjg 0dlv0yuA+1YpBDIYNfL4bkX+IcZ1mTstL4Xw0f4N2iW3bBmnPnYmoYxMM8gflCiT gss73nBvG2f7v1PD7BDGYNO4iD4vAgMBAAGjggGLMIIBhzAfBgNVHSMEGDAWgBRT eb9aqitKz1SA4dibwJ3ysgNmyzAdBgNVHQ4EFgQUaQChxyFY+ODFGyCwCt2nUb8T 2eQwDgYDVR0PAQH/BAQDAgGGMBIGA1UdEwEB/wQIMAYBAf8CAQAwHQYDVR0lBBYw FAYIKwYBBQUHAwIGCCsGAQUFBwMEMDgGA1UdIAQxMC8wLQYEVR0gADAlMCMGCCsG AQUFBwIBFhdodHRwczovL3NlY3RpZ28uY29tL0NQUzBQBgNVHR8ESTBHMEWgQ6BB hj9odHRwOi8vY3JsLnVzZXJ0cnVzdC5jb20vVVNFUlRydXN0UlNBQ2VydGlmaWNh dGlvbkF1dGhvcml0eS5jcmwwdgYIKwYBBQUHAQEEajBoMD8GCCsGAQUFBzAChjNo dHRwOi8vY3J0LnVzZXJ0cnVzdC5jb20vVVNFUlRydXN0UlNBQWRkVHJ1c3RDQS5j cnQwJQYIKwYBBQUHMAGGGWh0dHA6Ly9vY3NwLnVzZXJ0cnVzdC5jb20wDQYJKoZI hvcNAQEMBQADggIBAAoFTnsNjx8TOQD9b+xixsPt7Req4wHMeNw/R5dddEPgQAQA YJZKz5BEv1cjGbH7nbPH3AxrxhN6OVH40p6OLIo9MXSrrfMzGs7/P+FTCjwgNxFE tLQ1KC9NboA3asJcl7mIs3l8h9iAgEH1zLUvq2s+5n++NQmbzudDsTFDMapY3kX1 TwyUCTRzmItqcbsYIyg2MeIXWfRtqPqC5R4bufmpzA5BPINLX340Sp/CNQ9QZqw3 VkfyHWwTo+vO9Gm2L6srNamJT6Lb+TeXZvl8UPL5a72O/pH0GgGHjt6z9QzPARna RKshVWviNK6ST4WmZHllu3CJg0BXqx1vWyswawgvNeWt1qxITacYe9mSWTbNR2Cf tvTUwerruDSY2jMaZPoNqbjUpuG/blYwWzzvVerBUhviAahPXJF/9V48ybWPBq6q KOEokW+s3B4ad5sY96KlovEijaIQDip1HO0SD+rLNYaiBcr9MV2aK+DfbZ8w9BaN CQyFEYwzxIKOVk3bYvzHRk5ihUDascmbk/bkiNl74c/KfuKQmJImaqWoWZR6jBcX cPV0WUIKz/nILTpFhGojZEQW77by3aezAi9jrEIUBHRG1LwzPbJc2V3SOzYyaJFQ atzuKZbN1Q9s9y/2x1QXtKwREY8jNgvx0iIfOK35gKgYJJcyDql4XfuEc2nVMIIH SzCCBTOgAwIBAgIRAMCEqCZW/bEp9AgcdlGEWuEwDQYJKoZIhvcNAQEMBQAwRjEL MAkGA1UEBhMCTkwxGTAXBgNVBAoTEEdFQU5UIFZlcmVuaWdpbmcxHDAaBgNVBAMT E0dFQU5UIFBlcnNvbmFsIENBIDQwHhcNMjMwODE1MDAwMDAwWhcNMjYwODE0MjM1 OTU5WjCB0zEOMAwGA1UEERMFODA1MzkxRzBFBgNVBAoMPk1heC1QbGFuY2stR2Vz ZWxsc2NoYWZ0IHp1ciBGw7ZyZGVydW5nIGRlciBXaXNzZW5zY2hhZnRlbiBlLlYu MRswGQYDVQQJDBJIb2ZnYXJ0ZW5zdHJhw59lIDgxDzANBgNVBAgTBkJheWVybjEL MAkGA1UEBhMCREUxFTATBgNVBAMTDEdlcnJpdCBLdWVobjEmMCQGCSqGSIb3DQEJ ARYXZ2Vycml0Lmt1ZWhuQGFlaS5tcGcuZGUwggIiMA0GCSqGSIb3DQEBAQUAA4IC DwAwggIKAoICAQCg7n7fRC0hIeomyBYF0RZ0L/jKjURwqPL3vBN+HvDxzp+Wcn0a Voeia3LPeXvf18d7BeIQ2SVFXWnWzVpVKzv7VUg4OD424GmcQrFXkChSvOc/rLaA FmNIaKWgYwUOAqmDh3t9JzQTVj6FrAeJwzXmnv42msNUfnhA2dRllOCmilLUqm/5 nOgrImuiA3R1S0CcljAmEr5PnUmKJaanbaq74Jb54gf622cRyWwylMJijMGboDYw uaGynrLgfo+rWbXc2TASO6pjSQDKAAfXO/NzLgp+BmneN1II9alVUAJRUpFDkgx9 peM+qUJryLtO+veOKElsOe2S4qvk0PaE/MVAcIJiThdY7qde8Q9FyOJsDN5kiX4g fsKmtF7EdB71Uc8N78L62r7/7Y5WL8gRxXCN8BsmLXSiCylvtIYsbJMDhK6C+37w 9Cg1A8AWeksg1TmCcvolEJy3+bfPx7NlmEfRdkdzuVb1KxfB0z4SbhSwOAR1WYVg mEAQuj1l9k7suUtdUY4ZeMnRLVPtmQh+bxcJPaRllpHSTYbYVQlSNXkP0al2/J8d