From nobody Mon Feb 26 01:10:12 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TjjGR2HQ9z5BlHK; Mon, 26 Feb 2024 01:10:23 +0000 (UTC) (envelope-from lexi@le-fay.org) Received: from thyme.eden.le-Fay.ORG (THYME.EDEN.LE-FAY.ORG [81.187.47.194]) by mx1.freebsd.org (Postfix) with ESMTP id 4TjjGQ0DQwz4vT9; Mon, 26 Feb 2024 01:10:22 +0000 (UTC) (envelope-from lexi@le-fay.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=le-fay.org header.s=thyme header.b=SPP24wZ1; dmarc=none; spf=pass (mx1.freebsd.org: domain of lexi@le-fay.org designates 81.187.47.194 as permitted sender) smtp.mailfrom=lexi@le-fay.org Received: from iris.eden.le-Fay.ORG (IRIS.EDEN.LE-FAY.ORG [IPv6:2001:8b0:aab5:106:3::6]) by thyme.eden.le-Fay.ORG (Postfix) with ESMTP id 94865A0; Mon, 26 Feb 2024 01:10:10 +0000 (GMT) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=le-fay.org; s=thyme; t=1708909810; bh=QGuEInZpnpYdSLFNU3wxJSAzEmvtDhp6EaKLfCArJ4I=; h=Date:From:To:Cc:Subject; b=SPP24wZ1Khzg8HWoev4mPEVli3E+XZ8cB066tCTMPNRbbSrU/KmaVsiRJyFGLpLkY 0WPgoDCO0lC4MgTgXe9B3ML7CRKdAOUonQHlsbpHd9YlQkNCixIFGWyqqrIzD34Ldq Hxcqa4oF7AazNs3G9RmOBGgwudtKmcfjhEcS+jXE= Received: from ilythia.eden.le-fay.org (ILYTHIA.EDEN.LE-FAY.ORG [IPv6:2001:8b0:aab5:106:3::10]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (secp384r1) server-digest SHA384) (No client certificate requested) by iris.eden.le-Fay.ORG (Postfix) with ESMTPSA id 9B3932C041F; Mon, 26 Feb 2024 01:10:12 +0000 (GMT) Date: Mon, 26 Feb 2024 01:10:12 +0000 From: Lexi Winter <lexi@le-fay.org> To: ports@freebsd.org Cc: python@freebsd.org Subject: ports commit request Message-ID: <Zdvk9CF_ORxOZ-QQ@ilythia.eden.le-fay.org> Mail-Followup-To: ports@freebsd.org, python@freebsd.org List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="/brXcZ1NLeG6sHQS" Content-Disposition: inline X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.50 / 15.00]; SIGNED_PGP(-2.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; R_SPF_ALLOW(-0.20)[+ip4:81.187.47.194]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; R_DKIM_ALLOW(-0.20)[le-fay.org:s=thyme]; RCVD_NO_TLS_LAST(0.10)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; MISSING_XM_UA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; ASN(0.00)[asn:20712, ipnet:81.187.0.0/16, country:GB]; ARC_NA(0.00)[]; DMARC_NA(0.00)[le-fay.org]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DWL_DNSWL_NONE(0.00)[le-fay.org:dkim]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROMTLD(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MLMMJ_DEST(0.00)[ports@freebsd.org,python@freebsd.org]; DKIM_TRACE(0.00)[le-fay.org:+] X-Rspamd-Queue-Id: 4TjjGQ0DQwz4vT9 --/brXcZ1NLeG6sHQS Content-Type: text/plain; charset=us-ascii Content-Disposition: inline hello, if someone has a moment, could you please commit this patch: https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=276347 this is a trivial patch to make a broken port as BROKEN=. thanks, lexi. --/brXcZ1NLeG6sHQS Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGzBAABCAAdFiEEuwt6MaPcv/+Mo+ftDHqbqZ41x5kFAmXb5PAACgkQDHqbqZ41 x5mK/Qv+P7Uoq54YbTrXGTAtHQpmoIlwVETzidv2dB9SacrudXMWsmnna6nHMsZf E5192G0RhhbWP1/yzAX4YwNnPEWlzv7EmqX1z5Q/xIC6g8j42VGGdMcIUTDb+Zww lLa004zd3tpaCaiHMWIOley9MEP6bk/pPvgwptA/H4qN8VKFa7/wWn1ZLsjLz7OS LuxAJ3sX0pbDxmEnDoaUOHK257IBeTSe2XCVqkIN0Ehb6+o++kkigyepcvn4shdk vVuYpVW+x9P6jbcvg1+aRU+19DnU7BpZEec508C8MGTfB1CQjmSJ20/BvKSDLOTF jeuRku66YqJdKFvC5uxEIE39FmPV2NyBkuCKn1GPgZJUSGIlX5L9tmtBTcaEgG7m mdSBpCHrzlUE2j74ofE7HMqxyvieveY31U7PA8hpiTZZfg/v3Ar8lpVT4WGrXL8N 9w0TfRJc+zNdup/y1cgjaIdpUUCim8urzuaZCCZIcYqwahdnO+mdrgTk8S8d35VT NIWPbku3 =egXG -----END PGP SIGNATURE----- --/brXcZ1NLeG6sHQS-- From nobody Mon Feb 26 04:10:53 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TjnGk4Jkjz5CJ3W for <ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 04:10:54 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TjnGj6wQFz4Bq9 for <ports@freebsd.org>; Mon, 26 Feb 2024 04:10:53 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1708920654; a=rsa-sha256; cv=none; b=PTneHJVsHNpBMD5Xf+WEelNAuSJj3DMGzuMXelGJP7/jD2lX/kgMQcWWwKMPLpQAvMyyCc TP2vP7Lm8VGTufeYIPsFfrBsgJzXbNS+RiJCnnBaFiNC5J6Qt10UQxHlkqU1s1PDSRP/tO xZacxQAuoUZKTAfDcGFszRw08q1kR9fP401+I5i7f2SDk7U9w3dIG5rusSnha0XFr/DoT4 jl1qCto3H7TWs629sXP0c1NkGI6WX97YZNKtvYVSit4zmRYIx5muCdtQ5iOqDBP6i2fW67 53X3Vcxdn79vsg9PtiKAK8Q3YXOeRBRL42KehaZypFXN3a+cNBvnM2POy24Wtg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1708920654; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=rvhyjAiwlQEOUXkG8PutP7N6tyOOiAsq+qFf70c4lrE=; b=X+I8LGbcq6/p/PxqR0voZxXs1cKX+qcUQbH8Mzdb/6wsnJnUm+ISWXp0pvtWobhQPDb7wv 431+vqRyq2Pa4gqe6kSs1kLiCyS/K2aNfXer6WhS4wuXWm7tA+7uLgZnLlmdGs6fUYqbaz KhZZirNGwW1uHXEpKpdtcqhESEHyLls/ns0RsvdPOD+umnoqRQqMN5e6Sx0UMX/uMPCq9M i91e11vV0T9iiuxA9CDkU7a0dBbXUQZxkjeb6rTM4U1GlMdHRlPmz0Qu/x4DOZBNQ1XqPI aZ3dHIKfO7ltTDice8z1yMzPuxVH8EkAlQayBmHwwlB69qY8SaStImJhOJJdNg== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4TjnGj5MrTz1ByW for <ports@freebsd.org>; Mon, 26 Feb 2024 04:10:53 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 41Q4Ar4t095343 for <ports@freebsd.org>; Mon, 26 Feb 2024 04:10:53 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 41Q4ArWx095342; Mon, 26 Feb 2024 04:10:53 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202402260410.41Q4ArWx095342@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Mon, 26 Feb 2024 04:10:53 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ net-p2p/py-nicotine-plus | 3.2.9 | 3.3.2 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Mon Feb 26 05:24:29 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tjpvp22hbz5CQ2M for <freebsd-ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 05:24:38 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Received: from APC01-TYZ-obe.outbound.protection.outlook.com (mail-tyzapc01olkn2025.outbound.protection.outlook.com [40.92.107.25]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tjpvn5phVz4KFB for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 05:24:37 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Authentication-Results: mx1.freebsd.org; none ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=GQNekg6gxiY6LMs2/dFn9mLvvjwnf4yQpyI/q8WpPilTrDmGHEe4sfmWE30bWruy3BvX9dayRyEvUjKE66fEqQfIKSsSYsD/wW4K+E26MJdLq3qUJu3ej5XkytigVsAYFD1s8kGSmXARVdqOowtQkvG9Izica+bLBV/ghy3dw1leMyeYqCCtqwlKYrv4n1o0TR+mEvzR9BSa8hf7BUm1e9kA+78Rz7m8LkVE8ny0dVgkpFmnXe9Z19fzprw26DGzqU+Lch5SegpdNamQGTaJk+hWTlamvx3QD6/4kfbbg6WJX8XmxCPUb+6HvD35QttjXosMjiHh8yhgeU6Eb7O6Og== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=iKs81js2SU7EsAThcPxSZyJOEEPL2/3Up84yMA6kY1g=; b=aHf4kwk1vW/oqjInxspIFBdvgImkay0AF2L7WHM3bol/ez9MHkpQZlIFOh1u4O1x1X67kDQzBXJz50cj/XXG45LPo17bXFPwrYVqx3P9QSx5lNiZv2m7hUZp82bkmEiNj71yfSkjzKQp+QGgWmLt0DFIEqOmlfou2YBvsvHi6ZCdhPU3ZhGFKO7vL+ND/V2vlVAJbxR+zCZNKgX6CiUylOeiGTAJVE+rFQrVrrBnf6lM9nD4gmfyMp9jTW/xQ+Ud7LpXUIuS3al26Bxiw7G06CBfofsOj487JbZXGmsQGg59agIj/dm0yryJGp6AMjnnMxwDfuAmNzREzT+t7JNwSw== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=iKs81js2SU7EsAThcPxSZyJOEEPL2/3Up84yMA6kY1g=; b=cNSFxqZszcaMif72oNkgT3AZG4Dt+oh40+ekjLn1qXXWl4gkj8MOwnXko8cQTb8E8KbFRMLfogGBUqgc+bQIdXrb/Mp0jbwcVlJe/C5ItUYDA8KKplsxbjPcNV0QW/fyzi1oo0DNcieFBlFM3fp4agiPvJRbJp3bl5PccUoAka1yuFrtYxGH3j73ebzy2FBeoaDS+btjq23vuDbXaCbI7ifFjLhMcVx7h8hP/GhVeJqBCEF5VVcbw/HhZ2sr2GX7B8rDKLBAc5pmCI8kuYVJKoMX+1g1qwZySC/a7uTD35BTpKoL/DccWu3P+tGYE3nMmrPUYXCXSWmEOOf6FoOqHA== Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) by SI2PR01MB3978.apcprd01.prod.exchangelabs.com (2603:1096:4:103::8) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7316.34; Mon, 26 Feb 2024 05:24:33 +0000 Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef]) by SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef%6]) with mapi id 15.20.7316.023; Mon, 26 Feb 2024 05:24:33 +0000 Subject: Re: Scary update: devel/fstrm-0.6.1 -> fstrm-0.6.1_1 To: Michael Butler <imb@protected-networks.net>, freebsd-ports@freebsd.org, David Wolfskill <david@catwhisker.org> References: <Zdtpn_IGVIdJCJgS@albert.catwhisker.org> <8a579215-3209-459d-9118-e1f43bb17b41@protected-networks.net> From: Tatsuki Makino <tatsuki_makino@hotmail.com> Message-ID: <SI2PR01MB503661C849AF2FDC433E12DCFA5A2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Date: Mon, 26 Feb 2024 14:24:29 +0900 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 In-Reply-To: <8a579215-3209-459d-9118-e1f43bb17b41@protected-networks.net> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-TMN: [aQP79ToQOJdrkns/6mvssjEUUmxKo6Zg] X-ClientProxiedBy: TYWPR01CA0028.jpnprd01.prod.outlook.com (2603:1096:400:aa::15) To SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) X-Microsoft-Original-Message-ID: <c1f11514-cd06-518a-2f5b-4fe6dfa9936e@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: SI2PR01MB5036:EE_|SI2PR01MB3978:EE_ X-MS-Office365-Filtering-Correlation-Id: 5fc92302-f94b-460f-5e89-08dc368b36b7 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: QH2meODm6GNw8VEpokKKP7G8CvuP7WAtfGVH73WHiGQypxC5Gap3dpLfHDxiqEZ4GGeYX9HefadaNn9UmpzvX4hmTQLCyGqinmYX85Tc6F3Miw1xh7SVU1bdlFpu6+GGx3FWc1zYmpxdWYWlG9OYB3SU5EyU7bteYCh1BQTkHGSEdywDTfuHgWYoWkmIRo9I7RQ2L3n9hwqAXTkvy0RzK/CgUOLPDKHmNi8gpvBJXNRA9K/AnwdJq1EA73WLDdJcZmKljI0JnP5hJMD/Pqb1CGun5vE2922Lscrtt/GSzduo9gxbGmmNheJRl2Lnu8yg2F5fk3aYrVLSMscOQ/5B3ubVF1U/ocVwqc4UDYkJ4U8IsdXvIlaDaVuzFbcEtfXrvhNTaOXcwr1OlIF8+gHaxPx1PneFQsxgpVAMSWK25h+EPQP9WMWXN1A1/ifQALPLKuxXE0SgP1WQ/JqcbNLK1mBOo2kj+TAZ/uhlzB8y5S35cfG2FBtS4b2cFK8XG7g2raDRkt31pdi7pth8+cxLPjguIXC45AZecA+EIXpOLwwTyDCM/f/SktcPrFMriYMqw4A3bsYxGD3npFkbnQnye/gdEmFmd2RUyr7iNutDjfvvaUoI+mTlqxnbnuayTg5A X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?SzgrRm1TVmhBaGJTckQvMTlSMCt1eWZyQjlJSWhVWXM3L2tnVmRoNWlsUTlt?= =?utf-8?B?VWVSY1Y5V2k0OFlsRUV1NXRaSis1VXBRd2tsZkNrTlZQS3ozeGNNaDdJV0Nv?= =?utf-8?B?Z1hzeXRpc0p5Mmc1a2p5VWM5UGlLUTEvSUcybDY1VGpXL2l6Z29ub0swbEJ6?= =?utf-8?B?Y3M2Vlc0QXUyYVRkVW0yYlh5SVp5ZENtNGNjRThjdjc2KzBsdStjQW1IQ1hU?= =?utf-8?B?NDRUWUxTayt3UzZpbnNnVi92WWRxbGxmQ2U2ekdtOWZSYUltaVpvTXlYcUp2?= =?utf-8?B?SjVycXN0UUpabENTYktDMjRTQVNXemk1czFYblRXRndZTjZmZXQrVUo0a0xp?= =?utf-8?B?cm9Yb3Vvb1NBTmxTQW43TUl0eVkrandrL0FocUZQbHNjOUE5NTZkcHRiajV2?= =?utf-8?B?cTFHUHlkRDNZWk9obkNrOS93d3d6ZnBPVjhYOXdUY1dPa0JXdTlxZlY1VEJI?= =?utf-8?B?S2Fnd2IyU0hReDJITTY4ek82YXViQkorT0xtTkhkWVc2a0l3R2w1QkZVd1M3?= =?utf-8?B?TCtkTE95dm1oenl4N3R6YzREN3VFdUdvRkwrT2NXZm02YXR2SGxlYTJkTHZl?= =?utf-8?B?K2tvZDY1aitTTXRxR0ZBeHdMVjN2MVZFdTRGRytpOEJmYnJnbjVxZW8rdWlm?= =?utf-8?B?ZGdwS0F4RlBTS2VkdVA0T2hJT3FqWFhjakVVaFZZbzVtWUVxZjVxQUlNS2M3?= =?utf-8?B?Q09xcDdzN2o0LzZOZzVoRDlPYWx1WFpqaVFPWEpWM2RTL2RvNXFsbFBVaEhB?= =?utf-8?B?REVYWktwMFZkek1lVGpsQlUwUTZXSU5DLzF4eDF0NjFPUFY2YlUwQytuNXFu?= =?utf-8?B?dXhORVZaQUpYblZBZ0RJdjRQc0NkcWozVlZ3aGd5SUtYS2E2T0diVjBXNVh5?= =?utf-8?B?ejUxQ0FjRU9NVExENUhDejRlMUJEZG5SZnRxQzVmaUpyaTMyQ1VUNXpXYlhG?= =?utf-8?B?R21lSDJXQzZIVkJrZEUvQi9UZVNNdW1yVklxN2kvM2lDdHFxNlROVWo1Nmpv?= =?utf-8?B?aStyZFBMTFFteGIza2lOWmpSMzg5dzhNcWNBdmF4N29aRWRVcUdvc2hRZS9J?= =?utf-8?B?SEIrbEY3cGdXU3N6aUlFSHp4cnpYR1NUK0Z0N1dESkNCRGVMc3Z5YU5uMVR5?= =?utf-8?B?Vzlscy9jd1Bya1ozYkpqdnVISTYxMng0ZEthekZrREJkU295SzFzNEpPNWM4?= =?utf-8?B?aDZJYVNZb2FzN2VWSW1CZWxnVW5xeTJUcXl0QWg2NGgzTDFudy85eWIrVjN0?= =?utf-8?B?OVVrOXl1M2RNQTlrUmwvbmE2T0JDZHErTU1HUWZ3eHlscm1XdHowQTZ2VENx?= =?utf-8?B?bTExa3Fjb0d3d3ZsWm9pdFNtL0doVVlxajU0a0pVOFhlM0xLS21vR2p3LzVK?= =?utf-8?B?dkpZYWNKaDUyUUxiQStESmlpd2lzMTR0b0Y1WDVhQUJvZ2JCLzFoVm1ETk10?= =?utf-8?B?aHIweE1kNXh4OVdDV3VDNnFOb0RtaWZrVkY1YzUySGFsVitLOGFJV1JsdXNZ?= =?utf-8?B?bVZlS0ZOMzYzOFN5WU5lYWZzN003aUw5TVA0Q2xUaVFVTVNvRzY2L0VkU2ZS?= =?utf-8?B?N04vV1U4TG02d05nK0hxSko0RzRDREdlRTJlYm9Nc1NDL0Q5Yk5wZ3VzQy8z?= =?utf-8?B?SnZRVU5uQ2FjQjQvRTAzZnBpZkh1M3JVVWIvdndENklhbjdhaERkbmJKZ1g2?= =?utf-8?Q?8Po5z7kzQoI/uXdjf2dJ?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-d8e84.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: 5fc92302-f94b-460f-5e89-08dc368b36b7 X-MS-Exchange-CrossTenant-AuthSource: SI2PR01MB5036.apcprd01.prod.exchangelabs.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 26 Feb 2024 05:24:33.3094 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: SI2PR01MB3978 X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:8075, ipnet:40.80.0.0/12, country:US] X-Rspamd-Queue-Id: 4Tjpvn5phVz4KFB Hello. Michael Butler wrote on 2024/02/26 01:41: > On 2/25/24 11:23, David Wolfskill wrote: >> ld-elf.so.1: /usr/local/lib/libfstrm.so.0: version LIBFSTRM_0.2.0 required by /usr/local/lib/libdns-9.18.24.so not defined >> /usr/local/etc/rc.d/named: ERROR: named-checkconf for /usr/local/etc/namedb/named.conf failed >> My local mirror of the ports repo is at main-n652984-cb640dd9f467. > I had to force a rebuild/reinstall of bind918 after the fstrm upgrade. bind918 version should have been bumped to account for the dependency :-( In ${WRKSRC}/m4/ld-version-script.m4 of devel/fstrm, it is automatically detected and unstable. It may be possible to fix it by --enable-ld-version-script. Regards. From nobody Mon Feb 26 07:04:26 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tjs7D6flJz5CYd2 for <ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 07:04:40 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tjs7D4clZz4YdQ; Mon, 26 Feb 2024 07:04:40 +0000 (UTC) (envelope-from bofh@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1708931080; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=sCNA4kOkuPUdh4CDjTtaQAzy0pDyx1mint4w73CFf78=; b=j0SCd3EAxkIorRdHwDsj6zlDIskuK4vRmZMvxcWkM9yqir1eOe4w7Uq7d/HtaNZ5dLKJ3m Qyr75+s9atu7wqsK6EkTu0b4sMQKM2aNz0Q4J9UvH+FVw3iJSetCOqCn0BqicPUv6kuoWo h+jK8S693gMY2TxTqQDNfX97YVahXjxRAqS3yrmg0HKlZQDbjm+j0z7hSgzZ3ljQjlWPXO y5WvKZ5ZBKmxnUIM/AT6CM0zo5yw1L18q5EmJfR0pF2U2AqRjFRnsS5djJJra6MAnFAYxW R/IGb+0brd0DfMwlISvstw3UmjIn4Izxj43bwt26hV8F1Tu6tDLUEHtK7zmRLA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1708931080; a=rsa-sha256; cv=none; b=ols+xQWrsi3QCeed9RIaxBTeRJEWllz1gv+dbizHaGvDTK9ILP0F1Ev7R6q529EtFfJcUF GjWmKdS+vF4MmHgHQhhemShoSeCpvBOiS+WWohiHE50Y2lGSzBszfnlxplYK0DTLNfvEed E3+2cAn/xSO/fR+LJae8tjB59bpBxmDu0VJG4L94xTe/BnbkHmpfLHeE/S+T0RsIAtSl1r 6RvJchIYZSDgAv58trfovG7EmLxGw7JZT5/ksTfxsAawS1g6qBF+d7kEOyGen71Mi8w1aA 7804YFjhYyyHe9A3uPci7qEbfY/lHKNeLs9TQDrp0zA3JfN5UMVTpVwFc2CUlg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1708931080; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=sCNA4kOkuPUdh4CDjTtaQAzy0pDyx1mint4w73CFf78=; b=gTxUuGc+P/Bhh88qd1E+3wp5dKWzly01hD71sMf1WRqNJDiaCPW5fOW46+7WBA6pUlBvyL pV6SG18DhS2fJprcQRohTs1dxg89u1VvNNkJpORhhUlUamF+Af9gdKd8WhNA5ZorxRcY86 6rif9176CmVXcrDGlU5Og0TDvnkyCRqagi4GIsDi+bHZAzodwjMIK0eO3nHX00a6cajh4u Dld5fIg3WFfgYFUPvAOkkFHxF/U2dDqQugE0IzCUrFiOnoj1Q6vzzq1dlN34LKLHnTv9SR KMmxZG/BzbJWbEDuSA3jQNz9M2OYZ2ZP4kP9rBy4UkZNS0NioULPhIAUvD8t3Q== Received: from mx.bofh.network (mx.bofh.network [5.9.249.227]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: bofh/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4Tjs7D0vDhz12YZ; Mon, 26 Feb 2024 07:04:40 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtpclient.apple (<unknown> [217.117.226.147]) by mx.bofh.network (OpenSMTPD) with ESMTPSA id d8df81a7 (TLSv1.2:ECDHE-ECDSA-AES256-GCM-SHA384:256:NO); Mon, 26 Feb 2024 07:04:36 +0000 (UTC) Content-Type: multipart/signed; boundary="Apple-Mail=_7E0773C1-EBA2-4CB5-9520-2300DD180C57"; protocol="application/pgp-signature"; micalg=pgp-sha512 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.700.6.1.1\)) Subject: Re: Call for help: moving manpages to share/man From: Moin Rahman <bofh@freebsd.org> In-Reply-To: <CALH631nfXW+hQ+zm6Czm_Ag_pZEHuvHAr3ZJMFU0_0c8OV9vvg@mail.gmail.com> Date: Mon, 26 Feb 2024 08:04:26 +0100 Cc: Gleb Popov <arrowd@freebsd.org> Message-Id: <1B813C75-BE57-4A78-AB92-E63FA4B57CFE@freebsd.org> References: <CALH631=312+z8-1Gr32gZL_X3QduNCiMEyM3ZOwvqmAh6eRW7A@mail.gmail.com> <CALH631nfXW+hQ+zm6Czm_Ag_pZEHuvHAr3ZJMFU0_0c8OV9vvg@mail.gmail.com> To: "ports@FreeBSD.org" <ports@freebsd.org> X-Mailer: Apple Mail (2.3731.700.6.1.1) --Apple-Mail=_7E0773C1-EBA2-4CB5-9520-2300DD180C57 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 > On Feb 23, 2024, at 11:29 AM, Gleb Popov <arrowd@freebsd.org> wrote: >=20 > On Sun, Jan 21, 2024 at 1:19=E2=80=AFPM Gleb Popov = <arrowd@freebsd.org> wrote: >>=20 >> Ahoy there fellow porters! >>=20 >> portmgr@ is currently working on switching the directory into which >> man pages are installed from "${PREFIX}/man" to = "${PREFIX}/share/man". >> It is quite a tedious process, as you might imagine. >> ... >=20 > It's been a month since the initial call was made. Despite the fact > that the separate branch approach didn't really work out, the process > of moving manpages to share/man is still ongoing. I'd like to thank > everyone who sent me PRs and plain patches - they were all integrated > into the main branch and all were helpful for our cause. >=20 > Still, there is a lot more to process, so I'm making another call for > help, hopefully more concrete this time. > moin@ created a list of problematic ports [1] along with MAINTAINER > field, so you can quickly find if any of your ports need fixing. In > this list "failed" ports are confirmed to be broken if we change the > default mandir prefix in the framework. The "skipped" ports may > probably be dependent on the "failed" ones, so it is better to deal > with "failed" first. >=20 > We have an established ways to fix Autotools and CMake-based ports: > - Autotools ports are generally identified by the presence of > GNU_CONFIGURE=3Dyes knob. To fix such a port one should add > GNU_CONFIGURE_MANPREFIX=3D${PREFIX}/share knob and fix pkg-plist. > - CMake already defaults to a correct mandir location, so CMake ports > usually have some patching that replaces share/man with man. To fix > such ports it is sufficient to remove that patching and then again fix > the plist. >=20 > We don't yet care of Meson ports (although it also should be as simple > as the Autotools case). Feel free to skip them for now. >=20 > Finally, there are ports with homegrown ad-hoc build systems. There is > no general way to fix them. >=20 > When making a mandir-converting change remember to put "Approved by: > portmgr (blanket)" tag into the commit message. This also means that > if you're fixing someone else's port, you don't need to wait for a > maintainer timeout (although it might be still a good idea to wait for > the feedback if the port in question is complex or the change itself > is big). >=20 > Thanks in advance to everyone who will help us in this quest. >=20 > [1] = https://people.freebsd.org/~bofh/dropzone/manprefix-fail.maintainer.txt >=20 Some of you reached me mentioning that their ports are mentioned in skipped list and those ports don't have any man pages at all. Sorry for the confusion. But let me iterate on how I am fixing things. I started with a fresh ports tree with share/man as the only place for manpages. And while others are fixing the tree and committing my build system is just taking the last failed and skipped list to build and check the next set of remaining ports. So there might be some ports which are false positives. If that is the case please send me a mail with your ports which do not have any man pages at all so that I can manually remove that. And sorry for the spams. But we are very close to what we planned to achieve. Kind regards, Moin --Apple-Mail=_7E0773C1-EBA2-4CB5-9520-2300DD180C57 Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=signature.asc Content-Type: application/pgp-signature; name=signature.asc Content-Description: Message signed with OpenPGP -----BEGIN PGP SIGNATURE----- iQKTBAEBCgB9FiEETfdREoUGjQZKBS+fvbm1phfAvJEFAmXcN/pfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldDRE Rjc1MTEyODUwNjhEMDY0QTA1MkY5RkJEQjlCNUE2MTdDMEJDOTEACgkQvbm1phfA vJG8+g/9G/HvLGnzGTwPUIsYG7fBKh3K50fuzuNKnCCtFZtGgGkd3QRXZnYVoHZx dwsNavfB3VN7SEHsm5VqGpzV6oavL0PQ71kfBSDUApGzvlaPiWXGbsWHu7soRVbP msVUjSuru/uuAJojXdsbG4S9iTBOlHpkvB8zcyrVPlWebcHiTBHsVJEey8yL4z63 6l2A7jtdw1Z3BevEK3uhHtYcidenTUspih2F61xjiil3KnJ/656XzUrwZne3rJ4Z f6WB4XJ2IdsctNRpFJXUI2uuH3tajc/Qx6oVnpMWD+Z5zCgaWtPoJuQTP/qwmfL+ Gm4ovAVw/PqnhgFmxgA3jNKl2RhPEOlLaswXH/8ZcyPoAfDAioCM04GGLje3OOcT t+76891ZnCtHynId1BPHLX4UMM95a5qiSWZiyZrn6N+Tphg3m9qyeQFUt0I9/1c0 YZhZhVNqOJFNbdGFpyM09BEvfyFtNi3GGQkV2i/e0px8oK1k1zJdfgQDNagUoB7Y AjhyMblIR9YUZl/0JfF/BNp4VcRk+/6lMDwyjm4M4hCHZcTAqwi3ePfAcO0ig8WG 9LaJtjCo6CZij1uPusiakrWlvbMslR9z4pTER77r1yCCW8mFBxrQi/Sa5dtgkcgC l8w3akksCtsKldVhngGqVE7j6I41qVvit9B3qRGBmKpWpGk0dAA= =b1Z0 -----END PGP SIGNATURE----- --Apple-Mail=_7E0773C1-EBA2-4CB5-9520-2300DD180C57-- From nobody Mon Feb 26 09:06:41 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TjvrN3lBBz5Cknb for <freebsd-ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 09:07:00 +0000 (UTC) (envelope-from trashcan@ellael.org) Received: from mx2.enfer-du-nord.net (mx2.enfer-du-nord.net [IPv6:2001:41d0:701:1000::435d]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4TjvrN0tTNz4pgj for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 09:07:00 +0000 (UTC) (envelope-from trashcan@ellael.org) Authentication-Results: mx1.freebsd.org; none Received: from smtpclient.apple (p200300fB4F137701f06F7d4484029d64.dip0.t-ipconnect.de [IPv6:2003:fb:4f13:7701:f06f:7d44:8402:9d64]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mx2.enfer-du-nord.net (Postfix) with ESMTPSA id 4TjvrG4dJ3z1Rgf; Mon, 26 Feb 2024 10:06:54 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=ellael.org; s=dkim; t=1708938414; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=Klv4xXfivuxCXOumPkw/fd/+o6PPGaSKpF4t94NReU0=; b=TOMRNd1YzedGuSthriorUy3vvL9ruTrEfIpdNs+kI1qoZCzjR9rngXGO13m/7RW5w2YfM8 Jsn7niFsqIdP2KSQyTKNEYJeJoYvLkpN/RpSVubJtHPcgmxG0E4k+XKUuqrv+UsZBcuxyN 5V42TVJUg8RblhNQE/oAOPN4FZC8gbo7lNLo+4lx51sQeBNVJJeEcFbxuIF11VM7rFIab+ M9fVo/LppuMEFZPflprGtQVGX8CBeeGnKMhXmHD5Wuasb1CiomXihCVnbLYwSneefDhv8Z J/5WB3JtpL+holtovnIutQ7Fcr/6kmqe7y1AsjVPP8oz/4WnI62VcVR/S+9odg== Content-Type: text/plain; charset=utf-8 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.400.31\)) Subject: Re: dns/knot3 and dns/knot-resolver do not get along with From: Michael Grimm <trashcan@ellael.org> In-Reply-To: <79302DD2-2673-4745-82B3-06BEEC907DAE@yahoo.com> Date: Mon, 26 Feb 2024 10:06:41 +0100 Cc: FreeBSD Mailing List <freebsd-ports@freebsd.org> Content-Transfer-Encoding: quoted-printable Message-Id: <6C622E06-4CFC-4296-B0C8-6279F6BD3FDB@ellael.org> References: <79302DD2-2673-4745-82B3-06BEEC907DAE.ref@yahoo.com> <79302DD2-2673-4745-82B3-06BEEC907DAE@yahoo.com> To: Mark Millard <marklmi@yahoo.com> X-Mailer: Apple Mail (2.3774.400.31) X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16276, ipnet:2001:41d0::/32, country:FR] X-Rspamd-Queue-Id: 4TjvrN0tTNz4pgj Mark Millard <marklmi@yahoo.com> wrote: > Michael Grimm <trashcan_at_ellael.org> wrote on > Date: Sun, 25 Feb 2024 19:46:22 UTC : >> I am trying to install dns/knot3 and dns/knot-resolver = simultaneously. >>=20 >> Compilation is achieved with the help of poudriere which complains = about dns/knot-resolver: >>=20 >> =3D=3D=3D> Installing existing package = /packages/All/knot-resolver-5.7.0_2.pkg >> [stable-default-job-02] Installing knot-resolver-5.7.0_2... >> [stable-default-job-02] `-- Installing knot3-lib-3.3.3_1... >> pkg-static: knot3-lib-3.3.3_1 conflicts with knot3-3.3.3_1 (installs = files into the same place). Problematic file: = /usr/local/include/knot/module.h >>=20 >> Failed to install the following 1 package(s): = /packages/All/knot-resolver-5.7.0_2.pkg >> *** Error code 1 >>=20 >> Stop. [=E2=80=A6] >> One needs to know, that there is a third port involved, namely = dns/knot3-lib, dependent for dns/knot-resolver. And, dns/knot3-lib is = simply a part of dns/knot3. >>=20 >> Thus, knot3-lib-3.3.3_1 as part of dns/knot3 shouldn't conflict with = dns/knot3. >>=20 >>=20 >> Questions: >>=20 >> #) Bug? >> #) How to resolve this conflict? >> #) Anyone running both ports in parallel? >=20 > If I understand right, if 2 more more installers should be allowed > to be used in the same context in overlapping it-is-installed > time frames, they must not conflict in what they install: no files > with the same paths. > Expected conflicts can be noted in the Makefiles to get earlier > notifications of the attempt to use conflicting material. But > having such conflicts means mutual exclusion as far as being > installed in overlapping time frames goes. > I'm not sure how your notes fit with the overlapping time frames > issue: is it valid to have knot3-?.?.? and knot3-lib-?.?.? > installed in overlapping time frames? FYI: I do not understand what you mean by 'overlapping time frames' Ok, there are 3 ports involved: 1) authoritative dns: dns/knot3 2) library part of dns/knot3: dns/knot3-lib 3) recursive dns: dns/knot-resolver 2) is needed by 3),=20 thus compiling 3) pulls all libraries and includes from 1), and stores them in the very same locations as 1) will. Thats, if I am not mistaken, the reason for pkg complaining 'pkg-static: = knot3-lib-3.3.3_1 conflicts with knot3-3.3.3_1 (installs files into the = same place).' Thus, IMHO, both ports dns/knot3 and dns/knot-resolver cannot be = installed simultaneously. One could install them in different jails, but = that is not an option for me. Possible solutions: 1) dns/knot3-lib should store its libraries and includes into a = different location as dns/knot3 does 2) discard dns/knot3-lib and make dns/knot3 and dns/knot-resolver = mutually dependent 3) =E2=80=A6? I am not an expert in ports internals, thus: what would the best way to = solve this issue? Thanks and regards, Michael From nobody Mon Feb 26 10:43:36 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tjy083FB4z5CsRZ for <freebsd-ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 10:43:52 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic316-8.consmr.mail.gq1.yahoo.com (sonic316-8.consmr.mail.gq1.yahoo.com [98.137.69.32]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tjy080h43z51Ly for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 10:43:52 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1708944228; bh=g8llxDQ/nRPA2Vs9ahrGZweqk3ChhkQneyx6fjZOclM=; h=Subject:From:In-Reply-To:Date:Cc:References:To:From:Subject:Reply-To; b=tUDSuPgcqRcTwo0iUklQ+H4bTt+stVfWNPPOwBt20xqztUe/v88ydOwlwfokHfO/RzM71TjdA2pI3tx9ryTphUqgzer9enzyrCQ8jWJ6t93mIs+WWfOlxPthWf5L1aenJ7VwZ0Sbh3/z0tSLm+tDbebLpDW7SFZWJU8tpxieYCndJx9GjE65q8K6h7yZU7gcAfaowXIiq6K6OOVDHfBtZRYJf/lUQIDsii4oofWtToyOOE16BCvgHXgMTyNCRoLw5cJi6OQKePSv0A/epOD+FrOrd3wMSPgBcSgw2jZTL3x5wKN3l9ZvFU/zzB7tfB5f6R8yR+BxzSe7NCIMQh2Qlw== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1708944228; bh=x2RE9WxItX37P0vxgHDyzAQE+v/9/RsB6vykLlgSFHg=; h=X-Sonic-MF:Subject:From:Date:To:From:Subject; b=YHOK30ItcSx+8gT8hXjZAafZOkT4ROcLWuU4pF3+Bf6HmnJn/7eLu48ERoqD2MqS8Dj+GWH/51SuXf9VyEqzlJsRWHa6KV6GlFIuK44PZaruu7G+YaqyxPabcUuLfCi3z3LXDdiYvuZlU6+Tu+rQ9dUkDrER1zgH2ypvDQHLxvK9wTc2LFhmk02DxB/oZLyYF7FNXLOOrJEa+21xFEsunYMbXErbWPKqt3QzbgG9pzqg1V7wXHPR9/+h/tyluPBKapWUKiYWgwjZvIuo6erxh1kg5YiDeX5w+vwe3BZYZZIlOEGTg2zK6TEeStgBpKA3b8YTN3N/1Wxwf0E12QLa6w== X-YMail-OSG: Dm_2YrwVM1mF9NpYkcAGXsSzVTTSh2CVPnMusSJgNEmUX4FDOZIXkxOezJLNyom puCycqQTttcwKamfC9R5eiCS.TmvsnjF4Wre3PJpRbvB4ffMMkRjkL7q0i_n4zUVYSjNPngllAQd g828Eyo5q698qZa8CYtwtwzld619cLBBQkcUePYfyke8Nb3H3GduxDDBSBqJ51n96ch3BPJkI_uM XpHM2R8ZC51qCckYAsL525Mv0u7K7YTI5Ng5stWaKZCocm4Wjb5fBCe3mH6ifgwyLGxpugfqwFDe TCq0asroVBM85Um4OWt8f5CsAMvhjt4GPkNXQzR7HoIJJVQe7UGaPn_68Jx7letvs93zV8LDh6uB Ri.DntSocKASEazWs0pGj9Ffzu5ZVGsViwBPghCCuFoypuozcipLBB0F8CqZvlSPUsry.WHfS7q2 48c1THpmpraVT.GHDhQxcKcOE0Dx.Xyp3cfpOFDV_nftkSRSqD3zmRKfPVhESkDEtGWyhgpnD0F3 J22SwhSq24vSiA5g1yKBfJqI1hoDiNoGGqCWH343tBN31CQEKTi.PktUVg4bhlS3pzfdAfNEKsoC ZxMocp5pskiKsjCeKSBuCkA3oxbUfdORni45U37hRDiajMlNnIU7kiDq4dUWNSm0slfVp9B4kvPS sIIW8DESq0yAB5zhCJq2i5NEn_71U5Aaprn3hHCJsuUZosZabOP.xYfe9NF3tq8o_My8JOGoQW68 PkB.d6zk6DrZTglK7hk6Sl1jkGHvfnH1fNDAP2rRig60Hyb_8nFRcQvYsM2RzS9.Xnnog0r3zo6I 6ECAdonDmsOgpAIqt6RuILVBsga6V29WfluS23nu6ynU2IhOONO8x5bjNSoHo8WhX.hjZP5t.w2F X_v9ktLCpsN_ghSJ71TAPJHQoFLcqPjV2URGAx3DwZ7BFjiNCw.90hpzzgs80iNHyN3dyineKxxs Xus1azB9Z51PPULS4s9aUbxmlMLYYUkf1Aeuii9kZ7PgMsYv04nmnEX7WOrJqDaJuLUjEZyKU6jj xF0xoXNdXws5.GWhd7wTB3t8AxAlstiqIsh7At9rcuur3ZVllHtn0km0IWycw_1aK9RQ5jeXGoDb DL0dPkiuZdXrsKRAIK4Ru1EzbnzhHp3QU4f_IElSlfNpdS0ONB7KZtREc454DFIPaHM1kG9K.14d gNbIOj_L2gQQMZc0l5dK4nsBAU6ms.aLUWTT6MF9nW0KwYBQQbtetMp6jWs3SSuOedW_96aakHYD 2FrLQuMhVGT5pBi51OoJuPo4O3Pp.Z3bVi74ZiqRSl.OE3ZISC5Cu0Osb1w5VzD7oYLwtdeeef5v OFR.i0SfFIddY2foU5AMvtrEV8mmpQX867Jmm1k7DJiFHJuhu.Zc6vjt3kqWXYnpOFwGHoSkdhYf U0SQhmrJ.6vput9TCQJ5_6aAoJpwsRwOGut2pX_FoqRJkiCw9dFbPaNESKFHz5iuTikDUrqtbide WyVO9nhiVJpikB7uXIITZarxri6zxGjazou_4gGwh.7xWUVerEu9jeoHdVXascQktvUztk6PrguM hj6YJBBhsYaSpZCHH8qEk5SZXOWLhwcnECePdk8KB2lPUl.br5cF7PN8BqoNnnsqMnOtDrT4M.Wk 8KMXFPoPyEtRcwqLZalN_makYaiwJuftzJ1UHkbpItBrE8r8j_xB3g8KfTXMSgJDn6U77HqrRvxo AlWkKGVBELYJyFfgBwWp_3nUTeCHdTIfdNjsUp23ZwxJuS5j7J1d9bpt3aIi9tMYjtZMV8x38oZW r1lp.FOCHam1B0MeX0hARqRzF9pL2U7PgON0E4gOUyJA39P4MThxWjYRQMQfL0HRLOLRNdCdb5ml io5E_beI9UuZioqtNEauOSaDeRvYbizGufUntUEwDju3IjShRtOX8ke6oTjqvxyMcrZzeb8HQnhG .NWs5_wVNCCPl7ORhs2tFIuftp5bkVhSmMrqP2gN0grji8Xn_QedhvaxFqy7YSyrc3rlDrj539Po qCVQgVbcGrRhrjr6B5W57DDMQ3nONud_f27FogGvDfwO9C_smaWATQ2b_D5Oq3lddw1BmS5uzB_r ekOyY47vOT17BpksBPAureR4LR66JwyNuBIDuWdu56wFiSaqNqrkZ.lG9GaAMwPqiOClD1QObFFl QLCZq5O_cUtQpkLNyQjgcGaajYJAchn_zOGoBELX9W5ia9vjrjbnZ.z1xbkBJXl3hIXlfyqI1oKl ObNjf4xfowNWASG1GaUsYwPTTQW8m_nyWum4WCfzLdz98Tp_TIKYLWxWdGMai6pWssE5svA0sTuq X X-Sonic-MF: <marklmi@yahoo.com> X-Sonic-ID: f04c2f9c-1422-45d6-b383-4e304b935f9e Received: from sonic.gate.mail.ne1.yahoo.com by sonic316.consmr.mail.gq1.yahoo.com with HTTP; Mon, 26 Feb 2024 10:43:48 +0000 Received: by hermes--production-gq1-5c57879fdf-kht2b (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID fe607b36e352579452d3080df18fb499; Mon, 26 Feb 2024 10:43:47 +0000 (UTC) Content-Type: text/plain; charset=utf-8 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.400.31\)) Subject: Re: dns/knot3 and dns/knot-resolver do not get along with From: Mark Millard <marklmi@yahoo.com> In-Reply-To: <6C622E06-4CFC-4296-B0C8-6279F6BD3FDB@ellael.org> Date: Mon, 26 Feb 2024 02:43:36 -0800 Cc: FreeBSD Mailing List <freebsd-ports@freebsd.org> Content-Transfer-Encoding: quoted-printable Message-Id: <6F77C083-4AC6-4592-88C3-626D138B10D0@yahoo.com> References: <79302DD2-2673-4745-82B3-06BEEC907DAE.ref@yahoo.com> <79302DD2-2673-4745-82B3-06BEEC907DAE@yahoo.com> <6C622E06-4CFC-4296-B0C8-6279F6BD3FDB@ellael.org> To: Michael Grimm <trashcan@ellael.org> X-Mailer: Apple Mail (2.3774.400.31) X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Queue-Id: 4Tjy080h43z51Ly On Feb 26, 2024, at 01:06, Michael Grimm <trashcan@ellael.org> wrote: > Mark Millard <marklmi@yahoo.com> wrote: >> Michael Grimm <trashcan_at_ellael.org> wrote on >> Date: Sun, 25 Feb 2024 19:46:22 UTC : >=20 >>> I am trying to install dns/knot3 and dns/knot-resolver = simultaneously. >>>=20 >>> Compilation is achieved with the help of poudriere which complains = about dns/knot-resolver: >>>=20 >>> =3D=3D=3D> Installing existing package = /packages/All/knot-resolver-5.7.0_2.pkg >>> [stable-default-job-02] Installing knot-resolver-5.7.0_2... >>> [stable-default-job-02] `-- Installing knot3-lib-3.3.3_1... >>> pkg-static: knot3-lib-3.3.3_1 conflicts with knot3-3.3.3_1 (installs = files into the same place). Problematic file: = /usr/local/include/knot/module.h >>>=20 >>> Failed to install the following 1 package(s): = /packages/All/knot-resolver-5.7.0_2.pkg >>> *** Error code 1 >>>=20 >>> Stop. >=20 > [=E2=80=A6] >=20 >>> One needs to know, that there is a third port involved, namely = dns/knot3-lib, dependent for dns/knot-resolver. And, dns/knot3-lib is = simply a part of dns/knot3. >>>=20 >>> Thus, knot3-lib-3.3.3_1 as part of dns/knot3 shouldn't conflict with = dns/knot3. >>>=20 >>>=20 >>> Questions: >>>=20 >>> #) Bug? >>> #) How to resolve this conflict? >>> #) Anyone running both ports in parallel? >>=20 >> If I understand right, if 2 more more installers should be allowed >> to be used in the same context in overlapping it-is-installed >> time frames, they must not conflict in what they install: no files >> with the same paths. >=20 >> Expected conflicts can be noted in the Makefiles to get earlier >> notifications of the attempt to use conflicting material. But >> having such conflicts means mutual exclusion as far as being >> installed in overlapping time frames goes. >=20 >> I'm not sure how your notes fit with the overlapping time frames >> issue: is it valid to have knot3-?.?.? and knot3-lib-?.?.? >> installed in overlapping time frames? >=20 > FYI: I do not understand what you mean by 'overlapping time frames' A time interval over which both dns/knot3 and dns/knot3-lib are in the installed state in the context. You have answered yes below. > Ok, there are 3 ports involved: >=20 > 1) authoritative dns: dns/knot3 > 2) library part of dns/knot3: dns/knot3-lib > 3) recursive dns: dns/knot-resolver >=20 > 2) is needed by 3),=20 > thus compiling 3) pulls all libraries and includes from 1), > and stores them in the very same locations as 1) will. >=20 > Thats, if I am not mistaken, the reason for pkg complaining = 'pkg-static: knot3-lib-3.3.3_1 conflicts with knot3-3.3.3_1 (installs = files into the same place).' >=20 > Thus, IMHO, both ports dns/knot3 and dns/knot-resolver cannot be = installed simultaneously. One could install them in different jails, but = that is not an option for me. >=20 > Possible solutions: >=20 > 1) dns/knot3-lib should store its libraries and includes into a = different location as dns/knot3 does A variation of that is that dns/knot-resolver has its own files in its own locations for such, no dns/knot3-lib port involved. > 2) discard dns/knot3-lib and make dns/knot3 and dns/knot-resolver = mutually dependent > 3) =E2=80=A6? "..." might be: dns/knot3 uses the files from dns/knot3-lib instead of installing its own and so has both a build dependency on dns/knot3-lib and a run-time dependency on dns/knot3-lib . dns/knot-resolver also then has such ( and no dependency on dns/knot3 ). The run-time = dependency leads to installation of either dns/knot3 or dns/knot-resolver first installing dns/knot3-lib if it is not already installed. Uninstalling dns/knot3-lib would lead to both dns/knot3 or dns/knot-resolver being uninstalled if both were installed. The build time dependencies lead to dns/knot3-lib being built first and being installed before builds of either dns/knot3 or dns/knot-resolver if dns/knot3-lib is not already installed. (In poudriere such build time install of dns/knot3-lib is temporary and internal to the build activity.) This allows both dns/knot3 and dns/knot-resolver to be installed in the same jail "simultaneously". (It does not matter which is installed first vs. second in the sequence of installs.) I do not know which way is simpler to support. That likely is dependent on details I'm ignorant of. All look to be technically possible. > I am not an expert in ports internals, thus: what would the best way = to solve this issue? >=20 =3D=3D=3D Mark Millard marklmi at yahoo.com From nobody Mon Feb 26 23:48:11 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkHPN3tsSz5Bwnq for <freebsd-ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 23:48:24 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Received: from APC01-PSA-obe.outbound.protection.outlook.com (mail-psaapc01acsn20805.outbound.protection.outlook.com [IPv6:2a01:111:f400:feae::805]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkHPM3F8Jz4ZjR for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 23:48:23 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=HiVYrVgK; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of tatsuki_makino@hotmail.com designates 2a01:111:f400:feae::805 as permitted sender) smtp.mailfrom=tatsuki_makino@hotmail.com; arc=pass ("microsoft.com:s=arcselector9901:i=1") ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=L+VhTLBdhcGGoYs2AG075tkaLgEbG491ecVZ1Dw2KMR8ZZhTcYjfKiSQyW9T/ob8Ee+Uss44CpCnzTqKrNlBZfK8CGjqcpCyeGZSj0EaLordwebCxIdeihmPUuzXgl4AMLp/fBPMsqPKqVXN/pEyeuK/4pHC3H+YwwVqVnMjAE/giGtiOgxf1oU++LGutUbI7eLaV5vvRy6KMtvukG1oPGGD4aAfawiS92ob5q4RNPNWN5e4JJBeCAVp4yIJIdEweych3zBO0hOsVGekdU0vKdSHA5u7xGPo7xpDFnubeeyMtHci9NYlaTlgBuiFnhqSuvhIvsfeVwArtSw6we7YQg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=NLKBTDDh5SXEK9GrOMc3UhDa8Z+aHjSep0fnpAS/Ook=; b=S2BtSUomw9StRJOBcpVrecm2jGlo80d4vz07eXIN9qcnCr66gS4T124tS7U3I32AFQRwJeHS/AzE9smVT0s4ASaoJHtVh08Mo6ciT3g6jT6p3BDJOGYo7/KvnFwZ/iMaA1pshqvdgSeGebNTjFikrvETQyHI6+Yd5VyLunrjdZZuJOOtzRoB6ZKQSP47+t66xk0lHlXHkjEYmLcmGRbl1BOf+Gb3SuhWKsEmTGmmQwoMLfBHlxIHWkpmev/kKS/9cqwGMJhHEYIc55t1ZKaEpwgq+8mZRHJZYhj7TNWCOHHVEOmWSauJvekYAxbb5aJJ4CJ6urs0SeF8aBBLfq2jyg== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=NLKBTDDh5SXEK9GrOMc3UhDa8Z+aHjSep0fnpAS/Ook=; b=HiVYrVgKSxJDj73myF1MGkEOgIM+yXvtpq6qrjMNVl0r1qcnYHTtxqBv4KhH0IDR1aDFtsQ2LubfK6mi8IIY7+nwe2aGbUwKkJ8cEMqG3/mreCjsX+Bc0AQiROiMm8fsWA6waDBkwwOvI1fARfZDtOVPkC5atw0b2KpdC+xk6nXNp7elVnwp2UjsU075Cp4Pa6jNsLLxaKXP6/f0ROKHI3dYtNpHgjsbyVYWqIFvnJq+P5rO9537bT6ryputjSo389l2eDTe3cXR/dGF2VjTb4yPIM6Bg2h68hKetMNWV2SzXl44/WQiP8xZNB7lK2FiyrRsjQP4KapsyrlpYHfMRg== Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) by SEYPR01MB4509.apcprd01.prod.exchangelabs.com (2603:1096:101:88::12) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7316.24; Mon, 26 Feb 2024 23:48:16 +0000 Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef]) by SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef%6]) with mapi id 15.20.7316.023; Mon, 26 Feb 2024 23:48:15 +0000 Subject: Re: Subpackages: Update From: Tatsuki Makino <tatsuki_makino@hotmail.com> To: FreeBSD Ports mailing list <freebsd-ports@freebsd.org> References: <CAB88xy8o_d99cndg+nTi9fK6XfS+ym=Njor4+cVAkTqV49tfhQ@mail.gmail.com> <SI2PR01MB5036E49A846567CDCBB89E6FFA572@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> <SI2PR01MB503602F416BF36D2C622482DFA552@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Message-ID: <SI2PR01MB50367F214A4BDE2EEC97B77CFA5A2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Date: Tue, 27 Feb 2024 08:48:11 +0900 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 In-Reply-To: <SI2PR01MB503602F416BF36D2C622482DFA552@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-TMN: [QowYLvUAIF90cjYzuFElkgUdL8W/B/sE] X-ClientProxiedBy: TYCPR01CA0207.jpnprd01.prod.outlook.com (2603:1096:405:7a::8) To SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) X-Microsoft-Original-Message-ID: <fd14d65e-7bac-5011-6f94-730ebd8cf51f@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: SI2PR01MB5036:EE_|SEYPR01MB4509:EE_ X-MS-Office365-Filtering-Correlation-Id: d0985656-0306-4ef1-68cd-08dc3725660f X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: 7FXZUrmN3WPazHHUe1i16kP2DLI0Dhll4/K61lWu1YaDBFxlv9rAN2hudNdyP18tIr3lK+ksH/UF+s3UfIP5BJKff3Eetl7F+1ADxyO5RiBT2yIPng5aOaDomHqwBwdh5g9ekV0MhRc2k1bjU2GRHCXSgAFwWzwmgZRi0JwGpBF7gdnk+442MsnOK9axaDwP1b+oxaICevheXqmfteDDUvoHJ1iZMfpF/G3FQI+4apL+hrJESu3vmrZZx2hF20DNkNYORmP7AWDmpGKkckqitWgM094hXxuftjhBmfBZRGeY99aSEkLOExO1uuUEdkb8GfWniG0VZk5FyJv72vLDBfU7eQi4tccjDe3OAotLaEhvS6n2wyPQJtsVH+I2RHusJVxTwWy00X/yhiPzwIw/vVPh0l7ezynjYdxugdMMvfEBtbo4yfdyQn77cgUmyTnK3UbJPDcRkemvkLjWxzAM7TXsF3+KHP7721v9h+G1T4qcAp+TMFDMuNwqGeLU8+fw2iaduwmtUgYQUKCZZGfDDta4i/x5cxK71MCy49fDs9UfwGtbk4jruVZmEEJM/biuOSoDM8oc4xTvQLSiAV/9A/ERfWoOxr/7UqL5OhfmDPaaWpDJ28/AQhbUObHG6T04 X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?Y1c2QVhEOW43VG13cy9NbDNTSGFYKzRJM25maXA4RjVjeFNRMlA5RmZ3azlr?