jJHhulOsCX8oYfyQ9a33jHsKUf632Lpg8446ym19UrNPh9pntXRXVhhkw+/tPE8G BxH81BCvvSUhVu0Nckx8zOWiI1+6Z5t71udnXOEv9lJFvqDlY71lkiu+jQIDAQAB o4IBpDCCAaAwHwYDVR0jBBgwFoAUaQChxyFY+ODFGyCwCt2nUb8T2eQwHQYDVR0O BBYEFOsacOXMtCWA1hWcY7A/tb8e/tTSMA4GA1UdDwEB/wQEAwIFoDAMBgNVHRMB Af8EAjAAMB0GA1UdJQQWMBQGCCsGAQUFBwMEBggrBgEFBQcDAjA/BgNVHSAEODA2 MDQGCysGAQQBsjEBAgJPMCUwIwYIKwYBBQUHAgEWF2h0dHBzOi8vc2VjdGlnby5j b20vQ1BTMEIGA1UdHwQ7MDkwN6A1oDOGMWh0dHA6Ly9HRUFOVC5jcmwuc2VjdGln by5jb20vR0VBTlRQZXJzb25hbENBNC5jcmwweAYIKwYBBQUHAQEEbDBqMD0GCCsG AQUFBzAChjFodHRwOi8vR0VBTlQuY3J0LnNlY3RpZ28uY29tL0dFQU5UUGVyc29u YWxDQTQuY3J0MCkGCCsGAQUFBzABhh1odHRwOi8vR0VBTlQub2NzcC5zZWN0aWdv LmNvbTAiBgNVHREEGzAZgRdnZXJyaXQua3VlaG5AYWVpLm1wZy5kZTANBgkqhkiG 9w0BAQwFAAOCAgEAbUB7zWvNZ98vh3u7hzpnbA1K4U9bga1YkpVbOgv7/UY5RiZP Rk06O18f5TnRSWiiF3XImBG1uVjbcwVKIemliCQRQzVVt2JXOJVT1EafDDe9DK5o QaXGHY7NAT1lPLEwtgv8hxBBvthMaMa6lpibT/IUi83jHPZUgsGajCgPXd05Bh/L jCzWDOmHuwFdjRAMQs1VsPYx+OVcRvS1jmw0bT6o5/nruRwF5brxUK39Mftj3sIN b+UvVkXdAGw5iQWFwllGpwBgo3iESa1R72qkBMWph8D6Jbg795WBgjMULCPTiZkq eOif9sW1/37AoutSh7VMh7WMrEW9QURVWYR1hYjS0/TMo8aXfPOLtLYoSg/R6i+j eXqREsJQxMAl0e/JJej1TAFCsWg0r6Dg4mYq636plAr6pu7pJATNVPT0HrsBMYWu PV2WRH8Obs+n1xe4ftGxE4yDWiL56lnp6tnfVR8qinEqpGBfj7BAwEcO/Na9b+oK tDEmWHzupKkdmoOWktURY+Q/5RVWoiozNujYljc9iaK3agqBbJ5ZzRyrCKOPLnw4 9b8koO03WkXPqlm59nxAOdJE6ZQ2aQ8ev6ji+UlGnlIvgk70MsRukY2shpAiowb6 bKjKyK3QGNnT4zmL6ixSRmnYhC95U923Yf+hy+6jqS1Ec6kgpREYG53Qv5IxggMs MIIDKAIBATBbMEYxCzAJBgNVBAYTAk5MMRkwFwYDVQQKExBHRUFOVCBWZXJlbmln aW5nMRwwGgYDVQQDExNHRUFOVCBQZXJzb25hbCBDQSA0AhEAwISoJlb9sSn0CBx2 UYRa4TANBglghkgBZQMEAgIFAKCBozAYBgkqhkiG9w0BCQMxCwYJKoZIhvcNAQcB MBwGCSqGSIb3DQEJBTEPFw0yMzEyMTUwNzM4MzJaMCgGCSqGSIb3DQEJDzEbMBkw CwYJYIZIAWUDBAECMAoGCCqGSIb3DQMHMD8GCSqGSIb3DQEJBDEyBDB6EeO2Zzi/ Ebc1wxUtpbuqg9xgxpTXmVwb8zy5JHjdC7XhFrDGN7oj56ks8nTfwNgwDQYJKoZI hvcNAQEBBQAEggIAdhh8uOhNIblLULZhU17anbt8/q8SzUq7XbRJDCvMoJqiJQrN IcDf8RCWxuD0ZQJJwywQ9HgLXrgbh3997SRuZTvHTPdQ3xHQpisPBxcIwteVeFiJ qscoXSd4UBuR2zUew2mw2jTqOSqxOQvOilmfHjDU+2OSqueRFkYpCMWBYBvJcjbj oZcfI5rbPYntVMgzaBNgjsN2OncIKctgUpCJ5giD7B5Ri+gy+xBR2f640Z3eCGZM x2x6WlyfrrzN5PW9hxu9ZbNxXtSv5/Skmb5rc4UF+V2cpbo39bSwRZZ+EE8D1jL1 IKHvlaL2x/Ecs7OY9CTGbVKpI6b1zL3zbmajr+XrKT5IrTsJj9Dd6Qw3Nsj+fG4K vJrMF15pBjrIHg6GnNWDqprLkOLaTTyx+E9comft/0EBNJndHF1hTDjSBERbMJtP A1HUeuoTk2tDaklAjQ9A81BIPKKYMEhiXbiM7NGZPkSUov2g5E4bIUiUXN+Kt1GH WG0l1lZ0VIXGtdXwTDOqCpbULqGckVZQ8PMQGyC7vKIKZjPvpZKLIm0Hbmaqoh4U 3xlldpzXUod6tE1KAF24gpyGTfldVqjoZC0YjkegvJ8B/UQqS6rmNqz65l8Pyp/i cuDdvCqg/syF+ydmtOHIXv3n0m711a3H6J50RKmgAi0GZqeYE1jZOXxGiKcAAAAA