= =?utf-8?B?cU1BTXFyejh3VUNuVENVOW1HaDNod2FEblB5eTJmVHNjZU40b2h3bDg0T3NI?= =?utf-8?B?STRNMXBQQlZMN2pucCtXTGdiaW8rV3pDR3dvUXBvZnNIQlBrKzAyOWVISzB6?= =?utf-8?B?RythYXpmQ1pYS0ZIQkJPbEdpUDQxZEpMNzNZOFhhOENqMFVKYzNOcE9hMTFT?= =?utf-8?B?QUFHMFRJQ3lyUFBOYlN3WVp4RGNLMnJ2WVl3eHZVZ0pjaHk2RHdsSTdiZW9y?= =?utf-8?B?ZGRDbVJhZ2RuQXdvR2xaUVBUdFFBTEtxckVzVWovUkxYdkozSk4wdWtYazdH?= =?utf-8?B?YUNFMEQwM3VUcitvelE2V2xOYkVlenJSc2l4TzdUaTlxb0I3OVl6aFV0RlNr?= =?utf-8?B?aTE5YkNIYjljdVRVRjBDbGV0NXBoTWsybFowRDZoSVVXMjJBdlA4K0dBbjNq?= =?utf-8?B?SldYY2pxdWhaT3RYQjU3QjI3U1VDOWZIVklVWWpOSzN6cy91ZnJyckp3NXZF?= =?utf-8?B?VVhHZWlIenhnbzRlSXZ2SkhVVzc0cVR5WC8yTjFFT05FZ0tRSWpVMEZzaDVz?= =?utf-8?B?eDc5eGd1b2FYZytTdjhHYmV0eDJKaUhNcVcrWlg3SEM1dUJHdmF0RCtnVUtJ?= =?utf-8?B?ZFJxNHlVeVlTc2xXNWhrVkxsZXNnYnFLdzV6djRNclJ5SlhYWVJTU3U2WDk4?= =?utf-8?B?bDBCMVhaTmRXbkVVM3lCWGowUDVYSzVWQ1VIWlhOOGxsNnY3T2wrc0xmS3g5?= =?utf-8?B?akp4NGlPZERzMXNVd1NFUm1RVjV1dEc3OHpEZ2FQem9kNlVSRk1SbDViMTdE?= =?utf-8?B?dm1LZ2dxSTN1ejJnM0orRWdXNFkwVEFDbXoyUlIxVTVaa0FqZFBZbENrVFc4?= =?utf-8?B?N1FTVG9mZG9FVE1RN0ZNbE1SWDRMa0twSmJVcDRRNllTQ1lJcVZkRUZrTTgz?= =?utf-8?B?SkRURU8rMHI0c29Vd21hTmVERGs4SWJ0cTdOaVFQazhXQmJmdWh3WVJzZkp5?= =?utf-8?B?SHU3YWF4YlZxWkREb0t6b3dZOUhrRWxUaGpmTEZZYUQ0QUtVOHBnQ2d6NXlo?= =?utf-8?B?b3NxUys5NHRBM2hIM1Btb2VqVzl6Sllvek9kckZOSmVVOG55VkRnQkNJcEJa?= =?utf-8?B?bm1rQmliWU1aUFR1UGFKR2d4VVBxMlA1MWJOUDl5OXZTRExseXFDbEU2RXBF?= =?utf-8?B?MGxQaHF4emRzSHdZR1ZIM2x3MTc2Wmc5aWVjZmltdS9xdXgrVjhiY3JRdkIr?= =?utf-8?B?QThZd0VURXBPS05zMmNYNzlZYW1YUGFrRFh1ODN1M3lodkgzVEQwOFFtdS95?= =?utf-8?B?TlJ6VnVEWlF4NmZlR0ltRWwxa2ZQSVFZU2dpajJwamo1bFNVK1JGOCs3S3pz?= =?utf-8?B?L0N6dW1YSWdUSXA4MmlEVm1jTmxkTC8xeGVKSlpvNG93MXdMY3d4MHZVcFIx?= =?utf-8?B?aFFCbldnVEQ1QjRrcFZuY1hZMDl4aWhTcEV6WXlRaG0yUlQ3N0UweTRYYVF2?= =?utf-8?B?eldReTN2RUVDVzRGb2trVHh4cmZTaDBJNG1WdGYrSGxjRXkvVEtxZXU5Y2RP?= =?utf-8?B?UEhJT0ExSVlFMUJmcGF0RVNjQTlTYVVuRU55eDdCZGdmZVEwWjRHR3E5eXBk?= =?utf-8?B?b1JtVHVqUHpyMThWUmFxRzFod0RzS3Q5THJIZHFtM001VUYxNDdjN1Avd25I?= =?utf-8?Q?R8a6kynYSRJZ/BQDCVAd?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-d8e84.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: d0985656-0306-4ef1-68cd-08dc3725660f X-MS-Exchange-CrossTenant-AuthSource: SI2PR01MB5036.apcprd01.prod.exchangelabs.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 26 Feb 2024 23:48:15.0970 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: SEYPR01MB4509 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.50 / 15.00]; FORGED_MUA_SEAMONKEY_MSGID_UNKNOWN(2.50)[]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a01:111:f400::/48]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; MIME_GOOD(-0.10)[text/plain]; MIME_TRACE(0.00)[0:+]; FREEMAIL_FROM(0.00)[hotmail.com]; RCPT_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:8075, ipnet:2a01:111:f000::/36, country:US]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; DWL_DNSWL_NONE(0.00)[hotmail.com:dkim]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; RCVD_COUNT_TWO(0.00)[2]; TO_DN_ALL(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_LAST(0.00)[]; DKIM_TRACE(0.00)[hotmail.com:+] X-Rspamd-Queue-Id: 4TkHPM3F8Jz4ZjR Tatsuki Makino wrote on 2024/02/23 17:58: > Might need pkg delete -f -g alsa-plugins-\* because it causes file conflicts? In the case of pkg-1.20.9, It seems that alsa-plugins-* is not a glob pattern that picks out the intended package. Others like alsa-plugins-\?\* or alsa-plugins-\[^-\]\* are also no good. Using alsa-plugins-\[a-z\]\* is as intended. Regards. From nobody Mon Feb 26 23:53:43 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkHWg2GpXz5Bx9P for <freebsd-ports@mlmmj.nyi.freebsd.org>; Mon, 26 Feb 2024 23:53:51 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Received: from APC01-TYZ-obe.outbound.protection.outlook.com (mail-tyzapc01olkn2103.outbound.protection.outlook.com [40.92.107.103]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkHWf2n8rz4bl0 for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 23:53:50 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=HWqc0joD; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of tatsuki_makino@hotmail.com designates 40.92.107.103 as permitted sender) smtp.mailfrom=tatsuki_makino@hotmail.com; arc=pass ("microsoft.com:s=arcselector9901:i=1") ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=FjD/liccUnyof9NiY4Q19IvcISU0Bpbmz6q0iWSz1iNgPD5sxBq0zYQmZXTMAX2CAuCtXY+9ultjSgf8pXMa8vXN4iKDgAMDVOfHGfJGNoig0SUkDjRIuol4SyI3l1KxEEzeDirdAfqHoGwfEwnNLa9Hu5quFIx6E9hUQCLpktfPkHCRpi9E9jxLihAmx51q1XoofWX+avSXkFDACvW8QJ0VWJOMZylLTQygRkG9OgsZPQNdaRmk0CT11qrC4nsIg5bd0MyYvt6AJjI0jBrsRrkrkUw5kjtT5Uavu87HIiPJhaBLxfP56R5z/0+fIl6/WOrjIQR1G66QvWCB/s1nDw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=FBVg+EEViov17qJtK7NObl+DNxIfFzcjSoPFnaipNEA=; b=bw+CBU1WrEKFcE18YuBbFMkq7seoqvWeFQYSCPX/s3nMXRPT6123uBmexxV2oyAN20E53wnThhoyzN7vSOJfJDR328O+mYT6YoXPobojajm/tQ1y6Xl3LeBX1F712m4SfrJKn3RKpv8FzSR0pglATkUt2W9xTFO5CX0tEWI332aorUBhrg++neDSjVkoNxKsPk/+LVWVnkCl89OBwAjkvcFe3W+NhOLZWraM6m8PYKhlgZj90z88SH+8aSydpjfIVizbiWbWR/PEF09itLyP7WTpxuSu9x1DZoXm04p9LCOG+s0eoDNfnYlAiBeXt/xpc6Uqah3U2acJZq2bzuAEig== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=FBVg+EEViov17qJtK7NObl+DNxIfFzcjSoPFnaipNEA=; b=HWqc0joDBKkZo2l4kUoKe4Oym/8DgydUY1Rc8UAfk24VCQshsynBl6PFSTMKUBIi2PmgB3jMc3k7gTMpbig+H6/9FbatUqyQ3E90lGMbQfEQ4vDjsfWoRT8tYci5sSTlnA/3iUlAAwtwXbuquMFZi2nboHRfledH0Q3pFnG60Hq+RPbrcfH0MJRxiSxKNQ0UA5VLP2I1EhV2mz25G4+IafJ4mG08+AHHzF28pGUUGOYZQqJ6owkhkL+dkUNMJBOFClhlnDyrj9T/mMVWBu2qJb/uUeDWtpeaOajN5FOXz7Jz8gVnrFNX3qlsJiNmOV2+VCGSXEPigikgmLKDquhBSA== Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) by SI6PR01MB6883.apcprd01.prod.exchangelabs.com (2603:1096:4:23b::12) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7316.33; Mon, 26 Feb 2024 23:53:46 +0000 Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef]) by SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef%6]) with mapi id 15.20.7316.023; Mon, 26 Feb 2024 23:53:46 +0000 Subject: Re: Subpackages: Update From: Tatsuki Makino <tatsuki_makino@hotmail.com> To: FreeBSD Ports mailing list <freebsd-ports@freebsd.org> References: <CAB88xy8o_d99cndg+nTi9fK6XfS+ym=Njor4+cVAkTqV49tfhQ@mail.gmail.com> <SI2PR01MB5036E49A846567CDCBB89E6FFA572@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> <SI2PR01MB503602F416BF36D2C622482DFA552@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> <SI2PR01MB50367F214A4BDE2EEC97B77CFA5A2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Message-ID: <SI2PR01MB5036A3560CC1D21BA2836A55FA5A2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Date: Tue, 27 Feb 2024 08:53:43 +0900 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 In-Reply-To: <SI2PR01MB50367F214A4BDE2EEC97B77CFA5A2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-TMN: [Eq5uFCRNAgW/jey6Y4C+5Lzoa53D5rTY] X-ClientProxiedBy: TYAPR01CA0099.jpnprd01.prod.outlook.com (2603:1096:404:2a::15) To SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) X-Microsoft-Original-Message-ID: <b7be7619-7da5-d33f-9935-0984bcd3ea73@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: SI2PR01MB5036:EE_|SI6PR01MB6883:EE_ X-MS-Office365-Filtering-Correlation-Id: b3a56daa-1814-4ec2-f53b-08dc37262ba1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: 36CdaIJDEKKlkeTmRv+ni0glBviLd+VzLNZFBA9Zu02LeNMfQg/C85A65+ikyieR6INLYC0EIXPTiE3di9Qn9Avnb5o/Y6U7ytVOMFVoUEPZYHeGgsMoTMxh5viORcDNle1F3evvJLoUWKNZ9xAePIiXFo68Vk8W7zeNb9SNgYpR/RNd91AJTIIh5jurlpWu1hnceQHD5W+UUFzJkCqVfjy/B1hFyn5hFX2eLCZ7ddZiuSDiGmlkkwrE/VyxsEF9AC0XBwA6gyl15CBYdDcQW6LmE4KHsBMZPtItPNbUlcCBl78kmyOV3F2Bk85hgLRFzHyCyBW2vsyvkBjFc93GfrjuRVog0L5W/UTV6EwtQM/KfhrHpEYZJfzh266svrN+kduhJcBNNDT+U32MrtKkhCiAWMm95zFWQugu3oix+2mK5YII34gqDpVYCWXhPOupurCyfnfLPtKC4eom/tIYduzVqzimRBTa2uzRYI7PkSZm4fMmP0LOLPvQMAQ3g02q+WFZsNbu3JzUKbMX3Xo7hvT1i7X3PScAS0oZgCE0DDIhlCPAP/QtVsSNxdqPlTcxJ72XAGCE6NHXsuFqkd3IEqn/7vkuBw0E4kc9CeVWBF/lS3g1376no1LCUK84DfdN X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?ZEQ1Syt3akpRbDNqbzdLclF1SlU3eWFlcU5NSDltd2VLNlRPcDdFdzB1OHRU?= =?utf-8?B?NDRCT0NaVElraVdxRlJTRklmK091K1VsbVJLOXB1YUYyK3BFWVBqTnQ5bWts?= =?utf-8?B?MEthMzVTdVpVcHFBZGJuVEUyYUhaRzNweUU4N2dxa3R3NGxMbEo2M3kwWE54?= =?utf-8?B?SlJkVzVVTy92dHdTMmtBSDd1MUt6aDNraTE4UnNLVWhZZm1CL1JseDlaNWd2?= =?utf-8?B?czl3L3ZRVlFWbCtUWlUzTXNhY2V5Vk1UYnJxTmd2b2M0eXB5N1pGUmQvcHBp?= =?utf-8?B?ZUFKOEVYMUNXdWNWd1hYOHJTcXdMcU1tcTdkSDNocnovKzk3WjlPZEc2ZXgy?= =?utf-8?B?ZXdJeEZNYUFIazNubk5XdVZHVXNWaCtMUnpUdG1CanNFcEQ0VUtvcTY3ZkFO?= =?utf-8?B?dVNFMnpSRHlFZkY0ZEJnNUtDQlJqSjVNNk50OWJLck51M05HUFBlU00vVEpJ?= =?utf-8?B?WXdaejFlcTNLenc3VnNOLzBoKzZWSXpqaDBmdG1IbVc2VUdPMkx3b0hUQUVH?= =?utf-8?B?bjdnRVRqS285WmNxaEJzZ25hcCt3KzBKWjQ0N25tMzVVWEIzbndhdW5KWGhw?= =?utf-8?B?VlJmeitoMWlvcmJlM29uSVhnTGF2cFY1Y0htTzZpWXNKY0YvVjF3djN2WDBn?= =?utf-8?B?TDQxaDJwR1VZV1FhU1RWYms5ejZyMGMzSEQrZ3BGSyt3TUc3N3E2SkdLenVE?= =?utf-8?B?QmRkVW15TjdXU0NnYkh1RFkwNERTTnRYSHRKem8reU9jTWM0RG5nMWx1S3Fj?= =?utf-8?B?enFTd3RMeC9RQ3JHQVZWb2tvbStsaVlXRHYvbCtpdWFnOG1lTXFvVnd3dG9U?= =?utf-8?B?NEpUeXgxZnZNMC9JWGQ3QnJIVWczUy8wVVhiMUhtWis5SG5SMHZJTC90cS9I?= =?utf-8?B?MnI3akd3UlB5eEV5WTlBcWs2R1h5VlhRNzVWVWExODlhaWJYY2FCNk1YR1V2?= =?utf-8?B?Z3k4cDh3bmltcUxBN0FPYS9ZOVA2cGRjVDJWVEh0OEFPcitWMHFvWGExNERr?= =?utf-8?B?V0NoMlgwZ1d6bzEwZG9uaUFlRTlRUmo2a1pveXc5bnVrN1hQOUpXQk80TXVZ?= =?utf-8?B?WVFwTVdBN2hrNU5FNjZoekpYajIvZldSUkhRY25IN09YVXphL0d1ZUhoZDU1?= =?utf-8?B?ZHhNb2VLOGR6TTBVbnpEQjl2Rzg0UUFEdjFVWVhLZGEvS1BnNUpwdWtUUmxs?= =?utf-8?B?NEhBdFJ5Q09Ub3RZWlVOT0IyY1g2WWMwdDgwRzIyalVLcmtRR1ZsSmJESE13?= =?utf-8?B?SjVPbnFCVEVFSStjcGJKK0d0UkVHWmVGN2duZ3I0WEpNSWxwWHdkeHh6eDlh?= =?utf-8?B?NGo4KzY0VC9ScU43R3VNcm1IT09wL2hoQ3FFUGRkUzZsNXJKU1BDQXNQWnBV?= =?utf-8?B?NWhwd2EyeVFBSUVWODR4cG1wTS9rZThlZm1rNmlnMFlKdDE2K1A0VGxmMHFB?= =?utf-8?B?MWhnNWcwaE5udUNURE9HQmMvR1FidVdVQVM5MkhMM09SY2hCVmFJN3VwT1hO?= =?utf-8?B?Vlc5Yk9VaE1nVGN0aldwRnVtQXZGYlRab0xjZnRFYjA4bWVUQXo2Z1BJR2RP?= =?utf-8?B?cmpERlBhMEVRRE9KTXo5aUFTN25ESFg0OWFNQ0lYRzFUZmtWSnVSOVJFTnNM?= =?utf-8?B?V2JPQW51cUl0cnl1ekg5NGM1VERHUzYyZ2oramZFS3JweVVTR0Q3eFhNUzR6?= =?utf-8?Q?4CrDtOAM7RG1hQ112rcC?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-d8e84.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: b3a56daa-1814-4ec2-f53b-08dc37262ba1 X-MS-Exchange-CrossTenant-AuthSource: SI2PR01MB5036.apcprd01.prod.exchangelabs.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 26 Feb 2024 23:53:46.2844 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: SI6PR01MB6883 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.50 / 15.00]; FORGED_MUA_SEAMONKEY_MSGID_UNKNOWN(2.50)[]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-0.999]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; R_SPF_ALLOW(-0.20)[+ip4:40.92.0.0/16]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; MIME_GOOD(-0.10)[text/plain]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FREEMAIL_FROM(0.00)[hotmail.com]; ASN(0.00)[asn:8075, ipnet:40.80.0.0/12, country:US]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; RCVD_COUNT_TWO(0.00)[2]; RWL_MAILSPIKE_POSSIBLE(0.00)[40.92.107.103:from]; RCVD_IN_DNSWL_NONE(0.00)[40.92.107.103:from]; TO_DN_ALL(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; DWL_DNSWL_NONE(0.00)[hotmail.com:dkim]; DKIM_TRACE(0.00)[hotmail.com:+] X-Rspamd-Queue-Id: 4TkHWf2n8rz4bl0 Tatsuki Makino wrote on 2024/02/27 08:48: > Tatsuki Makino wrote on 2024/02/23 17:58: >> Might need pkg delete -f -g alsa-plugins-\* because it causes file conflicts? > In the case of pkg-1.20.9, It seems that alsa-plugins-* is not a glob pattern that picks out the intended package. > Others like alsa-plugins-\?\* or alsa-plugins-\[^-\]\* are also no good. > Using alsa-plugins-\[a-z\]\* is as intended. This meant that the pattern matched the package version number... :) From nobody Tue Feb 27 02:43:27 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkMHR2pSsz5CDty for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 02:43:31 +0000 (UTC) (envelope-from agh@riseup.net) Received: from mx1.riseup.net (mx1.riseup.net [198.252.153.129]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx1.riseup.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkMHP6rK3z41w9; Tue, 27 Feb 2024 02:43:29 +0000 (UTC) (envelope-from agh@riseup.net) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=lrZ9qUv1; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of agh@riseup.net designates 198.252.153.129 as permitted sender) smtp.mailfrom=agh@riseup.net Received: from fews02-sea.riseup.net (fews02-sea-pn.riseup.net [10.0.1.112]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mx1.riseup.net (Postfix) with ESMTPS id 4TkMHM6J3wzDqNV; Tue, 27 Feb 2024 02:43:27 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1709001807; bh=ceD/Zm5W4J26ozCRsBA37G8am7nZc0BZMcO/ZWdakDo=; h=Date:From:To:Cc:Subject:In-Reply-To:References:From; b=lrZ9qUv1eLvik8wo+Z1oP8kTG9iTHdSRcbjm3x/2CawubJCY3KtnAqGAeM0gU/mG0 YS4dfZ3V33sNnWPfDpnhRXnYbejXga0/D96DzL379cKdYMtMwEsbbMzWLd9wor9D7a F4jxPAvpqrPemqvy1GIrnYmOcumXYWb3qJn3n9gc= X-Riseup-User-ID: 4EFBA8515149E9AC63E3797D65C720DFAB95D1E6847966D23CAEC723332AA1EB Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews02-sea.riseup.net (Postfix) with ESMTPSA id 4TkMHM4tKvzFsbK; Tue, 27 Feb 2024 02:43:27 +0000 (UTC) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Tue, 27 Feb 2024 02:43:27 +0000 From: Alastair Hogge <agh@riseup.net> To: Gleb Popov <arrowd@freebsd.org> Cc: freebsd-ports@freebsd.org Subject: Re: emulators/mame: Increasing option granularity woes In-Reply-To: <CALH631=4UCndd8NZo4Zzxop8MBCBLHTU_i1RUezxTBH0P5VaNQ@mail.gmail.com> References: <0f7f4f5675d1e75e504ad67d963e8874@riseup.net> <CALH631=4UCndd8NZo4Zzxop8MBCBLHTU_i1RUezxTBH0P5VaNQ@mail.gmail.com> Message-ID: <137c5ccbdaa6ca8e5913771d0ed737d7@riseup.net> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.20 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.997]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; R_SPF_ALLOW(-0.20)[+a:mx1.riseup.net]; RWL_MAILSPIKE_GOOD(-0.10)[198.252.153.129:from]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.129:from]; MISSING_XM_UA(0.00)[]; DWL_DNSWL_NONE(0.00)[riseup.net:dkim]; MIME_TRACE(0.00)[0:+]; TO_DN_SOME(0.00)[]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; ARC_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_TLS_ALL(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DKIM_TRACE(0.00)[riseup.net:+] X-Rspamd-Queue-Id: 4TkMHP6rK3z41w9 On 2024-02-23 15:05, Gleb Popov wrote: Hi Gleb, > On Fri, Feb 23, 2024 at 5:51 AM Alastair Hogge <agh@riseup.net> wrote: >> >> Hello, >> >> The current in-tree port of mame, 0.261, is built around the core >> multi-emulation framework, which results in the usual mega monolithic >> mame binary. There are options for TOOLS, which include two other >> emulators. The current upstream release, 0.262 has enabled separation of >> mame from the rest of the project—TOOLS can now be built separately. I >> would like to reflect this in the Port, however, that means moving the >> two added emulators (LaserDisk player, and Netlist resolver) out of >> TOOLS (which I think the correct path to take). Considering the new >> upstream build pattern, I would like to configure the Port to option any >> of the emulators, and existing TOOLS. The problem I am facing, the three >> emulators require the same (or close to it) runtime config/resources, >> the assets are currently covered by the do-install target[1], how do I >> cover the assets in the Port, specifically in the pkg-plist to be >> conditioned on either of 3 potential emulator options? Should I add an >> option MAMEDATA? > > You're almost right. Indeed there is no need in the user-visible > option, but you want all other machinery to kick in. > Basically, it boils down to > > .if somecond > PLIST_SUB+= MAMEDATA= > .else > PLIST_SUB+= MAMEDATA="@comment " > .endif The mess I have at the moment. > where "somecond" defines if the files should be present in the > package. For OPTIONS (and when OPTIONS_SUB=yes is present [1]) it > happens automatically. > > If you end up with "somecond" being in form "${PORT_OPTIONS:MFOO} || > ${PORT_OPTIONS:MBAR}" then you could simplify it even more > > FOO_PLIST_SUB= MAMEDATA= > FOO_PLIST_SUB_OFF= MAMEDATA="@comment " > BAR_PLIST_SUB= MAMEDATA= > BAR_PLIST_SUB_OFF= MAMEDATA="@comment " This is brilliant, I think I was getting confused with the documentation referring to OPTIONS/OPT for conditioning PLIST, and an User visible option is what I wanted to avoid. I am testing this now, and it is far more elegant, however, I do not know how that translates to Makefile targets, like do-install-NON_USER_FACING_OPT-on. Currently the Makefile target is of the ".if somecond FOO= .else BAR= .endif" form. Thanks a billion! Alastair From nobody Tue Feb 27 04:08:23 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkP9N38bVz5CMtk for <ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 04:08:24 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkP9M62vKz49y1 for <ports@freebsd.org>; Tue, 27 Feb 2024 04:08:23 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709006903; a=rsa-sha256; cv=none; b=ECx69XY18bwQEdrqlg2rOfOdVWY2Zbz7qnoBNa6MVeDBZpKHlrNNeHqEvDrCIal8y5dYjG FBhGw9cUxM7fwUWLpUmBNryrY0ljry3N+ZF4GfiItK64vpxxtgo09bUKTJITmsL6h7671k 6zhqAs8a0AbUHwYEkNaNWpv3ETdA4FZWXg7R+tEzVIFS+1dWAY5AsYp/HE6ppl+sukqReR 09GZlkyuO4fkHGWkatFtJAOD9vhhWkipi79ocHVLUhrL4Gbnn1OsUzEduzFtwZcDdtnxZg 9H6exEOql6aNPCAfcUgo+yq27rgqr8O3zakGUcepp/RUoYM37nzofH5vPGmS1Q== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709006903; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=GTAs2O4CoKajTrbv6iDXxj7TP2qvTnLJi0TEp/cPaRs=; b=Zm8EjD+ECFa7i0c9O8X+mkaVYXhCNUhra4KM8DBnRPfs1qRvrhmyCCBoAPmTG+oxIjd65w NNmvtQBXmb42BCcspGNypp6C4jaPyfnJPConZvQLbKArf6aiYcpe1hY3LTXsbk3ilfZupv FVQ72bP4bqmby+wm4CTM0cqyGYYVUnDJDdW4uE5J5dfJxBhBF6VwwJ0VEpct1DRsLDoZhI I/AtM9jqIEyDW/4H//hDhqG3IMYlULVLfkDxCR3U+q0C6yl5KBmh6mwNF+sDo4yvzSpOZn m++WqOkGHv4avvKc3JsoaVHqcOkZRtzh3YqtDJGZMketrc7DNONCu2uRnzWQ1A== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4TkP9M4LjLzxD7 for <ports@freebsd.org>; Tue, 27 Feb 2024 04:08:23 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 41R48NPQ005245 for <ports@freebsd.org>; Tue, 27 Feb 2024 04:08:23 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 41R48N8f005244; Tue, 27 Feb 2024 04:08:23 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202402270408.41R48N8f005244@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Tue, 27 Feb 2024 04:08:23 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ cad/ifcopenshell | 0.6.0 | blenderbim-240226 ------------------------------------------------+-----------------+------------ devel/tinygo | 0.19.0 | v0.31.0 ------------------------------------------------+-----------------+------------ security/globalprotect-openconnect | 1.4.9 | v2.1.0 ------------------------------------------------+-----------------+------------ sysutils/conky | 1.19.6 | v1.19.8 ------------------------------------------------+-----------------+------------ sysutils/conky-awesome | 1.19.6 | v1.19.8 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Tue Feb 27 06:01:42 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkRrQ4BnQz5CXtr for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 06:08:54 +0000 (UTC) (envelope-from me@pacopascal.com) Received: from MTA-06-4.privateemail.com (mta-06-4.privateemail.com [198.54.122.146]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkRrP1WpDz4Pgl for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 06:08:53 +0000 (UTC) (envelope-from me@pacopascal.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of me@pacopascal.com designates 198.54.122.146 as permitted sender) smtp.mailfrom=me@pacopascal.com Received: from mta-06.privateemail.com (localhost [127.0.0.1]) by mta-06.privateemail.com (Postfix) with ESMTP id 2E12D18000B6 for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 01:08:50 -0500 (EST) Received: from Gauss.LF (pool-71-183-246-181.nycmny.fios.verizon.net [71.183.246.181]) by mta-06.privateemail.com (Postfix) with ESMTPA for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 01:08:49 -0500 (EST) From: Paco Pascal <me@pacopascal.com> To: freebsd-ports@freebsd.org Subject: Updating & Adopting lang/owl-lisp Date: Tue, 27 Feb 2024 01:01:42 -0500 User-Agent: mu4e 1.12.0; emacs 29.2 Message-ID: <87o7c2cuc9.fsf@Gauss.LF> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: text/plain X-Virus-Scanned: ClamAV using ClamSMTP X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.37 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.97)[-0.968]; R_SPF_ALLOW(-0.20)[+ip4:198.54.122.128/27]; RWL_MAILSPIKE_GOOD(-0.10)[198.54.122.146:from]; MIME_GOOD(-0.10)[text/plain]; RCVD_VIA_SMTP_AUTH(0.00)[]; ASN(0.00)[asn:22612, ipnet:198.54.122.0/24, country:US]; FREEFALL_USER(0.00)[me]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; FROM_HAS_DN(0.00)[]; R_DKIM_NA(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; TO_DN_NONE(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_LAST(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; DMARC_NA(0.00)[pacopascal.com]; RCVD_IN_DNSWL_NONE(0.00)[198.54.122.146:from] X-Rspamd-Queue-Id: 4TkRrP1WpDz4Pgl Hi, I submitted a PR back in November 2023 with a patch to update owl-lisp from v0.1.23 to v0.2.2. At the moment, the port is orphaned and I'm interested in adopting. https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=275337 // Paco From nobody Tue Feb 27 06:24:13 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkSBg5Dm1z5CZ0k for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 06:24:43 +0000 (UTC) (envelope-from 6yearold@gmail.com) Received: from mail-vk1-f180.google.com (mail-vk1-f180.google.com [209.85.221.180]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkSBg2td9z4RbM for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 06:24:43 +0000 (UTC) (envelope-from 6yearold@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-vk1-f180.google.com with SMTP id 71dfb90a1353d-4cba3807eedso2157894e0c.0 for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 22:24:43 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709015082; x=1709619882; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=ThYikVyF2c+BZkChRSNUAY3T74Fadz2i9ToT1PmE0VU=; b=XeTdX3v+ALG4jk4PWhM7viGylZtEw87ShbAd0VXPR34DVB5B25pzICn8ORpKPChW5o cBsyFwcdAA8+cQN/nuJfLdw+m/tD92YqzB9rW8pCRkvwkmlcFsYRnSaMk9SAUkZoy0ud 6I/dBmm5KK9plAYmpQ9q5eLHqxYD3Z5Vqlw2ghiyXQKeFmmKIuaH99qbFg1I/SZvaJo9 FpmzrX3neliHtL1CY7gNtFnRX9gzP/gZGJCQwfEJDhti0EqaQDHgOirCe4CfVb+QzMTh laJhx3Mjaaqn5ejom6G58cIDTwudEep0KJc7UiMRS1TcSxNMPUyDs4nMtxV7yMwaP3Aq S2Yw== X-Gm-Message-State: AOJu0Yxyo/v7a2m1+YXmymSiIAgkKDHkWcXL41OYpUboR00sW4BEgi2C fuid1ilOjDUP1lOjDIgMmC4X1L5XhO0gU++i5dLgKMtZuMhlPfKi7L9l1k1OZe4= X-Google-Smtp-Source: AGHT+IFITCKuacGm/Bb2yp4zb9kqLmRNheYloerqNrjuJqCKNmY0GtQYEX+unqtQFaZCDM/bcXviUQ== X-Received: by 2002:a05:6122:4d0e:b0:4c8:aaf1:1558 with SMTP id fi14-20020a0561224d0e00b004c8aaf11558mr6491482vkb.3.1709015081907; Mon, 26 Feb 2024 22:24:41 -0800 (PST) Received: from mail-vk1-f173.google.com (mail-vk1-f173.google.com. [209.85.221.173]) by smtp.gmail.com with ESMTPSA id fc23-20020a0561224b1700b004c880fc9728sm844457vkb.46.2024.02.26.22.24.41 for <freebsd-ports@freebsd.org> (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Mon, 26 Feb 2024 22:24:41 -0800 (PST) Received: by mail-vk1-f173.google.com with SMTP id 71dfb90a1353d-4caabc3f941so1943538e0c.1 for <freebsd-ports@freebsd.org>; Mon, 26 Feb 2024 22:24:41 -0800 (PST) X-Received: by 2002:a1f:d501:0:b0:4c7:7760:8f14 with SMTP id m1-20020a1fd501000000b004c777608f14mr6580130vkg.7.1709015081504; Mon, 26 Feb 2024 22:24:41 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <0f7f4f5675d1e75e504ad67d963e8874@riseup.net> <CALH631=4UCndd8NZo4Zzxop8MBCBLHTU_i1RUezxTBH0P5VaNQ@mail.gmail.com> <137c5ccbdaa6ca8e5913771d0ed737d7@riseup.net> In-Reply-To: <137c5ccbdaa6ca8e5913771d0ed737d7@riseup.net> From: Gleb Popov <arrowd@freebsd.org> Date: Tue, 27 Feb 2024 09:24:13 +0300 X-Gmail-Original-Message-ID: <CALH631=TsOzONNmh3zFwR-SeqBzB9yHCc=aHTYJGBgi7U1Pukg@mail.gmail.com> Message-ID: <CALH631=TsOzONNmh3zFwR-SeqBzB9yHCc=aHTYJGBgi7U1Pukg@mail.gmail.com> Subject: Re: emulators/mame: Increasing option granularity woes To: Alastair Hogge <agh@riseup.net> Cc: freebsd-ports@freebsd.org Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:15169, ipnet:209.85.128.0/17, country:US] X-Rspamd-Queue-Id: 4TkSBg2td9z4RbM On Tue, Feb 27, 2024 at 5:43=E2=80=AFAM Alastair Hogge <agh@riseup.net> wro= te: > > however, I do not know how that translates to Makefile > targets, like do-install-NON_USER_FACING_OPT-on. Currently the Makefile > target is of the ".if somecond FOO=3D .else BAR=3D .endif" form. I'm afraid you'd still have to write post-install: .if ${PORT_OPTIONS:MFOO} || ${PORT_OPTIONS:MBAR} ... .endif for optionalizing targets. From nobody Tue Feb 27 13:37:08 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tkdnx34p5z5Bj0l for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 13:37:25 +0000 (UTC) (envelope-from trashcan@ellael.org) Received: from mx2.enfer-du-nord.net (mx2.enfer-du-nord.net [IPv6:2001:41d0:701:1000::435d]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tkdnw3vRYz4Jls for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 13:37:24 +0000 (UTC) (envelope-from trashcan@ellael.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=ellael.org header.s=dkim header.b=rXNQsc8B; dmarc=pass (policy=quarantine) header.from=ellael.org; spf=pass (mx1.freebsd.org: domain of trashcan@ellael.org designates 2001:41d0:701:1000::435d as permitted sender) smtp.mailfrom=trashcan@ellael.org Received: from smtpclient.apple (p200300FB4F01BC01257bD061Ab3f79B2.dip0.t-ipconnect.de [IPv6:2003:fb:4f01:bc01:257b:d061:ab3f:79b2]) (using TLSv1.2 with cipher ECDHE-ECDSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by mx2.enfer-du-nord.net (Postfix) with ESMTPSA id 4Tkdnq20xZz1fXl; Tue, 27 Feb 2024 14:37:19 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=ellael.org; s=dkim; t=1709041040; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=pUEDuIZj9Yymz8x1Pmmclxn8hVUWtM0aNmfU0JjNMQ4=; b=rXNQsc8BLbKnT4eeb24HyVN0HRBICsTalND2v8uI1JAEUmzjA1HQOe35ziyLV5B/F7dBM/ JjM6IDIEibkzCBPS+rjYu1NQyE4DVYLfwbqeNbHOm3M9EOkMoyNVzfmS7gvYVSDhS2Awif eNxeQiUxRLzjc1qcE+59QpSuIO0cnFsSRpAIh2yxfP9S2hWoNfnIXd+2e1Ne0FVdDh7fS8 Cw4hRkx5KbxpaYmJQY+KN9ZLOZV49HAt+76tkFaN8JE1yGmlgQJMBVkaItw+7yxurYrb0l iKOlywtjDyrJaF7/26hKWJa4RuDZfHx4LqaQ0nfCzwkUjB5xZuqznr/lTBhO0A== Content-Type: text/plain; charset=utf-8 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.400.31\)) Subject: Re: dns/knot3 and dns/knot-resolver do not get along with From: Michael Grimm <trashcan@ellael.org> In-Reply-To: <6F77C083-4AC6-4592-88C3-626D138B10D0@yahoo.com> Date: Tue, 27 Feb 2024 14:37:08 +0100 Cc: FreeBSD Mailing List <freebsd-ports@freebsd.org> Content-Transfer-Encoding: quoted-printable Message-Id: <22AAFA97-0276-44C7-A88B-8AD9CB2A972C@ellael.org> References: <79302DD2-2673-4745-82B3-06BEEC907DAE.ref@yahoo.com> <79302DD2-2673-4745-82B3-06BEEC907DAE@yahoo.com> <6C622E06-4CFC-4296-B0C8-6279F6BD3FDB@ellael.org> <6F77C083-4AC6-4592-88C3-626D138B10D0@yahoo.com> To: Mark Millard <marklmi@yahoo.com> X-Mailer: Apple Mail (2.3774.400.31) X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.90 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[ellael.org,quarantine]; R_DKIM_ALLOW(-0.20)[ellael.org:s=dkim]; R_SPF_ALLOW(-0.20)[+ip6:2001:41d0:701:1000::435d]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; RCVD_TLS_ALL(0.00)[]; DKIM_TRACE(0.00)[ellael.org:+]; TO_DN_ALL(0.00)[]; FREEMAIL_TO(0.00)[yahoo.com]; RCPT_COUNT_TWO(0.00)[2]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:16276, ipnet:2001:41d0::/32, country:FR]; TO_MATCH_ENVRCPT_SOME(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; APPLE_MAILER_COMMON(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2001:41d0:701:1000::435d:from] X-Rspamd-Queue-Id: 4Tkdnw3vRYz4Jls Mark Millard <marklmi@yahoo.com> wrote: > On Feb 26, 2024, at 01:06, Michael Grimm <trashcan@ellael.org> wrote: >> Possible solutions: >>=20 >> 1) dns/knot3-lib should store its libraries and includes into a = different location as dns/knot3 does >=20 > A variation of that is that dns/knot-resolver has its own files > in its own locations for such, no dns/knot3-lib port involved. >=20 >> 2) discard dns/knot3-lib and make dns/knot3 and dns/knot-resolver = mutually dependent >> 3) =E2=80=A6? >=20 > "..." might be: dns/knot3 uses the files from dns/knot3-lib instead of > installing its own and so has both a build dependency on dns/knot3-lib > and a run-time dependency on dns/knot3-lib . dns/knot-resolver also > then has such ( and no dependency on dns/knot3 ). The run-time = dependency > leads to installation of either dns/knot3 or dns/knot-resolver first > installing dns/knot3-lib if it is not already installed. Uninstalling > dns/knot3-lib would lead to both dns/knot3 or dns/knot-resolver being > uninstalled if both were installed. The build time dependencies lead = to > dns/knot3-lib being built first and being installed before builds of > either dns/knot3 or dns/knot-resolver if dns/knot3-lib is not already > installed. (In poudriere such build time install of dns/knot3-lib is > temporary and internal to the build activity.) >=20 > This allows both dns/knot3 and dns/knot-resolver to be installed > in the same jail "simultaneously". (It does not matter which is > installed first vs. second in the sequence of installs.) >=20 > I do not know which way is simpler to support. That likely is = dependent > on details I'm ignorant of. All look to be technically possible. FYI: I do prefer your "=E2=80=A6" solution and opened = https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D277332 Thanks for your input and kind regards, Michael From nobody Tue Feb 27 17:50:26 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TklPx2hCcz5C7RZ for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 17:50:29 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-wr1-x42d.google.com (mail-wr1-x42d.google.com [IPv6:2a00:1450:4864:20::42d]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TklPw53YHz4pS8 for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 17:50:28 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=LNjx2MM4; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of hubert.tournier@gmail.com designates 2a00:1450:4864:20::42d as permitted sender) smtp.mailfrom=hubert.tournier@gmail.com Received: by mail-wr1-x42d.google.com with SMTP id ffacd0b85a97d-33dcd8dec88so1775088f8f.1 for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 09:50:28 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709056226; x=1709661026; darn=freebsd.org; h=subject:from:to:content-language:user-agent:mime-version:date :message-id:from:to:cc:subject:date:message-id:reply-to; bh=VQ8nWh4vQlC3wb/6Z4PNzh3cvBd4J1iRpe6Oh1JOCKk=; b=LNjx2MM4qbwT4aj36dXlHtQB54A7DhK/Ma/asu1zmqZFxfkpo6NqiX1R7pDpGkUdjl YePZnSEVuyJ5wdG0YUXixZ4aCjo7L5f6Tpk18eKpehwf8JBg4nXIyDuwxAEBu+9MsDbw Cy5eTVaAjyIDM8te/L8dOA/epXF8hIl+0PQy54PAQFyhCfo2kz1LT+cmnL7fdlgmXJDn tNf5VWfCoKejVM3CAvZ891nsmdYrXn46Rw3stcgOazZQ4WdT685dQQkhkeO2sjw+BwZd 9nj1TOvdOIRcxox9TepOI/NVabskLYHyAQvyyhUK5WK7F1XVoNReQabwcIFakjAYubsG jwvg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709056226; x=1709661026; h=subject:from:to:content-language:user-agent:mime-version:date :message-id:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=VQ8nWh4vQlC3wb/6Z4PNzh3cvBd4J1iRpe6Oh1JOCKk=; b=I2yOkY6ky5Fx0KtdxlZrOUVHl8ArJFy7UFDPy6sSNISGqhkf1CNJK6ZTLgmxjyRdZn pKadWE6FHFXyBk5DmEuXYj/NvcNoAp06zKI1nl/aAy2Efn201kU5HeovWNDze3Jrcg9D BTyIg1q8DyLO3Bx54IgNJxkYnANJ0YMwgGl2R+PylCqAXQgwZ8MUc8DGIY3UdceGyXTt wqvVfedWdVBpWWV+dsDIqYycPkXXhtvf9cYq9RsbPblIlngmT5MXZhyEvd0efLQCzLZo kMVgnIyzCdQQcvFVqQZkqq31HqFKr2/rtSAcOUAxKPxJNWMQzJwdtx+t+/m0JSRD3kEc v8HA== X-Gm-Message-State: AOJu0YznJAu7ReXxNDGX2R5gMaxaiNeDBDHrcnjHkFYiJlozV+zI6RVX FKVDcEWoUgsfMUNKvEBYedRLiX2XnJx0mBuW0lypi3LvGp/l3xNdo7bz865+cuE= X-Google-Smtp-Source: AGHT+IGvxtCxBQns+PpLLJj6Y7E+40B9ghDpMQSJ3/G3e7ix0FPAPcECLc/oGvkjolPlhYXL3hfRtg== X-Received: by 2002:a5d:61c1:0:b0:33d:82d5:e4bf with SMTP id q1-20020a5d61c1000000b0033d82d5e4bfmr7123288wrv.31.1709056225871; Tue, 27 Feb 2024 09:50:25 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:79cf:3763:c572:7f21? ([2a01:e0a:80d:9d80:79cf:3763:c572:7f21]) by smtp.gmail.com with ESMTPSA id c4-20020adfa304000000b0033df4fbe91esm1622300wrb.115.2024.02.27.09.50.25 for <freebsd-ports@freebsd.org> (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Tue, 27 Feb 2024 09:50:25 -0800 (PST) Content-Type: multipart/alternative; boundary="------------0SVVDBIHBiX63pNKgUA6mnen" Message-ID: <92ef9ee5-9ab7-4b33-94b2-e567618833cf@gmail.com> Date: Tue, 27 Feb 2024 18:50:26 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Content-Language: fr To: freebsd-ports@FreeBSD.org From: Hubert Tournier <hubert.tournier@gmail.com> Subject: Port tree linter X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.99 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; XM_UA_NO_VERSION(0.01)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; ARC_NA(0.00)[]; TAGGED_FROM(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_DN_NONE(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::42d:from] X-Rspamd-Queue-Id: 4TklPw53YHz4pS8 This is a multi-part message in MIME format. --------------0SVVDBIHBiX63pNKgUA6mnen Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit Hello there! I made a small program that perhaps may be of interest to some port maintainers. It's called portlint2 (https://github.com/HubTou/portlint2), and it checks the ports Index file and the port's makefiles, for the whole port tree, or for selected categories / maintainers / ports. On a freshly updated port Index and port tree, it will produce a summary of findings like this: Selected 34434 ports out of 34434 in the FreeBSD port tree, and found: 4 ports with unusual installation-prefix (warning) 339 ports with a comment string exceeding 70 characters (warning) 286 ports with an uncapitalized comment 11 ports comment ending with a dot 108 ports with a comment different between the Index and Makefile 2 ports with non existent description-file 4 ports with a maintainer different between the Index and Makefile 34 ports referring to unofficial categories (warning) 262 ports with categories different between the Index and Makefile 1251 ports with no www-site 300 ports with an unresolvable www-site hostname 658 ports with an unaccessible www-site 2 ports with a www-site different betwwen the Index and makefile There are other checks, but it only prints summary lines for those with 1+ occurrences. Before this summary, it prints a list of affected ports per maintainer, for example like this: yuri@FreeBSD.org: Diverging comments: jamulus-server-3.10.0 RStudio-2022.12.0+353_6 RStudio-server-2022.12.0+353_6 qbittorrent-nox-4.6.3 Too long comments: py39-pytest4-flakes-4.0.1 py39-spectral-0.22.4_1 Uncapitalized comments: shunit2-2.1.8.93 libmicrodns-0.2.0 py39-mmcif-0.84 hq-1.0.1_9 ibus-m17n-1.4.28 jaq-1.3.0_1 Diverging categories: obs-studio-30.0.2_1 HTTP Error 404 (Not found) on www-site: eteroj-lv2-0.10.0_1 geonkick-lv2-2.10.0 lv2lint-0.16.2_2 midi-matrix-lv2-0.28.0_1 moony-lv2-0.36.0_1 orbit-lv2-0.1.661 py39-hsaudiotag3k-1.1.3.p1 sherlock-lv2-0.28.0_2 timely-lv2-g20190412_1 vm-lv2-0.14.0_2 graphlan-1.1.3_1 GroopM-0.3.4_4 thrust-1.9.5_1 py39-ta-lib-0.4.28 cmh-1.1.1_3 FlintQS-1.0 coin-or-flopc++-1.2.5.20200527_1 moab-5.3.1_5 mpfrcx-0.6.3_1 paritwine-0.1_3 vinci-1.0.5 ironscanner-1.1.0.20180828 sdformat-8.0.0_6 clash-1.18.0_2 dftd3-3.2.0.3_1 dftd4-3.5.0_1 octopus-13.0_1 openbabel-3.1.1.178 opsin-3.0.20190223_1 py39-dftd4-3.5.0 py39-openbabel-3.1.1.1 py39-phono3py-1.22.3_2 py39-pyked-0.4.1.16_1 xdrawchem-1.11.0.2_2 ntk-1.3.1001_1 redkite-1.3.1 Unresolvable www-site: libpcl-1.12 geogram-1.7.9 daggy-2.1.3_1 silicon-0.1.124 ztoolkit-0.1.2_2 It also produces more detailed error logs on stderr. I hope it will be useful to others. I needed this because I have another program that mass checks Python ports for unreported vulnerabilities, which needs an up-to-date and correct information in the ports Index to be relevant... Best regards, Hubert --------------0SVVDBIHBiX63pNKgUA6mnen Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit <!DOCTYPE html> <html> <head> <meta http-equiv="content-type" content="text/html; charset=UTF-8"> </head> <body> <p>Hello there!<br> </p> <p>I made a small program that perhaps may be of interest to some port maintainers.</p> <p>It's called portlint2 (<a class="moz-txt-link-freetext" href="https://github.com/HubTou/portlint2">https://github.com/HubTou/portlint2</a>), and it checks the ports Index file and the port's makefiles, for the whole port tree, or for selected categories / maintainers / ports.<br> </p> <p>On a freshly updated port Index and port tree, it will produce a summary of findings like this:<br> </p> <pre>Selected 34434 ports out of 34434 in the FreeBSD port tree, and found: 4 ports with unusual installation-prefix (warning) 339 ports with a comment string exceeding 70 characters (warning) 286 ports with an uncapitalized comment 11 ports comment ending with a dot 108 ports with a comment different between the Index and Makefile 2 ports with non existent description-file 4 ports with a maintainer different between the Index and Makefile 34 ports referring to unofficial categories (warning) 262 ports with categories different between the Index and Makefile 1251 ports with no www-site 300 ports with an unresolvable www-site hostname 658 ports with an unaccessible www-site 2 ports with a www-site different betwwen the Index and makefile There are other checks, but it only prints summary lines for those with 1+ occurrences. Before this summary, it prints a list of affected ports per maintainer, for example like this: <a class="moz-txt-link-abbreviated" href="mailto:yuri@FreeBSD.org">yuri@FreeBSD.org</a>: Diverging comments: jamulus-server-3.10.0 RStudio-2022.12.0+353_6 RStudio-server-2022.12.0+353_6 qbittorrent-nox-4.6.3 Too long comments: py39-pytest4-flakes-4.0.1 py39-spectral-0.22.4_1 Uncapitalized comments: shunit2-2.1.8.93 libmicrodns-0.2.0 py39-mmcif-0.84 hq-1.0.1_9 ibus-m17n-1.4.28 jaq-1.3.0_1 Diverging categories: obs-studio-30.0.2_1 HTTP Error 404 (Not found) on www-site: eteroj-lv2-0.10.0_1 geonkick-lv2-2.10.0 lv2lint-0.16.2_2 midi-matrix-lv2-0.28.0_1 moony-lv2-0.36.0_1 orbit-lv2-0.1.661 py39-hsaudiotag3k-1.1.3.p1 sherlock-lv2-0.28.0_2 timely-lv2-g20190412_1 vm-lv2-0.14.0_2 graphlan-1.1.3_1 GroopM-0.3.4_4 thrust-1.9.5_1 py39-ta-lib-0.4.28 cmh-1.1.1_3 FlintQS-1.0 coin-or-flopc++-1.2.5.20200527_1 moab-5.3.1_5 mpfrcx-0.6.3_1 paritwine-0.1_3 vinci-1.0.5 ironscanner-1.1.0.20180828 sdformat-8.0.0_6 clash-1.18.0_2 dftd3-3.2.0.3_1 dftd4-3.5.0_1 octopus-13.0_1 openbabel-3.1.1.178 opsin-3.0.20190223_1 py39-dftd4-3.5.0 py39-openbabel-3.1.1.1 py39-phono3py-1.22.3_2 py39-pyked-0.4.1.16_1 xdrawchem-1.11.0.2_2 ntk-1.3.1001_1 redkite-1.3.1 Unresolvable www-site: libpcl-1.12 geogram-1.7.9 daggy-2.1.3_1 silicon-0.1.124 ztoolkit-0.1.2_2 It also produces more detailed error logs on stderr. I hope it will be useful to others. I needed this because I have another program that mass checks Python ports for unreported vulnerabilities, which needs an up-to-date and correct information in the ports Index to be relevant... Best regards, Hubert </pre> </body> </html> --------------0SVVDBIHBiX63pNKgUA6mnen-- From nobody Tue Feb 27 22:54:40 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tkt943Ldwz5BrbD for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 22:54:48 +0000 (UTC) (envelope-from portmaster@bsdforge.com) Received: from udns.ultimatedns.net (udns.ultimatedns.net [24.113.41.81]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "ultimatedns.