AAA= --Sig_/E_tMNBVBTwoJ4PMG6Rn0hE4-- From nobody Sat Dec 16 20:25:11 2023 X-Original-To: freebsd-stable@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4SsyJY6XYXz52g22; Sat, 16 Dec 2023 20:25:33 +0000 (UTC) (envelope-from hausen@punkt.de) Received: from mail.punkt.de (mail.punkt.de [IPv6:2a00:b580:8000:11:1c6b:7032:35e9:5616]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4SsyJX5YPlz4Pfy; Sat, 16 Dec 2023 20:25:32 +0000 (UTC) (envelope-from hausen@punkt.de) Authentication-Results: mx1.freebsd.org; dkim=none; spf=pass (mx1.freebsd.org: domain of hausen@punkt.de designates 2a00:b580:8000:11:1c6b:7032:35e9:5616 as permitted sender) smtp.mailfrom=hausen@punkt.de; dmarc=none Received: from smtpclient.apple (unknown [IPv6:2003:a:d59:3800:cd57:70fe:6ed:e47a]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mail.punkt.de (Postfix) with ESMTPSA id B1C7D6D39E; Sat, 16 Dec 2023 21:25:22 +0100 (CET) From: "Patrick M. Hausen" Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable List-Id: Production branch of FreeBSD source code List-Archive: https://lists.freebsd.org/archives/freebsd-stable List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-stable@freebsd.org X-BeenThere: freebsd-stable@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.200.91.1.1\)) Subject: Odd values for various memory metrics via SNMP Message-Id: <1EDAF2AC-3A2B-43BE-B66B-E095F5A80C2C@punkt.de> Date: Sat, 16 Dec 2023 21:25:11 +0100 To: FreeBSD-STABLE Mailing List , FreeBSD Net X-Mailer: Apple Mail (2.3774.200.91.1.1) X-Spamd-Result: default: False [-1.26 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-0.99)[-0.990]; NEURAL_SPAM_SHORT(0.53)[0.532]; MV_CASE(0.50)[]; R_SPF_ALLOW(-0.20)[+ip6:2a00:b580::/32]; MIME_GOOD(-0.10)[text/plain]; RCVD_COUNT_ONE(0.00)[1]; MLMMJ_DEST(0.00)[freebsd-net@freebsd.org,freebsd-stable@freebsd.org]; R_DKIM_NA(0.00)[]; ASN(0.00)[asn:16188, ipnet:2a00:b580::/32, country:DE]; MIME_TRACE(0.00)[0:+]; FROM_EQ_ENVFROM(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_TLS_ALL(0.00)[]; ARC_NA(0.00)[]; TO_DN_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; DMARC_NA(0.00)[punkt.de]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Rspamd-Queue-Id: 4SsyJX5YPlz4Pfy X-Spamd-Bar: - Hi all, what's the best platform/list/forum/... to discuss issues with the SNMP = implementations for FreeBSD? Since I started to dig deeper into Obervium I found that of = all the systems I own only the FreeBSD based ones present some challenges regarding the = interpretation of memory metrics. 