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tkt936KHjz4KKm for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 22:54:47 +0000 (UTC) (envelope-from portmaster@bsdforge.com) Authentication-Results: mx1.freebsd.org; dkim=none; spf=none (mx1.freebsd.org: domain of portmaster@bsdforge.com has no SPF policy when checking 24.113.41.81) smtp.mailfrom=portmaster@bsdforge.com Received: from ultimatedns.net (localhost [127.0.0.1]) by udns.ultimatedns.net (8.16.1/8.16.1) with ESMTP id 41RMsfdb043551; Tue, 27 Feb 2024 14:54:47 -0800 (PST) (envelope-from portmaster@bsdforge.com) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Tue, 27 Feb 2024 14:54:40 -0800 From: Chris <portmaster@bsdforge.com> To: Hubert Tournier <hubert.tournier@gmail.com> Cc: freebsd-ports@freebsd.org Subject: Re: Port tree linter In-Reply-To: <92ef9ee5-9ab7-4b33-94b2-e567618833cf@gmail.com> References: <92ef9ee5-9ab7-4b33-94b2-e567618833cf@gmail.com> User-Agent: UDNSMS/17.0 Message-ID: <c139e647ebb30377e52a770c552553b7@bsdforge.com> X-Sender: portmaster@bsdforge.com Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Bar: / X-Rspamd-Pre-Result: action=no action; module=multimap; Matched map: local_wl_ip X-Spamd-Result: default: False [0.00 / 15.00]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; R_SPF_NA(0.00)[no SPF record]; TAGGED_RCPT(0.00)[]; local_wl_ip(0.00)[24.113.41.81]; FREEMAIL_TO(0.00)[gmail.com]; R_DKIM_NA(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; ASN(0.00)[asn:11404, ipnet:24.113.0.0/16, country:US]; FROM_HAS_DN(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+] X-Rspamd-Queue-Id: 4Tkt936KHjz4KKm On 2024-02-27 09:50, Hubert Tournier wrote: > Hello there! > > I made a small program that perhaps may be of interest to some port > maintainers. > > It's called portlint2 (https://github.com/HubTou/portlint2), and it checks > the > ports Index file and the port's makefiles, for the whole port tree, or for > selected categories / maintainers / ports. > > On a freshly updated port Index and port tree, it will produce a summary of > findings like this: > > Selected 34434 ports out of 34434 in the FreeBSD port tree, and found: > 4 ports with unusual installation-prefix (warning) > 339 ports with a comment string exceeding 70 characters (warning) > 286 ports with an uncapitalized comment > 11 ports comment ending with a dot > 108 ports with a comment different between the Index and Makefile > 2 ports with non existent description-file > 4 ports with a maintainer different between the Index and Makefile > 34 ports referring to unofficial categories (warning) > 262 ports with categories different between the Index and Makefile > 1251 ports with no www-site > 300 ports with an unresolvable www-site hostname > 658 ports with an unaccessible www-site > 2 ports with a www-site different betwwen the Index and makefile > > There are other checks, but it only prints summary lines for those with 1+ > occurrences. > > Before this summary, it prints a list of affected ports per maintainer, for > example like this: > > yuri@FreeBSD.org: > Diverging comments: > jamulus-server-3.10.0 RStudio-2022.12.0+353_6 > RStudio-server-2022.12.0+353_6 qbittorrent-nox-4.6.3 > Too long comments: > py39-pytest4-flakes-4.0.1 py39-spectral-0.22.4_1 > Uncapitalized comments: > shunit2-2.1.8.93 libmicrodns-0.2.0 py39-mmcif-0.84 hq-1.0.1_9 > ibus-m17n-1.4.28 jaq-1.3.0_1 > Diverging categories: > obs-studio-30.0.2_1 > HTTP Error 404 (Not found) on www-site: > eteroj-lv2-0.10.0_1 geonkick-lv2-2.10.0 lv2lint-0.16.2_2 > midi-matrix-lv2-0.28.0_1 moony-lv2-0.36.0_1 orbit-lv2-0.1.661 > py39-hsaudiotag3k-1.1.3.p1 sherlock-lv2-0.28.0_2 > timely-lv2-g20190412_1 > vm-lv2-0.14.0_2 graphlan-1.1.3_1 GroopM-0.3.4_4 thrust-1.9.5_1 > py39-ta-lib-0.4.28 cmh-1.1.1_3 FlintQS-1.0 > coin-or-flopc++-1.2.5.20200527_1 moab-5.3.1_5 mpfrcx-0.6.3_1 > paritwine-0.1_3 vinci-1.0.5 ironscanner-1.1.0.20180828 > sdformat-8.0.0_6 > clash-1.18.0_2 dftd3-3.2.0.3_1 dftd4-3.5.0_1 octopus-13.0_1 > openbabel-3.1.1.178 opsin-3.0.20190223_1 py39-dftd4-3.5.0 > py39-openbabel-3.1.1.1 py39-phono3py-1.22.3_2 py39-pyked-0.4.1.16_1 > xdrawchem-1.11.0.2_2 ntk-1.3.1001_1 redkite-1.3.1 > Unresolvable www-site: > libpcl-1.12 geogram-1.7.9 daggy-2.1.3_1 silicon-0.1.124 > ztoolkit-0.1.2_2 > > It also produces more detailed error logs on stderr. > > I hope it will be useful to others. > > I needed this because I have another program that mass checks Python ports > for > unreported vulnerabilities, > which needs an up-to-date and correct information in the ports Index to be > relevant... > > Best regards, > > Hubert While I haven't (yet) tried it out. I'm grateful for your work. It'll potentially save a bunch of work, Thanks! Shouldn't this make it to ports-mgmt/ as portlinter? Thanks again. -- --Chris Hutchinson From nobody Tue Feb 27 23:49:42 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkvNX02VSz5Bx2b for <ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 23:49:48 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-wm1-x333.google.com (mail-wm1-x333.google.com [IPv6:2a00:1450:4864:20::333]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkvNW54GQz4Qkq for <ports@freebsd.org>; Tue, 27 Feb 2024 23:49:47 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-wm1-x333.google.com with SMTP id 5b1f17b1804b1-412a9457b2eso1744305e9.1 for <ports@freebsd.org>; Tue, 27 Feb 2024 15:49:47 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709077784; x=1709682584; darn=freebsd.org; h=content-transfer-encoding:in-reply-to:cc:from:content-language :references:to:subject:user-agent:mime-version:date:message-id:from :to:cc:subject:date:message-id:reply-to; bh=KzR1/8L3e8kYAjlzpX3nLls8sUYVF1FuzxYMiIeLpAY=; b=nneMgK5J50NOGNKU6EwRuntrBmuyrsqegn1O2mfGjpHFGrvrQWFLISNMrYTi5UMNkZ 6aPUqoxKsshhGWWrKKAu6LVt9cKceVEvGIqd/RlMZote5yrZ4FIUX7pmsuDoRcvRRNEz GIqaunmq9zDhVvx0auiMpV22FuL0K60oAMwxexL8mYSHVya8YIeZjr1AeU+O0DNokIyU 9Atpz+uH4eKxDXIARpxVLZze3Vbl8jgSikwlpDHwq4OZ9oGTF4IlIDqAHaytHoVM0ofo ReDqvQB2VV0KqcbkqYoYyLFWyL5f11jlpxwmx9Yrz2GLmyxhgvmfZZTOs4BGfxs8I8hh dBYw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709077784; x=1709682584; h=content-transfer-encoding:in-reply-to:cc:from:content-language :references:to:subject:user-agent:mime-version:date:message-id :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=KzR1/8L3e8kYAjlzpX3nLls8sUYVF1FuzxYMiIeLpAY=; b=vTbShNDSc+2wmDDvFvRbS3zfUrXE4DPhQ49h8huxSL01HXgUuZQDqmmS3qWcqvGBo/ UeuaB6xuEMKAuO2er4tTHl6nnqLYFhp3cVlpSjYdLPixQ+LiftXKxXrVR/yZyFBXoNOd Lhq3AcrCRnUztOUB5jHytrS1ThWbAhKG+sY2KiTBqpOHkJnNAV1JKp0BHNVWxwfDn19T MVx2jto9Vha1x3nOSAWHBx05RiaxRJ/oxZbwg9A0bH2Nd4InLvqZVBgG2bfLbY1T1KJl 2fzhERkF+5w1U0g7xhXvfa/E+Ve3Ej/c4eRn5Reu8wthcAkmS7uO2oHQdRt7c4qaBAn2 WjNA== X-Gm-Message-State: AOJu0Yw/UrBuWFNV1qBLO6HDZYNj2rrL/RA/d7oCfNfwKyYqrN7IUtQ+ DTfHiBUVpeY4mVSJXxt4em5KGPcu+k/tAWekHR83jOHPQHsc742Tjq1kyclLwHw= X-Google-Smtp-Source: AGHT+IEBdrXaLIEAJSf+gLMXh3CqISakDdJIKGpvNWM5NKCcrZ2QvmmwUHfeyZhNvS15Gd/pijn1Zw== X-Received: by 2002:a05:600c:4fc9:b0:412:a477:253f with SMTP id o9-20020a05600c4fc900b00412a477253fmr670935wmq.3.1709077784098; Tue, 27 Feb 2024 15:49:44 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:1db2:5037:305f:e60f? ([2a01:e0a:80d:9d80:1db2:5037:305f:e60f]) by smtp.gmail.com with ESMTPSA id ch12-20020a5d5d0c000000b0033dabeacab2sm12914851wrb.39.2024.02.27.15.49.43 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Tue, 27 Feb 2024 15:49:43 -0800 (PST) Message-ID: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> Date: Wed, 28 Feb 2024 00:49:42 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Port tree linter To: portmaster@bsdforge.com References: <92ef9ee5-9ab7-4b33-94b2-e567618833cf@gmail.com> <c139e647ebb30377e52a770c552553b7@bsdforge.com> Content-Language: fr From: Hubert Tournier <hubert.tournier@gmail.com> Cc: ports@freebsd.org In-Reply-To: <c139e647ebb30377e52a770c552553b7@bsdforge.com> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; TAGGED_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Rspamd-Queue-Id: 4TkvNW54GQz4Qkq Hello, Le 27/02/2024 à 23:54, Chris a écrit : > On 2024-02-27 09:50, Hubert Tournier wrote: >> It's called portlint2 (https://github.com/HubTou/portlint2), and it >> checks the >> ports Index file and the port's makefiles, for the whole port tree, >> or for >> selected categories / maintainers / ports. > While I haven't (yet) tried it out. I'm grateful for your work. It'll > potentially save a > bunch of work, Thanks! There's an example of output on a whole up-to-date port tree and index there:    https://www.frbsd.org/xch/stdout.txt    https://www.frbsd.org/xch/stderr.txt And an example run on your own 171 ports here:    https://www.frbsd.org/xch/chris.txt On a not up-to-date index, you would notice lots of non existing port-path and description-file, which is what caught my eye in the first place. That's because the portsnap method that I use to sync my port tree doesn't update the Index at all. The tool design is modular, so if additional checks are useful to someone, they could probably be added quite easily (use the GitHub page for these interactions). > Shouldn't this make it to ports-mgmt/ as portlinter? If it's deemed useful, I could make the port next week-end. Best regards, Hubert From nobody Tue Feb 27 23:52:33 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TkvRn0HLxz5Bx0D for <freebsd-ports@mlmmj.nyi.freebsd.org>; Tue, 27 Feb 2024 23:52:37 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-lj1-x229.google.com (mail-lj1-x229.google.com [IPv6:2a00:1450:4864:20::229]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TkvRm1L0dz4Rbs for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 23:52:36 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=mdNEoQ3P; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of hubert.tournier@gmail.com designates 2a00:1450:4864:20::229 as permitted sender) smtp.mailfrom=hubert.tournier@gmail.com Received: by mail-lj1-x229.google.com with SMTP id 38308e7fff4ca-2d094bc2244so58987501fa.1 for <freebsd-ports@freebsd.org>; Tue, 27 Feb 2024 15:52:36 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709077954; x=1709682754; darn=freebsd.org; h=content-transfer-encoding:in-reply-to:from:to:references :content-language:subject:user-agent:mime-version:date:message-id :from:to:cc:subject:date:message-id:reply-to; bh=KzR1/8L3e8kYAjlzpX3nLls8sUYVF1FuzxYMiIeLpAY=; b=mdNEoQ3PUfr0+pcfaMW9wfC+TS3Q9JJyj5bKW4Iw2gboThs0IqJ6C47H8nYQc2qEgd xhJ8MTnB9jPgYX5SJSeDPqw0rxPRcDcLw05ZQYUXUpc4AzUyV46pvGaVknb/WxUaIwmN tp6v33gKMP+nMzQ8gzXYeza7b39InkHvAuc8sslg0da2SiNoOfdQrXbMBlauLWZEP9TN 86vN/+WoEvp3Zk6aU/x6JfuXofUFtb8j83ZgJTVX8iGTjb2CniToLnt1AYRnkeKxzUpn cVixoWP7gPtaJv3URljVrq8YnjViPDPColBjEcA3tdwvM/7cCTCG4iuoEqq72T7tlmsh Ad7g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709077954; x=1709682754; h=content-transfer-encoding:in-reply-to:from:to:references :content-language:subject:user-agent:mime-version:date:message-id :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=KzR1/8L3e8kYAjlzpX3nLls8sUYVF1FuzxYMiIeLpAY=; b=rBOkJ5PjRmA0kFblxHMRe/bJq1cy1orAwZOF8+UKMltEwepu5hYVq+zSwKBhNZ7+UU U7jW72D5wZCeIc785ViqDBDb9W/kYR6i6jXf4TfTCuHdcFi/PZGxzsowhltGG1n8Wo9s JqYBhsaXk5L7ot7wAxRN9NkPJmBINXHBQK0SwUbgRg0CCvmu6n21bMHOI7hjo2RNXslK Giojnz5z8WBGarXJZFr6UhqexCCB2IDl1RzWKqMHAzaRgRUJ8+t9S+Kcnb4H4sRqNEM9 73TJl/YYWn8jkMmD+9d8fiNupF5DGkNscu073TdPGaaeDDezGU2NqOzKBZwtq1ksZPHd F/qA== X-Gm-Message-State: AOJu0Yy2TPhrJQlPM5IMzaa33q4FWqni8DWImxsYpmV5dBPw2otuLqqG 1lU59ZwK/ffSMZfvbuSL9yZ7dMLyK2fkzO3cYMMyfnPRcx/XVC8xwiOZI+kRfUo= X-Google-Smtp-Source: AGHT+IFN4Z+mLJ8TRPyfdY+Gcy+MGWE16CX7ANQPdVnWqMmOBDtOtvFtAvy3kyCGA5BjtdWdt8LU/Q== X-Received: by 2002:a05:651c:2c4:b0:2d2:7580:e220 with SMTP id f4-20020a05651c02c400b002d27580e220mr6197690ljo.15.1709077954276; Tue, 27 Feb 2024 15:52:34 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:1db2:5037:305f:e60f? ([2a01:e0a:80d:9d80:1db2:5037:305f:e60f]) by smtp.gmail.com with ESMTPSA id z21-20020a7bc7d5000000b0041061f094a2sm262373wmk.11.2024.02.27.15.52.33 for <freebsd-ports@freebsd.org> (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Tue, 27 Feb 2024 15:52:33 -0800 (PST) Message-ID: <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> Date: Wed, 28 Feb 2024 00:52:33 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: re: Port tree linter Content-Language: fr References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> To: freebsd-ports@FreeBSD.org From: Hubert Tournier <hubert.tournier@gmail.com> In-Reply-To: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> X-Forwarded-Message-Id: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.89 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.90)[-0.903]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[gmail.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; ARC_NA(0.00)[]; TAGGED_FROM(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_DN_NONE(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::229:from] X-Rspamd-Queue-Id: 4TkvRm1L0dz4Rbs Hello, Le 27/02/2024 à 23:54, Chris a écrit : > On 2024-02-27 09:50, Hubert Tournier wrote: >> It's called portlint2 (https://github.com/HubTou/portlint2), and it >> checks the >> ports Index file and the port's makefiles, for the whole port tree, >> or for >> selected categories / maintainers / ports. > While I haven't (yet) tried it out. I'm grateful for your work. It'll > potentially save a > bunch of work, Thanks! There's an example of output on a whole up-to-date port tree and index there:    https://www.frbsd.org/xch/stdout.txt    https://www.frbsd.org/xch/stderr.txt And an example run on your own 171 ports here:    https://www.frbsd.org/xch/chris.txt On a not up-to-date index, you would notice lots of non existing port-path and description-file, which is what caught my eye in the first place. That's because the portsnap method that I use to sync my port tree doesn't update the Index at all. The tool design is modular, so if additional checks are useful to someone, they could probably be added quite easily (use the GitHub page for these interactions). > Shouldn't this make it to ports-mgmt/ as portlinter? If it's deemed useful, I could make the port next week-end. Best regards, Hubert From nobody Wed Feb 28 04:16:48 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tl1Jd5hCFz5CZqV for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 04:16:49 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tl1Jd1l8Sz4nlR for <ports@freebsd.org>; Wed, 28 Feb 2024 04:16:49 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709093809; a=rsa-sha256; cv=none; b=q9qyxz38nVQfEWr9xNdYBHGMxdJrVjdxOfUgXAgycVx9QWsJeHxahbiYnDhsvAOYCMdzuK hW+ECYUgYnxEp13TjoPRWQ7SqMHFLd0FfFpugMFjEoW6d4twPMdq7uqpocZ5oLR68Z8SMp jtYHCMKwpPqA5f/LjOt4AriRmiuZRjALi3c1HZA3PPsoizz4o0/188rlj/LGi8LtOqIh3b Ey+CoHzQbUrbyeJliobhU+YgHx1TCQ4pnuXwmnRFoxGt52rJieqNLod2O28mJheOWgbLym V9a1NMiuDbXsqsoifWt2XE1arTUro8AnPDLjguURPAscG+McXlFW01+GZKhnBg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709093809; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=x512ElVbymDM+ZVJumQ14CayT5y5+5eVc24MOXg8PFI=; b=HFhofQPcG58a6o9Urp6q/t8LaQ9+Fz/X9C4+3w41VY769OuIIHVSzMNeCRjrSp0qZ2LE// NfpjavAIFBD8FAtkgSib8Wlm021DwV1outVcRop4SYoevc4foRDu0RpteWbX6Kh55weS3X Z6ju+WTxjHhHtTV4I/egQJg9ie/LeI4u0YhUlxhWAQ87MsyTyY3mKUrBYkRQzAKhLIr6e3 C+PY394xQ6583MgF5CWPX/y+ROQwwxMO/pOlXHpgWgcQgiqQRw8h7EZ8ZGssPMbSBAbchw KmVkjqyk7e/F65ANknMm/PVFXjanfLM3kOFh/68/z8+On1FsaKxMFsuDLnj9Lw== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4Tl1Jd0NGRzhsH for <ports@freebsd.org>; Wed, 28 Feb 2024 04:16:49 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 41S4Gmdp023570 for <ports@freebsd.org>; Wed, 28 Feb 2024 04:16:48 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 41S4GmWU023569; Wed, 28 Feb 2024 04:16:48 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202402280416.41S4GmWU023569@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Wed, 28 Feb 2024 04:16:48 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ cad/ifcopenshell | 0.6.0 | blenderbim-240227 ------------------------------------------------+-----------------+------------ devel/py-cle | 9.0.5405 | v9.2.92 ------------------------------------------------+-----------------+------------ security/py-ailment | 9.0.5405 | v9.2.92 ------------------------------------------------+-----------------+------------ security/py-angr | 9.0.5405 | v9.2.92 ------------------------------------------------+-----------------+------------ security/py-pyvex | 9.0.5405 | v9.2.92 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Wed Feb 28 07:32:26 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tl5g96g7jz5Cqtk for <freebsd-ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 07:33:09 +0000 (UTC) (envelope-from Alexander@Leidinger.net) Received: from mailgate.Leidinger.net (mailgate.leidinger.net [IPv6:2a00:1828:2000:313::1:5]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature ECDSA (P-256) client-digest SHA256) (Client CN "mailgate.leidinger.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tl5g74yNQz44dV for <freebsd-ports@freebsd.org>; Wed, 28 Feb 2024 07:33:07 +0000 (UTC) (envelope-from Alexander@Leidinger.net) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=leidinger.net header.s=outgoing-alex header.b=KKzdq1fR; dmarc=pass (policy=quarantine) header.from=leidinger.net; spf=pass (mx1.freebsd.org: domain of Alexander@Leidinger.net designates 2a00:1828:2000:313::1:5 as permitted sender) smtp.mailfrom=Alexander@Leidinger.net List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=leidinger.net; s=outgoing-alex; t=1709105571; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=IoKIJSAN1stXNe1f4i+3qTwnCJE3JLPm6v7lnixnvH8=; b=KKzdq1fRYTpIvkn4TEsYTylJ4W1Ad1o7NIto5+WAMrtMgju5o8l57zqTCpxNu5RUfuLoRU sp/socD0kVCb7wv4rUMGxzW/nW/JCXT4cdzy2Avr0O+4u5GS2Y1v/7owlwgu6pJ+hEm5b1 w/d7gAUp5muVUf9KkDrxM6QBhV9WrNxuxOeHfHKiiHbsm79XA94PZf823r65LfPgwlQ4g9 kU4ArwP9h6gAAXO9S6gRFn/XHryfw589WGryGZ7fzdm7EllwIsf0Upsm7k5TjIgsbWTz4I TBelIld9+H3doI65WuieQGGBGcAF+aoTehpy2pupKCwUcTCIVa4gacST3hgO7Q== Date: Wed, 28 Feb 2024 08:32:26 +0100 From: Alexander Leidinger <Alexander@Leidinger.net> To: Hubert Tournier <hubert.tournier@gmail.com> Cc: freebsd-ports@freebsd.org Subject: Re: Port tree linter In-Reply-To: <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> Message-ID: <46af7b220502ded8fb3848f279546da3@Leidinger.net> Organization: No organization, this is a private message. Content-Type: multipart/signed; protocol="application/pgp-signature"; boundary="=_42e9fc8b6445ef79fb72bfc1ac9a6f12"; micalg=pgp-sha256 X-Spamd-Bar: ------ X-Spamd-Result: default: False [-6.10 / 15.00]; SIGNED_PGP(-2.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[leidinger.net,quarantine]; R_DKIM_ALLOW(-0.20)[leidinger.net:s=outgoing-alex]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; ARC_NA(0.00)[]; ASN(0.00)[asn:34240, ipnet:2a00:1828::/32, country:DE]; DKIM_TRACE(0.00)[leidinger.net:+]; MIME_TRACE(0.00)[0:+,1:+,2:~]; HAS_ORG_HEADER(0.00)[]; TO_DN_SOME(0.00)[]; TAGGED_RCPT(0.00)[]; FREEMAIL_TO(0.00)[gmail.com]; MISSING_XM_UA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCVD_COUNT_ZERO(0.00)[0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; HAS_ATTACHMENT(0.00)[] X-Rspamd-Queue-Id: 4Tl5g74yNQz44dV This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --=_42e9fc8b6445ef79fb72bfc1ac9a6f12 Content-Transfer-Encoding: 7bit Content-Type: text/plain; charset=US-ASCII; format=flowed Am 2024-02-28 00:52, schrieb Hubert Tournier: >> Shouldn't this make it to ports-mgmt/ as portlinter? > > If it's deemed useful, I could make the port next week-end. If you do that, I suggest to use a name which makes it clear that it is not a replacement for portlint (which operates on 1 port), and that makes it clear that it operates on the whole tree. Maybe portstreelint, or portstreecheck, or ptlint, or ptcheck, or whatever, but not "portlint*". Bye, Alexander. -- http://www.Leidinger.net Alexander@Leidinger.net: PGP 0x8F31830F9F2772BF http://www.FreeBSD.org netchild@FreeBSD.org : PGP 0x8F31830F9F2772BF --=_42e9fc8b6445ef79fb72bfc1ac9a6f12 Content-Type: application/pgp-signature; name=signature.asc Content-Disposition: attachment; filename=signature.asc; size=833 Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQIzBAEBCAAdFiEER9UlYXp1PSd08nWXEg2wmwP42IYFAmXe4ZkACgkQEg2wmwP4 2Ibdfg//TuHKkQshQ5mEGODrX1cA8kjn76o2446VoHtJlujpl8g0tpXm5P58fjre 6rPok1XD3jLBJbKp2Zm6SPQfjAbAJTllKcKc3E7PTUuutcVQq9ZBocniM80Cankc JRZoRghel3vmazfjWQyTSPWvzxTeCm01eunWawkhgMJcWT/LBFLpHu0Ej+xiEdRX OTsPD6dSPf+jNflD2/kMLtMbjwYC/OTZRqXYDDIstrh0DvdYPyK4B6iyA3gGUT1c bAkeHHhaLpulhH2ACwJmSdWjEeBQGQoHKkP+bVB+EjMnYLfz0WaDq8m/yOK8tEcP Y7Qs/u47r/Ef521VOOJNBbmUwYlMoAPTmRl4PE35OA31fYoL4UNMawmdWMSFBI/G i+Vl4NiaVLgtw4pkb3SWRmrSvBRc/qYFhLI8hs8aeadOSbmoegTgApnk+nd4D/EI JZWEKeYiKlvcGyP+8vImzlOzzUmKGCsG6AExj4Fo/S/vMTVQGCshXPY0cdKx1gXT woTZl5fQ2IkqorA/+6h8/QQ/k89XVqxC8+lbNTkNIQmT5ImbfoEIHzX66UWwI+xX UnrECL3yYJi731KXBQfNtf/DiV+LQLnaVd6cEwaWWNj4AOY1zPfSeWy56bAm3YU+ DBtwjHQ9BPx/NYPH4vxR32C8/9WHnzqEcQdKlnKS+b9YalccSlc= =mz6x -----END PGP SIGNATURE----- --=_42e9fc8b6445ef79fb72bfc1ac9a6f12-- From nobody Wed Feb 28 07:36:31 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tl5lQ4T18z5CrKC for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 07:36:50 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tl5lQ3xccz45Mj for <ports@FreeBSD.org>; Wed, 28 Feb 2024 07:36:50 +0000 (UTC) (envelope-from bofh@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709105810; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type; bh=eY+ELs5cCrt9D/BAyNTr00AS6Rd6Qpu5PWFPzF7+EVQ=; b=U5jeZ5zeWNYyWlzWC2vTR4KC8JX2wROWSwZ7Vtdsxaw0fLB0bzDj+6IGQgKYliTHqGO7/7 xxb5GPKbx+tRWE6ziyImsoLvsjHgnV38PdK0Xq2V2RzABvF2cTMs2i0TChOPmTPfBCOsce 5ViQj6blGUK6njiNo8R+reIt4uQU8xAotOKwjz8wmWNLsAtDVgVa6nYk4SnKykCud9K6b+ rZRovQ4YPtrPqn35OBy3al+QSP+ePJlPYr8Ikhvd4/1jGd8z1TLfH5YLkh4xOGa7deFm/l R+yHSUalM2M5y16wdOCsebye4PiePjImWvDvulY4jXkEwFzmRWRE/906CA4mrA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709105810; a=rsa-sha256; cv=none; b=CF57lk9dfuySpHobBDBo+W4dWZnJXGdWsPDojybkepf3NX9ZSom4tPFBdJqG7pAiffcllV YxpKR0T7/miYSnopco/WUQnb76BJEKqJldKhYC2B4rBDhxMe6nap4+BvDzhTQvubwRBfMt B8uBSuUPFhrliu9tRu1mIMeYLfYvPO4bQcSZY6HA+3i2lxjfVuwq6WqOcBi3oQfAoKoetd Aq9d3oLo1JouQqgeZiCHNqgiIhmiKYYvgZLHw8R7LFAFe0xWGXzWE6rPXmIBhjzIj2TY8f Oity7LRRMGxj8cv+cojbbYRjSELcgA7MBNB/NPzjENct20/Hjr8XIrYAwwDJXA== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709105810; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type; bh=eY+ELs5cCrt9D/BAyNTr00AS6Rd6Qpu5PWFPzF7+EVQ=; b=opGidaGhJ8ukAAa0iUP6cD1N8GDTd08F9RsXSlzb11jH3CMdw6AqDdMFIMMk3n4M2KoFW5 Wu8gvKDDcGkIbH9rUszuzd5qCzc7U4CyBOLBjbQ09DwSu3v3RcOF/yemTF9AKPcTelI9jN x4mVkMzXEch3fdwemAgsTv/3NRPMpgBYOlJxgPKv9hYIUgQGnPIj9WZxGKVT1Md8AQdg7Q vkDrMuTcEC+mkcquqVPyQD2vLPfOvILzD2W+IyQn9lbqJJYeSlr2cFNqMqnHSY/7SQJ2+K npsah8MY62YtMgRGzWIDbFKt2m284OO38e3X65xFEzLvSBrZaah5Xf3v+rpChA== Received: from mx.bofh.network (mx.bofh.network [5.9.249.227]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: bofh/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4Tl5lQ166Nz10dn for <ports@FreeBSD.org>; Wed, 28 Feb 2024 07:36:50 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtpclient.apple (<unknown> [217.117.226.147]) by mx.bofh.network (OpenSMTPD) with ESMTPSA id f69d4874 (TLSv1.2:ECDHE-ECDSA-AES256-GCM-SHA384:256:NO) for <ports@FreeBSD.org>; Wed, 28 Feb 2024 07:36:47 +0000 (UTC) From: Moin Rahman <bofh@freebsd.org> Content-Type: multipart/signed; boundary="Apple-Mail=_D83C0C7E-3E29-4A7F-B12F-1B3C0A934FAB"; protocol="application/pgp-signature"; micalg=pgp-sha512 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.700.6.1.1\)) Subject: Mass pkg-fallout reports with missing share/pixmaps Message-Id: <2A581684-3D6C-41C5-BE46-C8AE0BAB729A@freebsd.org> Date: Wed, 28 Feb 2024 08:36:31 +0100 To: freebsd-ports <ports@FreeBSD.org> X-Mailer: Apple Mail (2.3731.700.6.1.1) --Apple-Mail=_D83C0C7E-3E29-4A7F-B12F-1B3C0A934FAB Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=us-ascii Hello everyone, While working on moving the man pages I made a mistake with the mtree which has caused mass build failures with the errors like the following: install: /wrkdirs/usr/ports/../../work/stage/usr/local/share/pixmaps/*: = No such file or directory pkg-static: Unable to access file = /wrkdirs/usr/ports/../../work/stage/usr/local/share/pixmaps/*:Not a = directory This was caused by this commit: = https://cgit.freebsd.org/ports/commit/Templates/BSD.local.dist?id=3D2ba14d= e447a2358322a291cd5680ff40f38fc0d0 And this was also fixed by antoine@ on the same day: = https://cgit.freebsd.org/ports/commit/Templates/BSD.local.dist?id=3D5cd70c= b3b790012a0ba43c12fb0ceafe5bec2ab4 Seeing from the time line and how much our builder takes to build the sets you might receive the messages for one more day. Just ignore it for now and no need to add any MKDIR directives. Sorry for the noise. Kind regards, Moin --Apple-Mail=_D83C0C7E-3E29-4A7F-B12F-1B3C0A934FAB Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=signature.asc Content-Type: application/pgp-signature; name=signature.asc Content-Description: Message signed with OpenPGP -----BEGIN PGP SIGNATURE----- iQKTBAEBCgB9FiEETfdREoUGjQZKBS+fvbm1phfAvJEFAmXe4n9fFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldDRE Rjc1MTEyODUwNjhEMDY0QTA1MkY5RkJEQjlCNUE2MTdDMEJDOTEACgkQvbm1phfA vJFn1hAAlJfZdYvznUgl/fs/jKxSaWkZ7mJnPT5FEq2vQdAfiRjtZWniM2Napi5X V8WOd1ePUndXy+ZFHXzL2UOnVoPN8dpgjfQJAruAFCEIjWt40gLMIh8axdA5qGed +A5txuLjZcJi842aeRaOIl9jAwzfpXYTNoGqU8Y0ctf4A1qRCS6bTlrvKp4j13Zq Bd8n2TJ4fZtHBsbIm8oKEHG3mEARTyj22uNxh5lMGet4TyvhaOEIEeGYK1FzXgVp C9Td0SrYUBjHFDMiY/4FdHZPZon1zB/UAAf1maHI0dZxrvXPcumIM8jhqyUKhHrU LhzRD8hMhC0DS8bT7WY4H1z6CJwYEuYe0yEudfKz9ytKtcWRVt5JThnY8CMm9u2m YyMExq63LyMKR28B0lkZxDFEBxlHOLegsQi0mj2dQ+0L5ij07AqlNgoshoWTN4z2 SP/x/y+l2D6Ni9qnF2ukljZ28kdkTSObexE8kBGCTCKGpemhkm61+VXr5p/guVft NOQO63YLU6J/NiZ003QGds14e2hMg6mAVel/KF2NTSBz56rZX6SVmC8b8Hb3O1To rmua3p9hKNuccMr41+yjXS/iSrceQ6SzxWqwsocEBAgrU5UeTe0XSDDwjE6ywq5U 2OeJD61JnDym8TLN431fEsYVusCl+Dwdz7hk+byfHGvEw2HA1VA= =erJn -----END PGP SIGNATURE----- --Apple-Mail=_D83C0C7E-3E29-4A7F-B12F-1B3C0A934FAB-- From nobody Wed Feb 28 19:22:34 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlPPq55Kzz5CHL3 for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 19:22:39 +0000 (UTC) (envelope-from flo@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlPPq4dNcz4Njn; Wed, 28 Feb 2024 19:22:39 +0000 (UTC) (envelope-from flo@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709148159; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=Yxct7+m1BHl06R8J3SeG2Ms+cqv9iPP7qnaHOGfTSew=; b=TFGMaULUB02YWArlOUhxCiqHLv2aC8owrU6gEQ2uEo8YVkU7DshBXQatdZono2o92Ga0kv iKsPbbzCiAyAGo4o8pWk4AwuZhVqYzfcAr2VdByi3zwtPwln/K1WU7jgcNo9Zbdpop/Zz8 06rMiOYV22cwaECTG8LN/Nx5YGPGnRO1jY25jG7PFEGJdR3x9S4omlcudk1ISiTfoQ4Ekg h2J5EQme3GHxwtWoZ/c1X7c1CMnrU8pO/yJDA7V4s1rJ33nWgKovhwRdxvHctaGAiOIL0O q9/BvxYizJNcxayxeZOjiZ+vf4Nq5VPkiUlOuuPMUNifFCMFcjNN+xfqfbQKAg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709148159; a=rsa-sha256; cv=none; b=Ve003n+E6CDxbiQK2RM5ptaa3khToxkgZ8fozKMw7sB8XBZcl4vZa83rbOzrLRlUfme3jk icJdz3FYWqC5wuHwyREgQX07qiwHo2biDX8MXs7hYCGHTuuchAOFpaWlxYBi/+4ntpXWmM F6fn8RPWWfIZF3VCRBDkMwnfgKxEjJdxntf0UTVo2uoWFeIdz7t7TBOACLr/EtZ+QrAth/ marOeAqdTLWJqgI1HVRQc4hzM8Xu5KXxKbheB0Ci5lDx47RFb8nWAb4LamqYxblD75T/mo tCXD5Lrv4D9udD/A6/kVW265jy4kQPWC5rMToiLD35TvWJZ0NbczfdqC4B41og== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709148159; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=Yxct7+m1BHl06R8J3SeG2Ms+cqv9iPP7qnaHOGfTSew=; b=xEM3k7g61sbQHxYEzRrOLXQOdlVrzwiC1vUEEGlQoa1/YIvNsBXJAlHfW09GbzMfF4md+h q544xAu9AE2L7sU2X2kn7ZqU68NT0Bu8M/7AoLQvttQkcbS4Tk/RdlgKt8GKXd/QksUMbp vcpkuQX+fI3AR9xTS3Sc6wGPU0Mlh97w4fms+jxUOikFHdNjt/VhrBH03Ms6EySJMily/P 40KkOdVNAJQfl3npbgWCqT4harEr2izVepbaxZ2mclyt6JUl0Jkz/FERYc6zziy4Ju8Tij icQnLDJQRGIIWkZ5PVQNoY3a6InZh0x54q2lNrbTUwmqAJf7MjgsFAC7A+m+jg== Received: from [IPV6:2a01:4f8:10a:fd43::dead] (unknown [IPv6:2a01:4f8:10a:fd43::dead]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: flo/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TlPPp6LSQz1GRd; Wed, 28 Feb 2024 19:22:38 +0000 (UTC) (envelope-from flo@FreeBSD.org) Message-ID: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Date: Wed, 28 Feb 2024 20:22:34 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird From: Florian Smeets <flo@FreeBSD.org> To: ports@freebsd.org Content-Language: en-US Subject: Proposed ports deprecation and removal policy Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit Dear ports community, as the removal of ports is a recurring source of friction and dispute we would like to add a ports removal and deprecation policy to the porters handbook. We tried to find a sensible middle ground between too fast removal and keeping unmaintained and abandoned upstream software in our ports tree forever. When can or should ports be deprecated or removed? This policy should give some guidance on when ports can or should be removed. In general ports should not be removed without reason but if a port blocks progress it should be deprecated and subsequently removed. In general, if a ports blocks progress for some time it will be removed so that progress can be made. For more details see below. Ports can be removed immediately if one of the following conditions is met: - Upstream distfile is no longer available from the original source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not count as "available") - Upstream WWW is unavailable: deprecate, remove after 3 months - BROKEN for more than 6 months - has known vulnerabilities that weren’t addressed in the ports tree for more than 3 months A port can be deprecated and subsequently removed if: - Upstream declared the version EOL or officially stopped development. DEPRECATED should be set as soon as the planned removal date is know. (It is up to the maintainer if they want to remove the port immediately after the EOL date or if they want keep the port for some time with backported patches. Option two is *not* possible without backporting patches, see vulnerable ports) The general suggestion is that EOL versions should not stay in the ports tree for more than 3 months without justification. - The port does not adapt to infrastructure changes (i.e. USE_STAGE, MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set to DEPRECATED after 3 months and can be removed after 6 Reasons that do not warrant removal of a port: - Software hasn’t seen a release in a long time - Upstream looks inactive for a long time Florian (on behalf of portmgr) From nobody Wed Feb 28 19:31:33 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlPcM6XdVz5CHg8 for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 19:31:47 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Received: from mail-ej1-x634.google.com (mail-ej1-x634.google.com [IPv6:2a00:1450:4864:20::634]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlPcL3LVpz4QM6; Wed, 28 Feb 2024 19:31:46 +0000 (UTC) (envelope-from aryeh.friedman@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-ej1-x634.google.com with SMTP id a640c23a62f3a-a440b1c445eso17440766b.1; Wed, 28 Feb 2024 11:31:46 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709148704; x=1709753504; darn=freebsd.org; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:from:to:cc:subject:date :message-id:reply-to; bh=AOLmXEmhcd9NGWsjdOJe/l9km/5X6BEkMAU9FyaAwvo=; b=c6Q2ZRzLFyUXP/eItjzPFMwBsdpeySFShnx4K21DaQuV7/HpDFNLa0600Z8T1VTLZf DFnGm5eXHyCUxPrTjS3lu+j28jDQR6K1SAZrnMsFmWpkNBwDoejYfT3+9HAIPA+jAvKr RuONvyeV+De0Aw657JFfqDAPXv7SvKvjGTJhOwxa3KywYmAB4bdEpUjunq4Lvs7q3AbM zDOZ7WqJhTffKcengS/9W8pJLq5EhzsknH6/Q0wPhXxKvk1rU2QCWP4987pR54P/ZdG8 qTAhjGP61q65RylUgR9PwLDfxB63cOu9yCfyUAGRa8xgNn8uvAdwZR19Ity3fRRjPPgi GlzA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709148704; x=1709753504; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=AOLmXEmhcd9NGWsjdOJe/l9km/5X6BEkMAU9FyaAwvo=; b=W30t0RUao4dwVpw1u2GsvG1Nwc3q9JOpoG5FudN4IxTZxw7HikcEF4rTD+WwPaERnG Nvp3GXaLoaGaGvfzoPTm5tByIiRIpTOtwOMKl4lrHmyWqFI3GsN0K461MiOyWnf7g/Eg VggO1SQlXsiSfzR0hqMbVlcCyUS1jCsxnTl4KDbO8Ya0cGttZr16SNJb2V+P/6SEhJ5l FXB3o4QosNye7AA1cLELJ4PwaJ2syzpHq2/Ibil02tV9ALePSqlSY22TDGTb7+HzqzqH rLeI+9P+ajKf4Glkv8G1/Lk4XLwnMDdmnO3WVSe4GRiIsQZbAH9eGwyht6Nr0Q2yFE69 wmPA== X-Gm-Message-State: AOJu0YzmjoTeWvcfiXybVTWD6Qb+h38ZkAdPzZulkA3XWTEnK9tsfSvw PATQMqVMsktk36c4uh6C3qEnKybniM1cQgdfMFpL75iipHRwwMGT1q7PwMPBfmeDwWAlzG91Ccj hpXHBJd9ZSA80ml3hTCZlzDk6Ulqjam+AQIc= X-Google-Smtp-Source: AGHT+IFGtbsD22mZDqBtlP6BL6aGGQNvFMcMzHqs6wguGEdeQ2KADsl+ods5s+g3YQB164RtSP5uf/qSoZVzdj2rfMk= X-Received: by 2002:a17:906:c2ce:b0:a43:ffe1:7d1 with SMTP id ch14-20020a170906c2ce00b00a43ffe107d1mr145914ejb.17.1709148704042; Wed, 28 Feb 2024 11:31:44 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> From: Aryeh Friedman <aryehfriedman@gmail.com> Date: Wed, 28 Feb 2024 14:31:33 -0500 Message-ID: <CAGBxaX=jyEEfqcE2hYs93+sKt_ax--7yJxD-17bvj9qgQnpdvA@mail.gmail.com> Subject: Re: Proposed ports deprecation and removal policy To: Florian Smeets <flo@freebsd.org> Cc: ports@freebsd.org Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; TAGGED_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Rspamd-Queue-Id: 4TlPcL3LVpz4QM6 On Wed, Feb 28, 2024 at 2:22=E2=80=AFPM Florian Smeets <flo@freebsd.org> wr= ote: > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set > to DEPRECATED after 3 months and can be removed after 6 Does this include special cases such as the following comment in devel/aegis/Makefile (which I am the maintainer of and since the upstream is "dead" it was a single person who died in 2012)? # XXX Manpages are installed into ${DATADIR} too -- there's no easy way to # stop this because we don't have Makefile.am provided. Maintainer wil= l # sort this with upstream. Note I have updated everything to be built with the latest llvm and stuff. From nobody Wed Feb 28 20:00:16 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlQFS1Tq3z5CKsG for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 20:00:28 +0000 (UTC) (envelope-from SRS0=IaDc=KF=quip.cz=000.fbsd@elsa.codelab.cz) Received: from elsa.codelab.cz (elsa.codelab.cz [94.124.105.4]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlQFR5f6mz4S7g; Wed, 28 Feb 2024 20:00:27 +0000 (UTC) (envelope-from SRS0=IaDc=KF=quip.cz=000.fbsd@elsa.codelab.cz) Authentication-Results: mx1.freebsd.org; none Received: from elsa.codelab.cz (localhost [127.0.0.1]) by elsa.codelab.cz (Postfix) with ESMTP id 1FEA1D7891; Wed, 28 Feb 2024 21:00:19 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1709150419; bh=Zq6r7V5GdsepLss2WpNm/QlclxK1rIcCRmm2V+1Okf0=; h=Date:Subject:To:References:From:In-Reply-To; b=tlPHa36F6P+sYjlGvF/ZinKgV/Gdx7GAvuFZRz1q19Z0MXDb0QfBowba1TgG3wycN mo6TNqE0kOKvZWhHf/juSxtPiDcaSznav5UniuriGF3RBtJH15RrxwnlWMkbB3haab 26J4y01qEBkasW40cWNpD9tdvex18qxKCwR1VWIw= Received: from [192.168.145.49] (ip-89-177-27-225.bb.vodafone.cz [89.177.27.225]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by elsa.codelab.cz (Postfix) with ESMTPSA id 402E3D7890; Wed, 28 Feb 2024 21:00:17 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1709150417; bh=Zq6r7V5GdsepLss2WpNm/QlclxK1rIcCRmm2V+1Okf0=; h=Date:Subject:To:References:From:In-Reply-To; b=It1tHk0ZMuNFTkIPE1FzfpL4EyyLmrDzFEol/A5fYcF3MwnTcizILkCuP/ff4uRkW 72Qyshppsvf17xEdp+MuyVPQGdzI4InjqqKNnVcdZUF98eaTXT7jcpUEARMaV5QclZ VnJA2phvx5FbYaZYH9sBx4aX6zEUZ4JXqw1Q4/zI= Message-ID: <fb42e7b5-be11-4d6f-bacd-90bfd361ed48@quip.cz> Date: Wed, 28 Feb 2024 21:00:16 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: cs-Cestina To: Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> From: Miroslav Lachman <000.fbsd@quip.cz> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:42000, ipnet:94.124.104.0/21, country:CZ] X-Rspamd-Queue-Id: 4TlQFR5f6mz4S7g On 28/02/2024 20:22, Florian Smeets wrote: > Ports can be removed immediately if one of the following conditions is met: > > - Upstream distfile is no longer available from the original > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not > count as "available") I miss some sort of time frame like in the following cases. The way the sentence is written now, it looks like there may be an immediate removal on the first day of the outage. > - Upstream WWW is unavailable: deprecate, remove after 3 months > - BROKEN for more than 6 months > - has known vulnerabilities that weren’t addressed in the ports tree for > more than 3 months Kind regards Miroslav Lachman From nobody Wed Feb 28 20:13:35 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlQXj186Kz5CM2K for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 20:13:41 +0000 (UTC) (envelope-from flo@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlQXj0df6z4WHw; Wed, 28 Feb 2024 20:13:41 +0000 (UTC) (envelope-from flo@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709151221; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=X90mOLsMEV1R/ncwEF6dZcQMoaHjRhpJ0k+cVo0te1c=; b=iR0F6Kbo93K/kqH6dWb/EnAgHYTCjUiVjgD0qQ6VCnjNZbTIK4uOUqrJePQTi+CKe3mvSk ZDDQJOin0jTy7dZCwKI6EzWy16l03MQ/grvCd/98YY1h2Ys/wP+sJInKc4T8ZZOvODQN39 ZzjwiVJECTPCC8b/f/kn5NT3M80JTAk0W0OR2MG4aJqKs31JrDBWiZOC9j8mPw5zNpATdY wJFDXzq3ck2iR4aa9+NkAPLsf4lDeMePTmYZ79YhMMRN7q9RYegDU1lasBlvOIGj7WJx1y E46ICPybsjjZnZoZd8JBPJzOpMbpCTZBj0CTCO7inKzOL9K3IcmitPxRkTIH5Q== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709151221; a=rsa-sha256; cv=none; b=NCOr8dp2u/3w59S8D+TtPAeAFUuHSrz0+6kGWLHIPmGbGrqn4w4hjeglj9yqpuEKVp2ts+ Fb0BITOXBSNNly1c9aKAcEdhsrJZB/5QMgocy4+QGdap2VeVlbiQ3PhmRACKBV3TnepmgZ JMQzmLco9X447QnMgsEDr4Rnj01OCgYK7pcBe+7zBfkfJYQcWrn3A4ynXhId3c54MANzGv ai+ZzNUzjHDAsbLRgVsoHKX24UxPW4IKmPPaor5xm/ilhJjgaGVbdS5HAsbCE1HfYRJeFj A0kBveOBL/IkC4s2KS5BR80Tecvh8yUQoc3rOycoQ7UleHpHwo/Qb+x0/Ts+yg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709151221; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=X90mOLsMEV1R/ncwEF6dZcQMoaHjRhpJ0k+cVo0te1c=; b=vbQd8rQuOkXBCE2UzWZey5laLBdlekjKX0oDeY+a0mJ0paP7fducSDtDv5s4rL3CoVa72C TaeStNqftJgz1vE8fs6VMGEpyHN6ThEMb83E9JRJ8JQiB0Loa1yXelXAzsZTdt/ZPF+32A yR7Y/HDXwOnxEkV2LBXb+RVj3wfHtNuoCDoNqpdsXoK/UmxoKfVLhA1bsDekd8ornujxHt sFDh2c4HGutywv24ou6E/0jE6h9T+g4eYUyHqPWSEafU+A0K2aRVJp4P5woo06xVhuuacP /gKcj1SDePt6dLolHQWe4X0U80WpWDdMWLaT4+SAoO9m2sraKBinE0lMk7Waog== Received: from [IPV6:2a01:4f8:10a:fd43::dead] (unknown [IPv6:2a01:4f8:10a:fd43::dead]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: flo/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TlQXh0Ztcz1J1Y; Wed, 28 Feb 2024 20:13:39 +0000 (UTC) (envelope-from flo@FreeBSD.org) Message-ID: <1500d4f4-2bdb-4d3b-8848-900346f4d194@FreeBSD.org> Date: Wed, 28 Feb 2024 21:13:35 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy To: Miroslav Lachman <000.fbsd@quip.cz>, ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <fb42e7b5-be11-4d6f-bacd-90bfd361ed48@quip.cz> Content-Language: en-US From: Florian Smeets <flo@FreeBSD.org> In-Reply-To: <fb42e7b5-be11-4d6f-bacd-90bfd361ed48@quip.cz> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit On 28.02.24 21:00, Miroslav Lachman wrote: > On 28/02/2024 20:22, Florian Smeets wrote: > >> Ports can be removed immediately if one of the following conditions is >> met: >> >> - Upstream distfile is no longer available from the original >> source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do >> not count as "available") > > I miss some sort of time frame like in the following cases. The way the > sentence is written now, it looks like there may be an immediate removal > on the first day of the outage. > Good point. Yeah, it certainly isn't the intention to remove it immediately. I will make a note to add a time frame. I'm thinking 4 weeks, as that feels long for a site to go away and reappear, but we might just make it 3 months as with most of the other points. Thanks Florian From nobody Wed Feb 28 21:09:52 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlRnZ4cZwz5CQbC for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 21:09:54 +0000 (UTC) (envelope-from vishwin@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlRnZ43pzz4bbN; Wed, 28 Feb 2024 21:09:54 +0000 (UTC) (envelope-from vishwin@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709154594; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references:autocrypt:autocrypt; bh=ay0ElYS4j7F6ehNjwvI5gwUdUoiEGVMgA4DmGrgxX9Y=; b=aB9Cqj4wB9m0hTTRjmOHf0ltga+YuhPL5uZnl+jfJrwTzTyPEPGjVbAkLXrsoMlY6rQU+T jWyVIieBPIrr6YOsTdpMmzXGpVJa3PF5DFuz/JgFZu1VdikaRUJL5JEGs0jDL6wO7bVeNx my3usX4pCPbs/D2y5wNXYyj1VcTsE1M/EASOjQGkte+zqa/5FVgbElk7Wo3jS9LqyqI0UH SBkU5SMg9gzNPcTOVAN1Va611R9EWaY8vC9Hr00+jvpYqjunjTwNW7qAjQaivi5kONHRgr u54U64TFc74bfVcSZRbDKRVL9K4gvXl8aZzG6cFB+USk6O/SEpXXNlaNZ3ptfA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709154594; a=rsa-sha256; cv=none; b=AcC3Y1c4K1Y77DRcGAzr2wPslMQkQcTm8LmCdXC/WaklfLnrhnEDpMH9yZM8fdujdKbSrg ahml0lRBibm50UppLgtMBlIKUwJ8PXfq6lkkylcgad8XjShwVcW80VOtKo329aJ2Dfaisz tEKsY5naNlHdBf5ahzrE8QlNOyzW8eDLnkvQ3xfH71o+SHrpYNg4rJ/tBmZGPZDOY3yrb6 9mVUHtp0B/WRYSSsC8RebcRDWYlU4JtR+fUFrxopJ1WMqB5lo75fsDRsCWqg9HhyTbQ5rI eb7c3aVtKNevhsYaHFnBxUtV2TkjuzQ2Gqnuqk11Bw2DvWWw5wn3+dnH/CbiOA== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709154594; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references:autocrypt:autocrypt; bh=ay0ElYS4j7F6ehNjwvI5gwUdUoiEGVMgA4DmGrgxX9Y=; b=NdjU4pMdPZDJ6shWaWJ6DMkkqwrt+dQ7cnlSnKD7tkt5SdlCILtYb6EaKpedTnjAy96LWg UcmmuYfbtXWFmHvB5xBY+zZ9y/YVdJ8YaKGG9HwHx0T257Npvd6L6lzNvoIKHLQ8dD0W9c oNJZyIspuL/Cupy22VZR+Kprl39znkl9MVqPIA5sv8YpBw9WqAbbZr3JhmJMZx+1Wch0C3 Zv8JXSOIiXKoTWKXzsXNtEgs7bAgBOtBVnRbDIHw0xBAIVA8UbRUZX8114qRjxZNgA4xPz CHHsCTlGD+uPJSkkx4nAtubSTeNuBGyPyZnHgyFtpLwLx703mV3NCocc6OLaow== Received: from [IPV6:2601:98a:d80:d0:56ee:75ff:fe50:69b5] (unknown [IPv6:2601:98a:d80:d0:56ee:75ff:fe50:69b5]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: vishwin/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TlRnZ1w9Mz1Jf5; Wed, 28 Feb 2024 21:09:54 +0000 (UTC) (envelope-from vishwin@freebsd.org) Message-ID: <6d0a6af4-01d8-4db9-9661-ce688dc8da03@freebsd.org> Date: Wed, 28 Feb 2024 16:09:52 -0500 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy To: Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Content-Language: en-GB From: Charlie Li <vishwin@freebsd.org> Autocrypt: addr=vishwin@freebsd.org; keydata= xjMEZFWWqBYJKwYBBAHaRw8BAQdAINFDmM+bgGkT1C4nD5a3BxgcH8Xnx5qTJbPuIBxD57LN MkNoYXJsaWUgTGkgKEZyZWVCU0QgUHJvamVjdCkgPHZpc2h3aW5ARnJlZUJTRC5vcmc+wpkE ExYKAEEWIQRTQA7vBfo8y1zE1rpnj5NgWEFcygUCZFWWqAIbAwUJA+3ogAULCQgHAgIiAgYV CgkICwIEFgIDAQIeBwIXgAAKCRBnj5NgWEFcyllaAP9CGICFEvTUOv5BYh/H8m49VJ87a/wd 0obeQfVBnS464AD9FopTHbjEs0HDV0ZYmJPxzJIznjumsj9gBxX0bBqqTgzOOARkVZaoEgor BgEEAZdVAQUBAQdA6BUWuG5RuT0vmtoDyCUUqiJGdtd78GM5ic3kw2AntSADAQgHwn4EGBYK ACYWIQRTQA7vBfo8y1zE1rpnj5NgWEFcygUCZFWWqAIbDAUJA+3ogAAKCRBnj5NgWEFcyn55 AP9ezKDCUgHqAq6JX976abb9pYdbSjxxNJqnrjgNkfhgIQD/QhR+fgnUHhcGTMBy+pYHZUGH 5DCuITsK1U4+v252uws= Organization: FreeBSD Project In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="------------8ZdVoqtv79mWPX3S0rmkZKtR" This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --------------8ZdVoqtv79mWPX3S0rmkZKtR Content-Type: multipart/mixed; boundary="------------yWx3rZUBFx2nzFBPtbuaEzaO"; protected-headers="v1" From: Charlie Li <vishwin@freebsd.org> To: Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org Message-ID: <6d0a6af4-01d8-4db9-9661-ce688dc8da03@freebsd.org> Subject: Re: Proposed ports deprecation and removal policy References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> --------------yWx3rZUBFx2nzFBPtbuaEzaO Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: base64 RmxvcmlhbiBTbWVldHMgd3JvdGU6DQo+IFRoaXMgcG9saWN5IHNob3VsZCBnaXZlIHNvbWUg Z3VpZGFuY2Ugb24gd2hlbiBwb3J0cyBjYW4gb3Igc2hvdWxkIGJlIA0KPiByZW1vdmVkLiBJ biBnZW5lcmFsIHBvcnRzIHNob3VsZCBub3QgYmUgcmVtb3ZlZCB3aXRob3V0IHJlYXNvbiBi dXQgaWYgYSANCj4gcG9ydCBibG9ja3MgcHJvZ3Jlc3MgaXQgc2hvdWxkIGJlIGRlcHJlY2F0 ZWQgYW5kIHN1YnNlcXVlbnRseSByZW1vdmVkLiANCj4gSW4gZ2VuZXJhbCwgaWYgYSBwb3J0 cyBibG9ja3MgcHJvZ3Jlc3MgZm9yIHNvbWUgdGltZSBpdCB3aWxsIGJlIHJlbW92ZWQgDQo+ IHNvIHRoYXQgcHJvZ3Jlc3MgY2FuIGJlIG1hZGUuIEZvciBtb3JlIGRldGFpbHMgc2VlIGJl bG93Lg0KPiANClRoZSBwaHJhc2luZyAiYmxvY2tzIHByb2dyZXNzIiBpcyBwcm9ibGVtYXRp Yy4gUHJvZ3Jlc3Mgb2Ygd2hhdD8gDQpJbmRpc2NyaW1pbmF0ZWx5IGh1bnRpbmcgZG93biBF T0wvYXBwYXJlbnRseSBpbmFjdGl2ZSBzb2Z0d2FyZT8gTWFzcyANCm1pZ3JhdGluZyBmcm9t IG9uZSBidWlsZCBzeXN0ZW0gdG8gYW5vdGhlciBkdWUgdG8gcHJpbWFyaWx5IHBlcnNvbmFs IA0KcHJlZmVyZW5jZSwgZXZlbiBhZ2FpbnN0IHVwc3RyZWFtcycgd2lsbD8gVGhpcyBwaHJh c2luZyBpcyB2YWd1ZSBlbm91Z2ggDQp0byBqdXN0aWZ5IGRlcHJlY2F0aW5nIGFuZCByZW1v dmluZywgc2F5IEVPTCAoYnV0IHN0aWxsIGZldGNoYWJsZSBhbmQgDQpidWlsZGFibGUpIGxp YnJhcmllcyBuZWVkZWQgYnkgYWN0aXZlbHktbWFpbnRhaW5lZCBhbmQgc3VwcG9ydGVkIChh bmQgDQpwb3B1bGFyKSBzb2Z0d2FyZSB0aGF0IGFyZSBpbiBubyBydXNoIHRvIG1pZ3JhdGUg YXdheS4gSWYgdGhpcyB2YWd1ZW5lc3MgDQppcyBpbnRlbmRlZCwgdGhlbiBpdCBuZWVkcyB0 byBiZSBhY2NvbXBhbmllZCB3aXRoICp1cyogYWN0aXZlbHkgDQpkZXZlbG9waW5nIGluIHRo ZSB1cHN0cmVhbSBwcm9qZWN0IHRvIHN1cHBvcnQgZWZmb3J0cyBoZXJlLg0KPiBBIHBvcnQg Y2FuIGJlIGRlcHJlY2F0ZWQgYW5kIHN1YnNlcXVlbnRseSByZW1vdmVkIGlmOg0KPiANCj4g LSBVcHN0cmVhbSBkZWNsYXJlZCB0aGUgdmVyc2lvbiBFT0wgb3Igb2ZmaWNpYWxseSBzdG9w cGVkIGRldmVsb3BtZW50LiANCj4gREVQUkVDQVRFRCBzaG91bGQgYmUgc2V0IGFzIHNvb24g YXMgdGhlIHBsYW5uZWQgcmVtb3ZhbCBkYXRlIGlzIGtub3cuIA0KPiAoSXQgaXMgdXAgdG8g dGhlIG1haW50YWluZXIgaWYgdGhleSB3YW50IHRvIHJlbW92ZSB0aGUgcG9ydCBpbW1lZGlh dGVseSANCj4gYWZ0ZXIgdGhlIEVPTCBkYXRlIG9yIGlmIHRoZXkgd2FudCBrZWVwIHRoZSBw b3J0IGZvciBzb21lIHRpbWUgd2l0aCANCj4gYmFja3BvcnRlZCBwYXRjaGVzLiBPcHRpb24g dHdvIGlzICpub3QqIHBvc3NpYmxlIHdpdGhvdXQgYmFja3BvcnRpbmcgDQo+IHBhdGNoZXMs IHNlZSB2dWxuZXJhYmxlIHBvcnRzKSBUaGUgZ2VuZXJhbCBzdWdnZXN0aW9uIGlzIHRoYXQg RU9MIA0KPiB2ZXJzaW9ucyBzaG91bGQgbm90IHN0YXkgaW4gdGhlIHBvcnRzIHRyZWUgZm9y IG1vcmUgdGhhbiAzIG1vbnRocyANCj4gd2l0aG91dCBqdXN0aWZpY2F0aW9uLg0KPiAtIFRo ZSBwb3J0IGRvZXMgbm90IGFkYXB0IHRvIGluZnJhc3RydWN0dXJlIGNoYW5nZXMgKGkuZS4g VVNFX1NUQUdFLCANCj4gTUFOUFJFRklYLCBjb21waWxlciB1cGRhdGVzLCBldGMuKSB3aXRo aW4gNiBtb250aHMuIFBvcnRzIHNob3VsZCBiZSBzZXQgDQo+IHRvIERFUFJFQ0FURUQgYWZ0 ZXIgMyBtb250aHMgYW5kIGNhbiBiZSByZW1vdmVkIGFmdGVyIDYNCj4gDQo+IA0KPiBSZWFz b25zIHRoYXQgZG8gbm90IHdhcnJhbnQgcmVtb3ZhbCBvZiBhIHBvcnQ6DQo+IA0KPiAtIFNv ZnR3YXJlIGhhc27igJl0IHNlZW4gYSByZWxlYXNlIGluIGEgbG9uZyB0aW1lDQo+IC0gVXBz dHJlYW0gbG9va3MgaW5hY3RpdmUgZm9yIGEgbG9uZyB0aW1lDQo+IA0KVGhlc2UgcmVhc29u cyBhcmUgZ29vZCBvbiBmaXJzdCByZWFkIGJ1dCB0aGUgcHJlbWlzZSBuZWVkcyB0byBiZSB3 b3JrZWQgDQppbiBlYXJsaWVyLiBBbHNvIG5lZWQgdG8gY29uc2lkZXIgYWN0aXZlbHktbWFp bnRhaW5lZCBhbmQgc3VwcG9ydGVkIA0Kc29mdHdhcmUgdGhhdCBoYXBwZW4gdG8gdXNlIEVP TCBkZXBlbmRlbmNpZXMuDQoNCi0tIA0KQ2hhcmxpZSBMaQ0KLi4ubm9wZSwgc3RpbGwgZG9u J3QgaGF2ZSBhbiBleGl0IGxpbmUuDQoNCg== --------------yWx3rZUBFx2nzFBPtbuaEzaO-- --------------8ZdVoqtv79mWPX3S0rmkZKtR Content-Type: application/pgp-signature; name="OpenPGP_signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="OpenPGP_signature.asc" -----BEGIN PGP SIGNATURE----- wnsEABYIACMWIQRTQA7vBfo8y1zE1rpnj5NgWEFcygUCZd+hIAUDAAAAAAAKCRBnj5NgWEFcyijw AQCu3YDjdSPYE+A0WyoEN+0X2EhmmansKR/tD+VdChJ73QEAg3X3XzFfi8WCqKdQBANYQWHiqXBp Es2YUhTTHZYMcgA= =Kzo2 -----END PGP SIGNATURE----- --------------8ZdVoqtv79mWPX3S0rmkZKtR-- From nobody Wed Feb 28 21:18:53 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlS0836Ptz5CRN4 for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 21:19:04 +0000 (UTC) (envelope-from grembo@freebsd.org) Received: from mail.evolve.de (mail.evolve.de [213.239.217.29]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA512 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mail.evolve.de", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlS0765zTz4cRN; Wed, 28 Feb 2024 21:19:03 +0000 (UTC) (envelope-from grembo@freebsd.org) Authentication-Results: mx1.freebsd.org; none Received: by mail.evolve.de (OpenSMTPD) with ESMTP id 649ef09a; Wed, 28 Feb 2024 21:18:55 +0000 (UTC) Received: by mail.evolve.de (OpenSMTPD) with ESMTPSA id 1da66e87 (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 28 Feb 2024 21:18:55 +0000 (UTC) Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (1.0) Subject: Re: Proposed ports deprecation and removal policy From: Michael Gmelin <grembo@freebsd.org> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Date: Wed, 28 Feb 2024 22:18:53 +0100 Cc: ports@freebsd.org Message-Id: <817F1C79-001F-4131-BC54-A992BA1B78D0@freebsd.org> References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> To: Florian Smeets <flo@freebsd.org> X-Mailer: iPhone Mail (20H307) X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:24940, ipnet:213.239.192.0/18, country:DE] X-Rspamd-Queue-Id: 4TlS0765zTz4cRN > On 28. Feb 2024, at 20:22, Florian Smeets <flo@freebsd.org> wrote: >=20 > =EF=BB=BFDear ports community, >=20 > as the removal of ports is a recurring source of friction and dispute we w= ould like to add a ports removal and deprecation policy to the porters handb= ook. >=20 > We tried to find a sensible middle ground between too fast removal and kee= ping unmaintained and abandoned upstream software in our ports tree forever.= >=20 > When can or should ports be deprecated or removed? >=20 > This policy should give some guidance on when ports can or should be remov= ed. In general ports should not be removed without reason but if a port bloc= ks progress it should be deprecated and subsequently removed. In general, if= a ports blocks progress for some time it will be removed so that progress c= an be made. For more details see below. >=20 >=20 Hi Flo, Thanks for the effort, it=E2=80=99s a delicate topic for many. > Ports can be removed immediately if one of the following conditions is met= : >=20 > - Upstream distfile is no longer available from the original source/mirror= (Our and other distcaches e.g. Debian, Gentoo, etc do not count as "availab= le") > - Upstream WWW is unavailable: deprecate, remove after 3 months > - BROKEN for more than 6 months > - has known vulnerabilities that weren=E2=80=99t addressed in the ports tr= ee for more than 3 months >=20 >=20 > A port can be deprecated and subsequently removed if: >=20 By whom though? Portmgr? Any committer? > - Upstream declared the version EOL or officially stopped development. DEP= RECATED should be set as soon as the planned removal date is know. (It is up= to the maintainer if they want to remove the port immediately after the EOL= date or if they want keep the port for some time with backported patches. O= ption two is *not* possible without backporting patches, see vulnerable port= s) The general suggestion is that EOL versions should not stay in the ports t= ree for more than 3 months without justification. How many ports in the tree would be affected by this policy at the moment? Does =E2=80=9CEOL versions=E2=80=9C also affect software where there are no n= ew versions available (like, development officially stopped a long time ago o= r there was a license change, the project was archived etc.), or just outdat= ed versions of software that is still under development? In any case, three m= onths seems relatively short. I=E2=80=99m maintaining a couple of ports where upstream officially stopped d= evelopment, but which are still super useful (so they=E2=80=99re not just pa= rt of my personal software museum/there for sentimental reasons). Best > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, MANPR= EFIX, compiler updates, etc.) within 6 months. Ports should be set to DEPREC= ATED after 3 months and can be removed after 6 >=20 >=20 > Reasons that do not warrant removal of a port: >=20 > - Software hasn=E2=80=99t seen a release in a long time > - Upstream looks inactive for a long time >=20 > Florian (on behalf of portmgr) From nobody Wed Feb 28 21:27:05 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlS9W19WMz5CRcx for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 21:27:11 +0000 (UTC) (envelope-from flo@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlS9W038lz4dq4; Wed, 28 Feb 2024 21:27:11 +0000 (UTC) (envelope-from flo@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709155631; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=OXPJZtK298pAXJzQVZJVO5WlqzjCGx8/Pddmc3B0gB0=; b=u7U1sOu7znMh8aNsJ1OGO54SaiRMQxjnKC+N2yDmEA2k6jQ+I5U4L3EKt6i3h2nMYd3d6w 8/9WUkW62BlESMMG6G2Fw1/nb5sKh9gFJHrx2aLw0dk2dkSrLuXQsfP83rbELdKmI+MM5q ilFpbZYCWLg11+ulTX/902ngNNvdFk4EysOduuHkNFCvN8Ox9ExHbDXOoJPw7VzDx2JCsx Gs8iW6rbPf4qiDUTreDb9x3OMGItrl+jDdn8wOzgwMc0vgb8W/oI6YqDnryFF6gELyCPEj S3qNFhZXSJNwIM2We7BSKdZxOFcoy3Vt15B9DTWwSq13rCmsCXOyS1+1pCzxuQ== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709155631; a=rsa-sha256; cv=none; b=dXCeGlPnF8N4nRWlRVezbUvzvAQwtS/l606yltW77m3KVaZdsah3fRUUzxdSIt6dGm5KyO RPe5EMJ9K32+0/EyM+WVkHn1I1JqspBV/pIBI1Cxi2sCQUA70opaVR9xUobLqDZblu20gb LPxPcxaGnv2TOHQ2MQjoG96oU3o0bWiu3XR4M33SdUHZuh5xtFPQDcVb3Mx3bW94PYVNtv gGFep73euloTytBVfHXAZUk1zxWCiRktJ2l/HpluwPzU7zBK0i/C0MGK5qSbs0peCGrZE6 kzqKVzqV2U1aw1L44um4qf/bBRyjBuzuqsGV+xyUKpvaGjzmSq1eY7CK37/mhw== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709155631; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=OXPJZtK298pAXJzQVZJVO5WlqzjCGx8/Pddmc3B0gB0=; b=cfLOPfV3E7LX8gXf/0lwv6fgcOzqICLv4xDZmYEH6IdDWKmCqfrGWE6xN1Fs8QTcFt/vKL Zc7GrvWpZBVd3RLN3q+Bxtd9CBgvb/af5lpmqnjQNkXk6J5HvhXdSpT9xTZxsTxK0aerAD xt7nFPOJ+l0TNpfC8hw8kdigYv4uLG1wVJaHwn+C8I/enSaBeHhHcTG3ttMnRr4HhVkYd5 ZP0Bc2m0SEdcASMOIFPUKJMmaIO7L9Z49rMlhiTGEVfuHJ6IlbPd4g73/qX4XPXCwv7F28 UixWiQi/OjQ+QdvDSFlpaBd5WoWphh5cIKsfWWt1B3Gm4sfRua5R/1tyOigLlQ== Received: from [IPV6:2a01:4f8:10a:fd43::dead] (unknown [IPv6:2a01:4f8:10a:fd43::dead]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: flo/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TlS9S6nbqz1K4W; Wed, 28 Feb 2024 21:27:08 +0000 (UTC) (envelope-from flo@FreeBSD.org) Message-ID: <9f0610d5-c999-4b39-9175-d9a54ad0a9f1@FreeBSD.org> Date: Wed, 28 Feb 2024 22:27:05 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: en-US To: Charlie Li <vishwin@freebsd.org>, ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <6d0a6af4-01d8-4db9-9661-ce688dc8da03@freebsd.org> From: Florian Smeets <flo@FreeBSD.org> In-Reply-To: <6d0a6af4-01d8-4db9-9661-ce688dc8da03@freebsd.org> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit On 28.02.24 22:09, Charlie Li wrote: > Florian Smeets wrote: >> This policy should give some guidance on when ports can or should be >> removed. In general ports should not be removed without reason but if >> a port blocks progress it should be deprecated and subsequently >> removed. In general, if a ports blocks progress for some time it will >> be removed so that progress can be made. For more details see below. >> > The phrasing "blocks progress" is problematic. Progress of what? > Indiscriminately hunting down EOL/apparently inactive software? Mass > migrating from one build system to another due to primarily personal > preference, even against upstreams' will? This phrasing is vague enough > to justify deprecating and removing, say EOL (but still fetchable and > buildable) libraries needed by actively-maintained and supported (and > popular) software that are in no rush to migrate away. If this vagueness > is intended, then it needs to be accompanied with *us* actively > developing in the upstream project to support efforts here. The sentence you refer to is just a rough summary of what is described in more detail further down. e.g. >> - The port does not adapt to infrastructure changes (i.e. USE_STAGE, >> MANPREFIX, compiler updates, etc.) within 6 months. Ports should be >> set to DEPRECATED after 3 months and can be removed after 6 >> > These reasons are good on first read but the premise needs to be worked > in earlier. Also need to consider actively-maintained and supported > software that happen to use EOL dependencies. > I don't understand what you are trying to say with the first sentence. It's kind of implicit that we will not allow removal of libraries that still have (lots of) ports depending on them with this policy. But we should probably make this explicit. I'll add a note and come up with something. Thanks Florian From nobody Wed Feb 28 21:27:40 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlSBF5MPDz5CRTS for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 21:27:49 +0000 (UTC) (envelope-from portmaster@bsdforge.com) Received: from udns.ultimatedns.net (udns.ultimatedns.net [24.113.41.81]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "ultimatedns.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlSBD3fGjz4dvr; Wed, 28 Feb 2024 21:27:48 +0000 (UTC) (envelope-from portmaster@bsdforge.com) Authentication-Results: mx1.freebsd.org; none Received: from ultimatedns.net (localhost [127.0.0.1]) by udns.ultimatedns.net (8.16.1/8.16.1) with ESMTP id 41SLReXh098572; Wed, 28 Feb 2024 13:27:46 -0800 (PST) (envelope-from portmaster@bsdforge.com) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Wed, 28 Feb 2024 13:27:40 -0800 From: Chris <portmaster@bsdforge.com> To: Florian Smeets <flo@freebsd.org> Cc: ports@freebsd.org Subject: Re: Proposed ports deprecation and removal policy In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> User-Agent: UDNSMS/17.0 Message-ID: <3fa7a01e106818b41c494f993037d931@bsdforge.com> X-Sender: portmaster@bsdforge.com Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:11404, ipnet:24.113.0.0/16, country:US] X-Rspamd-Queue-Id: 4TlSBD3fGjz4dvr On 2024-02-28 11:22, Florian Smeets wrote: > Dear ports community, > > as the removal of ports is a recurring source of friction and dispute we > would > like to add a ports removal and deprecation policy to the porters handbook. > > We tried to find a sensible middle ground between too fast removal and > keeping > unmaintained and abandoned upstream software in our ports tree forever. > > When can or should ports be deprecated or removed? > > This policy should give some guidance on when ports can or should be > removed. In > general ports should not be removed without reason but if a port blocks > progress > it should be deprecated and subsequently removed. In general, if a ports > blocks > progress for some time it will be removed so that progress can be made. For > more > details see below. > > > Ports can be removed immediately if one of the following conditions is met: > > - Upstream distfile is no longer available from the original source/mirror > (Our > and other distcaches e.g. Debian, Gentoo, etc do not count as "available") > - Upstream WWW is unavailable: deprecate, remove after 3 months > - BROKEN for more than 6 months > - has known vulnerabilities that weren’t addressed in the ports tree for > more than 3 months > > > A port can be deprecated and subsequently removed if: > > - Upstream declared the version EOL or officially stopped development. > DEPRECATED > should be set as soon as the planned removal date is know. (It is up to the > maintainer if they want to remove the port immediately after the EOL date or > if > they want keep the port for some time with backported patches. Option two is > *not* > possible without backporting patches, see vulnerable ports) The general > suggestion > is that EOL versions should not stay in the ports tree for more than 3 > months > without justification. > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > MANPREFIX, > compiler updates, etc.) within 6 months. Ports should be set to DEPRECATED > after 3 > months and can be removed after 6 > > > Reasons that do not warrant removal of a port: > > - Software hasn’t seen a release in a long time > - Upstream looks inactive for a long time > > Florian (on behalf of portmgr) Thank you very much for your attempt to set precedence in this area. Your proposal seems well tempered and prudent. Thank you. Consider this a "+1" from me. :) --Chris -- --Chris Hutchinson From nobody Wed Feb 28 21:38:19 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlSQW2k5Cz5CStp for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 21:38:27 +0000 (UTC) (envelope-from portmaster@bsdforge.com) Received: from udns.ultimatedns.net (udns.ultimatedns.net [24.113.41.81]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "ultimatedns.