1. I confirmed that this is not an Observium artefact. LibreNMS and = manual snmpwalk give the same results. 2. This is independent of the question if you use net-snmp (FreeNAS, = OPNsense) or bsnmpd in base (my Raspberry Pi cluster). 3. These are the systems concerned: - OPNsense - FreeBSD 13.2, AMD64, 8 G of RAM, net-snmp - FreeNAS - TrueANS CORE, FreeBSD 13.1, AMD64, 64 G of RAM, net-snmp - 7 Raspberry Pi CM 3+, AARCH64, 1 G of RAM, bsnmpd 4. The "odd" metrics: - "Real Memory" OPNsense: 762 of 768 M (yes!) used, flagged "red" in Observium, of = course FreeNAS: 35.9 of 36.1 G used All the Pis: 178 of 179 M used All - see hardware description above - no connection to the "real real" = memory installed. For comparison: ESXi 8.0: 26.7 of 31.9 G used - the system has got 32 G = of RAM installed. - "Shared real memory" OPNsense: 97.1 of 103 M used FreeNAS: 593 of 774 M used Pis: 11.8 of 12.4 M used - Shared virtual memory Only systems running net-snmp have this, bsnmpd based ones don't. OPNsense: 166 of 233 M used FreeNAS: 1028.27 M of 1.49 G used - Virtual Memory Again, only via net-snmp. OPNsense: 5.03 of 5.11 G used FreeNAS: 628 of 628 G used - that's particularly weird for a system with = 64 G of RAM installed and not swapping or anything. For comparison: my only Linux based system: 12.7 of 29.6 G used - the = system has 16 G of RAM plus 16 G of swap, that seems to match the "29.6". For me these numbers don't make any sense at all. The motivation to = write this email: I am planning to use SNMP based monitoring, probably Observium, for all = our data centres, which means > 100 FreeBSD based hosts. The point of a = monitoring/management system is that anything flagged "red" is a real problem that needs = attention and the default state should be "everything super green". Things flagged "red" but = "everybody knows it can be ignored" bind a huge amount of brain capacity on behalf of the = operators. Not good. So what is going on here? What do these numbers actually mean? Where do = they come from? Are they artefacts of the SNMP implementation not taylored = perfectly for FreeBSD or are they some real metric that ends up interpreted wrong in the NMS = (Observium)? Thanks and kind regards, Patrick --=20 punkt.de GmbH Patrick M. Hausen .infrastructure Sophienstr. 187 76185 Karlsruhe Tel. +49 721 9109500 https://infrastructure.punkt.de info@punkt.de AG Mannheim 108285 Gesch=C3=A4ftsf=C3=BChrer: Daniel Lienert, Fabian Stein