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlSQW0Zddz4gTm; Wed, 28 Feb 2024 21:38:26 +0000 (UTC) (envelope-from portmaster@bsdforge.com) Authentication-Results: mx1.freebsd.org; none Received: from ultimatedns.net (localhost [127.0.0.1]) by udns.ultimatedns.net (8.16.1/8.16.1) with ESMTP id 41SLcJkd004405; Wed, 28 Feb 2024 13:38:25 -0800 (PST) (envelope-from portmaster@bsdforge.com) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Wed, 28 Feb 2024 13:38:19 -0800 From: Chris <portmaster@bsdforge.com> To: Florian Smeets <flo@freebsd.org> Cc: Miroslav Lachman <000.fbsd@quip.cz>, ports@freebsd.org Subject: Re: Proposed ports deprecation and removal policy In-Reply-To: <1500d4f4-2bdb-4d3b-8848-900346f4d194@FreeBSD.org> References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <fb42e7b5-be11-4d6f-bacd-90bfd361ed48@quip.cz> <1500d4f4-2bdb-4d3b-8848-900346f4d194@FreeBSD.org> User-Agent: UDNSMS/17.0 Message-ID: <7d2a8e8e671578f99ed05431b68cf015@bsdforge.com> X-Sender: portmaster@bsdforge.com Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:11404, ipnet:24.113.0.0/16, country:US] X-Rspamd-Queue-Id: 4TlSQW0Zddz4gTm On 2024-02-28 12:13, Florian Smeets wrote: > On 28.02.24 21:00, Miroslav Lachman wrote: >> On 28/02/2024 20:22, Florian Smeets wrote: >> >>> Ports can be removed immediately if one of the following conditions is >>> met: >>> >>> - Upstream distfile is no longer available from the original source/mirror >>> (Our and other distcaches e.g. Debian, Gentoo, etc do not count as >>> "available") >> >> I miss some sort of time frame like in the following cases. The way the >> sentence is written now, it looks like there may be an immediate removal on >> the first day of the outage. >> > > Good point. Yeah, it certainly isn't the intention to remove it immediately. > I > will make a note to add a time frame. I'm thinking 4 weeks, as that feels > long for > a site to go away and reappear, but we might just make it 3 months as with > most of > the other points. I'd vote for 3 (mos). But 2 also seems reasonable. So that those that use it. But don't update frequently get a chance to notice, and subsequently save/maintain it. :) > > Thanks > Florian -- --Chris Hutchinson From nobody Wed Feb 28 22:13:08 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlTBb3L74z5CWG1 for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 22:13:11 +0000 (UTC) (envelope-from flo@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlTBb2dRjz4kvX; Wed, 28 Feb 2024 22:13:11 +0000 (UTC) (envelope-from flo@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709158391; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=kjtU46NYFRb1FFyz/bWEgEs9vc73L8POqK7TCj61Ymc=; b=mxq7L/iS/DhRNcKnAD42pnZ3pveR3kB492gARs9qAfCNYPQeoqRfBl37soLT+MVFewPiHU 60fdMTkUlxMfpKJ/8pSFMbUpbOLoNxDGBhqOM5gIac0cSclAO9mzp6XonKgelathxd/crQ SM6FuC9gC/6NtbPh+FBzIPfHHqLVKIo3iWAk/UdM4ClhdwioyBCEOAnCDTZ/TogLEzkFpE LuJHSKgCPHgvIc1IUONeOK+IG8ZK0QE9+WhiIA0aAimpQYn8GJS2tpmaSSHYl5jBTCc9xF QkTR/B4i5CHfCFhWNlbrmRlr7Lp2CBH0kwa0L6CivfCU9Zs47/iuRuI3IobAYg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709158391; a=rsa-sha256; cv=none; b=dTacAlb2zs0x2HMhQKOHPJxDPpkULdWiCOnuZuWDkWWvNsOzAzoLwsv1fo6b5qA0Ae8zUY +qa3WMIPO5eKNm2JnlGM5mnvv7nyUFJhPfA3yxt7SNVztdNH6b5/lYgIZMLJ4FEdsRfcED 8AmdIV5VZLSxB+6u+5yzjU3a9b55HFB54SXNJGr43iqshhauosPstdFlMliRIBGITmuY/g EF44jArRvY2bZD8LYJ/J8xh4vBPsoXh6pmcHg/OdhmanEjvxuKLA3l96wHpIlrq1CpESh5 HWxRl6LS9H0RDW83gbE/f50wj2EnbyfQCjuLYm55ouyFO74LuZXqEHCGFpH09A== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709158391; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=kjtU46NYFRb1FFyz/bWEgEs9vc73L8POqK7TCj61Ymc=; b=g6C05ogNtXTG77ibtGKcTyODAbG/WTE54i2CAR2sBndw9RSrcr4NBCRX8Rm7TIoS3oFapE OkriBFe1cSFMM6oPBxxps6txZLgQRxareXK1acfaiu4syLfy07rAaLAR1PdRFH177nU1Ly NA1v39TgiWFrOIt0M0DOKsyJVPlMZU+5FzOaPo4yLEIIG6OI8k9Bmu8dap4L2v2aOK+SOt Yo1mgh/pXQtbrICEYtvhEUJIo42AMuHPZxm31MdxSahKpfLUg0McC8RK9VuiZqhBijDFOX 8kFA7pbVLSmm+I2eABTzOBoQIwaHZmBFAe8BzR3JiDJSL/AofZ9nK/aCdAqW0g== Received: from [IPV6:2a01:4f8:10a:fd43::dead] (unknown [IPv6:2a01:4f8:10a:fd43::dead]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: flo/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TlTBZ2hJbz1KKl; Wed, 28 Feb 2024 22:13:10 +0000 (UTC) (envelope-from flo@FreeBSD.org) Message-ID: <b3ccdd5d-6a00-4438-bfcd-2dd5fb0b8f9c@FreeBSD.org> Date: Wed, 28 Feb 2024 23:13:08 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: en-US To: Michael Gmelin <grembo@freebsd.org> Cc: ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <817F1C79-001F-4131-BC54-A992BA1B78D0@freebsd.org> From: Florian Smeets <flo@FreeBSD.org> In-Reply-To: <817F1C79-001F-4131-BC54-A992BA1B78D0@freebsd.org> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit On 28.02.24 22:18, Michael Gmelin wrote: > > >> On 28. Feb 2024, at 20:22, Florian Smeets <flo@freebsd.org> wrote: > > Hi Flo, > > Thanks for the effort, it’s a delicate topic for many. It is, we're tying our best and put some thought into it in the last coupe of weeks. > >> Ports can be removed immediately if one of the following conditions is met: >> >> - Upstream distfile is no longer available from the original source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not count as "available") >> - Upstream WWW is unavailable: deprecate, remove after 3 months >> - BROKEN for more than 6 months >> - has known vulnerabilities that weren’t addressed in the ports tree for more than 3 months >> >> >> A port can be deprecated and subsequently removed if: >> > > By whom though? Portmgr? Any committer? Yes, this is a tough one. Obviously, first it's the maintainers job. If it's broken, vulnerable, etc. anybody can set DEPRECATED and remove it once it expires. How I saw this policy while writing it was as a guideline for maintainers and committers. Not something to allow committers to remove stuff at will that might fall under one of these points. But it will certainly be used to justify the start of glib20 deprecation and subsequent removal, for example. But that is a topic for another day ;) > >> - Upstream declared the version EOL or officially stopped development. DEPRECATED should be set as soon as the planned removal date is know. (It is up to the maintainer if they want to remove the port immediately after the EOL date or if they want keep the port for some time with backported patches. Option two is *not* possible without backporting patches, see vulnerable ports) The general suggestion is that EOL versions should not stay in the ports tree for more than 3 months without justification. > > How many ports in the tree would be affected by this policy at the moment? Honestly, I don't know. I'm not on a witch hunt for them. The policy is looking to make it easier to remove old stuff that hinders progress. If it's actively maintained, builds and is not vulnerable there should not be an issue. We are trying to make ports a bit more sustainable with the resources we have. e.g. look at the last PRs for the clang/LLVM updates. > > Does “EOL versions“ also affect software where there are no new versions available (like, development officially stopped a long time ago or there was a license change, the project was archived etc.), or just outdated versions of software that is still under development? In any case, three months seems relatively short. > > I’m maintaining a couple of ports where upstream officially stopped development, but which are still super useful (so they’re not just part of my personal software museum/there for sentimental reasons). That is why we have lots of shoulds in the policy. Some of the policies might have been written with server software in mind too much that have different versions in parallel. e.g. PHP, asterisk, etc. And yes, ports remaining or becoming more of a software museum is one of the things we want to combat with the policy to become more sustainable. Florian From nobody Wed Feb 28 22:38:55 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlTmV1CRyz5CYMJ for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 22:39:06 +0000 (UTC) (envelope-from mirror176@hotmail.com) Received: from NAM11-DM6-obe.outbound.protection.outlook.com (mail-dm6nam11olkn20801.outbound.protection.outlook.com [IPv6:2a01:111:f403:2c15::801]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlTmT1Q7gz4shC for <ports@freebsd.org>; Wed, 28 Feb 2024 22:39:05 +0000 (UTC) (envelope-from mirror176@hotmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=gQAVpEvl; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of mirror176@hotmail.com designates 2a01:111:f403:2c15::801 as permitted sender) smtp.mailfrom=mirror176@hotmail.com; arc=pass ("microsoft.com:s=arcselector9901:i=1") ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=dQl24Qq7DEDFW9Px0nnovejAxiLWvXdxWs+2H/0ElpOLXnkYfTLtgzDt1R4+rm2s2+BO8ObQ3eoTcwnGFh9Pu+GzeD3IIUlcb+Nu8L7EHbRO4QmSRSuieEugtFOSx9Ptlbqt/KO+AfHYSUzS+ap6cX/p6mtehetJRcjZrZMiLYyI+mzUq7VTzXFtAMN6yPyKFyjRM60UgqUm8HLgCzucUj3W76OBihoQQvGlh5KyzFrP2l/oER03L0ELpsW+WtnJKU2GBvBa3dgWvb3Mu2HtdE8RiINPQHmOMOW2BOplfnUUxhsbntBK09Tf/tfvAGr/6IJHJ39g4Hnb42oOMrICMA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=JsLaH+LZGGYC9H3Ow1Dl0NN5a1BV5pzUa3f+9SqIxm0=; b=WsaptGN1XzELPngWVP4MtVOBG6cqzxP6NE1gMvKPYrrJSdzNAeCyZHNCLAL5o4MIYck4rrcAkMpp7RQea5oJWURHKLlGxL6dj0CBcDmWmfc/yna+Tmaue2aBjJywJ3Qw0wlcx8e7/A1ynScgIefkw6ArKF7xiM4PdGNBtjPHZLK3uvk0EzVsBOfhiREDXHelJNeu2X/oWInyWQQU0BIT1nuBIBGLNpugMEGZUZ8yHlq/Z2Yfp2RTb8tKKRvXNHihYA310FxZFUSIwq2uADwZo5LOK3fNR8zB9sq9eLINm5TgvvZuAe+2eQc3xM//8MQEmhEtH3JhFsugZliysODomA== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=JsLaH+LZGGYC9H3Ow1Dl0NN5a1BV5pzUa3f+9SqIxm0=; b=gQAVpEvlW+aHmINPHVtTjk+QgtBH4gWFjv1AvwH6vVgQpQ6t3nQJrdDg6HFAjuYNodZpZ2hbdZyQwbCNXo9YoMgMPrqvkdcFaQcIEgGiqrA9qZVPLN2lv0EkkCG/dQQmdTIye0vvhUgFq4f0GAutuY2VdEflWXHvh0GICRyljwhE6+HHutrjMuGOxAeKIpFda6gaWLDxo6GuE7lPrbo3KO/3lUWgeVu9PiVebgodlOjlacJiBIPAZ7ratYpiARBxZAJ2OeM6FuniAOo+cAsUUg4YUc38CrjXr0VyLEHY6SoHbEWOtd8+FLAMqtwr9+uscHfULLaYR7XXFJud7nUa0w== Received: from CO1PR11MB4770.namprd11.prod.outlook.com (2603:10b6:303:94::19) by IA0PR11MB7694.namprd11.prod.outlook.com (2603:10b6:208:409::6) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7339.23; Wed, 28 Feb 2024 22:39:02 +0000 Received: from CO1PR11MB4770.namprd11.prod.outlook.com ([fe80::e526:b74c:4798:1295]) by CO1PR11MB4770.namprd11.prod.outlook.com ([fe80::e526:b74c:4798:1295%4]) with mapi id 15.20.7339.024; Wed, 28 Feb 2024 22:39:02 +0000 Message-ID: <CO1PR11MB47706AC0A06D7108F70A55C2E6582@CO1PR11MB4770.namprd11.prod.outlook.com> Date: Wed, 28 Feb 2024 15:38:55 -0700 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: en-US To: ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> From: "Edward Sanford Sutton, III" <mirror176@hotmail.com> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-TMN: [ZDO3nnfbl2xjTkXVV2EQOZexjj22mZ9v] X-ClientProxiedBy: MN2PR10CA0014.namprd10.prod.outlook.com (2603:10b6:208:120::27) To CO1PR11MB4770.namprd11.prod.outlook.com (2603:10b6:303:94::19) X-Microsoft-Original-Message-ID: <2870ef58-6303-4271-a5b2-e2c8be5136ec@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: CO1PR11MB4770:EE_|IA0PR11MB7694:EE_ X-MS-Office365-Filtering-Correlation-Id: 5af6abe1-c8d2-4b95-ed89-08dc38ae0f73 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: UKjZW3EfrVlxlaCqo4EAjthqPVUgpab16UeFNkKL0XINbHUm9KqHWpYiUNUGA2mkV9wVS0QDghosdp//2rdizS49i6JathZvuXqJwZCulVdF0JA9q5wkvh3+aIX5wD1uv1SEELTfz2KMORQJCao/F+slTGCXAiq3+wyOpp/MuvYiFUTSeZqKvZPT7B1XM0WXYwl5p0ih5rfqlO3BQO/dEBwBkuTxXmrXa44B8pKHitK2lFE438FyUT/m0TwhZcGSURCF4hFhKXYmjh0C3mMNp/q3iS4cCevYnPfKunVCYg9jepRN8olXRM32rcpwKjdWaTAPZpawRZ1Oxe1/FMMSraTOOgHlA4uPwliG6Z/PmSNhdgCao3B/rWUSAmzvMFF92wLPwRCu4YiiRPeTtOgsblyrHLHd3v0o9DJ0nrUQbXgKloa2M9WXvrdvKJUVxNyP2P/ez0QRQ3UCyJQ9Np/n5Fr4/MRl9dJHmTQmmyo5UDUwfPHSoOLAwjM17bbPvgPGKnzsHeYEZc4LjX4Tex8NS75AsyE4CAptiI0pXnDD1ZRwYLEGYp51rINzMHFqT2W8 X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?TjlLaXlPalZQMW5INXBnc21ZK0tWWHVRMmF2MUZoSU4vMENnMytwNmpGK3di?= =?utf-8?B?ZXFVSXgyLzZFRVJSOXJNc1FnSWl5RUI4Yk9vOWVORjdwY0pIK3VmZXpuekty?= =?utf-8?B?N0cwZThwMlk4OWh0MnVZdWFCUUVrQWNMZVE1a1pXR2hjOGdYRmppTzEzNUNE?= =?utf-8?B?Vkx2ZWVhOFUwUStEMzBEMGFqT1B6ZXVtbUdRWlppVGFzQkZBeUhRSzl1SGJR?= =?utf-8?B?VFk4UGVjSkdPRVJnTVY5d2V1S24xaFI4TE1SMmdaem9pdC9ybkxnL0FGSDlU?= =?utf-8?B?bHprakU5aGpBOFlTSmZmd0h0K2tIaFA3blRSaHY5Nm5pa0Q4T21RR0szbjBu?= =?utf-8?B?L0MwT3hTTkdxb1liOG9VVUFTRGl2Yzdka2Y2Q2dteEZ3MDNURC9jdHNUREtu?= =?utf-8?B?cjFDK2NHTDdzWFJrTXJoVzlDOXYrVTJLSnNSUGRWMy9VUnFzSnh2b1B4VWJo?= =?utf-8?B?eWN0b3ptZ1Q4d2tIMUhDSVNFaUloVHVHWUFnaytVMUw3UG1rUnpualVPb0s2?= =?utf-8?B?VE9mRTRBVHJrK3Y1Ly9ESGpXNEFieUYxc0tZM2pOa3NjN1l3c3EvWTFRTkIz?= =?utf-8?B?blYzOWFmTHhkZXVyU1RxM2lxRG1RdUhpZS8rcWtWeEdJRWZTVlI2Vy9id05V?= =?utf-8?B?Z2dqc3BPOExUTEY5MFdGWDdlWlNoWjExblRQSytqVU1MaDNVSzVqUnFiRUkv?= =?utf-8?B?MG9VNThqQjhWK0lzL2VtN3JobStBeGludDYvUVc1K01uZlphdEF0Q1RNS0hD?= =?utf-8?B?MGRwZmx4d0NFWWl1c3hYWktiMnZFWnA5RHZDdFNsT2twY1pCV3RPOHZ1Qzl2?= =?utf-8?B?QWlDUEhlUmk4b2gvUzQ3bWVEaFVubTZIL0V4RlhhbGJ4aXBsSDBNSnJWbDNJ?= =?utf-8?B?YVd3MjVnams3d1NpZXpTOHpRN1diOUxDRHZQUHJVS1JOeDBhVVlrdzkwUkxP?= =?utf-8?B?V1dkNko0VElzYTcxalczeUtsOWdFNUxpVVVIRVVCbytaZVZ3RG9mblVRMEhr?= =?utf-8?B?TjBRaDlkU3dQcXZnSHpRWFZSM3EwajNaZmc0QUtReFJlSWYyOEVhNEVHVytF?= =?utf-8?B?ZTJxUGExUC81c3ROd0R4NGhWVHF3ODNreGVjYzA5aVJvUEYrUjFrdVpwTjcv?= =?utf-8?B?UktRaXYyRWphcDZybTYzclRrdHdhdFN0emJ5ZmZ4MHlVY2hiUkJocThBcFBp?= =?utf-8?B?QmhqS2hNcE1sakNJVmdwSVRtYmtzeG5mNWF2WkxZTGlGRGxxQ0I0enBFVFdz?= =?utf-8?B?dDZhVkVITGFmbFIwRlR3ZWtQMkkreVZUZzBTMCtacjdnb2tkN1p1MTQ3Z1FG?= =?utf-8?B?Umx3UStURk0xcUhpKy9WV09HaktFRUxRdW52Kzg1eHZBRjd3Q3BHL0pRMjZI?= =?utf-8?B?VTdwVU8vSk5qQTk4S0RkOG9Fb29NeFVwYk9vMXNVWUZNdTZEMmhJMko4NCtv?= =?utf-8?B?VENBcE0wY3VVVldzYUYzbVgvMVhVVEZoYWxIbkZNekdmSmhKRVdvSHVLYjh1?= =?utf-8?B?VjRvekYrWC9aS0tOdERRSzNHUGR4L0xDMnB0QTZwVXNrZk8rU0dMTXIrM1Nu?= =?utf-8?B?RDJLYTViSjBlWVpsQVVNTTdDOWpPT0RtVWtha2krZzlWeEhldlUwS3ZrQ21R?= =?utf-8?Q?xbsB339h4/xsavT3NoHlxVIFO0v9KKA5wFZHcB4LKwro=3D?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-e8f36.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: 5af6abe1-c8d2-4b95-ed89-08dc38ae0f73 X-MS-Exchange-CrossTenant-AuthSource: CO1PR11MB4770.namprd11.prod.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 28 Feb 2024 22:39:01.9153 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: IA0PR11MB7694 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.48 / 15.00]; FORGED_MUA_THUNDERBIRD_MSGID_UNKNOWN(2.50)[]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-0.999]; NEURAL_HAM_SHORT(-0.99)[-0.987]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; R_SPF_ALLOW(-0.20)[+ip6:2a01:111:f403::/49]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; RCVD_IN_DNSWL_NONE(0.00)[2a01:111:f403:2c15::801:from]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; RCPT_COUNT_ONE(0.00)[1]; FREEMAIL_FROM(0.00)[hotmail.com]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:8075, ipnet:2a01:111:f000::/36, country:US]; MLMMJ_DEST(0.00)[ports@freebsd.org]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[hotmail.com:dkim]; RCVD_COUNT_TWO(0.00)[2]; TO_MATCH_ENVRCPT_ALL(0.00)[]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[hotmail.com:+] X-Rspamd-Queue-Id: 4TlTmT1Q7gz4shC On 2/28/24 12:22, Florian Smeets wrote: > Dear ports community, > > as the removal of ports is a recurring source of friction and dispute we > would like to add a ports removal and deprecation policy to the porters > handbook. > > We tried to find a sensible middle ground between too fast removal and > keeping unmaintained and abandoned upstream software in our ports tree > forever. Not otherwise mentioned in this post, there is value in considering the difference between unmaintained upstream, unmaintained from an inactive port maintainer, unmaintained from an interested port maintainer that is unable to solve the problems they have been presented with or find helpers who did, and unmaintained due to no maintainer for the port. Is there a recommendation, and way to go about it, for port maintainers to preemptively mention extended away time like vacation/holiday or longer? > When can or should ports be deprecated or removed? > > This policy should give some guidance on when ports can or should be > removed. In general ports should not be removed without reason but if a > port blocks progress it should be deprecated and subsequently removed. > In general, if a ports blocks progress for some time it will be removed > so that progress can be made. For more details see below. I presume 'progress' means things like 'blocks ports framework updates' as cases were mentioned of later, but was this the intent? Removing a port that causes conflict building/installing another could be considered progress. > Ports can be removed immediately if one of the following conditions is met: > > - Upstream distfile is no longer available from the original > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not > count as "available") > - Upstream WWW is unavailable: deprecate, remove after 3 months As some ports don't really have a WWW this may be a bit harsh in special cases where community interaction beyond source code is through a mailing list, chatroom, discord, etc. Some websites may be neglected or left to expire due to little interest from who ran it even though a project isn't similarly dead. > - BROKEN for more than 6 months Presume this is a 'broken for everyone on supported FreeBSD releases' though should probably also include stable and current before deletion can happen. I have seen results, besides just a 'BROKEN' being set, from ports with maintainers that had a PR with a maintainer's patch that fixed a problem go for months without being committed. I hope a rush to mark/remove ports as this email implies would lead to more efficient flow rather than creating more work by actions that would be a mistake in such cases. > - has known vulnerabilities that weren’t addressed in the ports tree for > more than 3 months Will the scope of a vulnerability be considered? As an example, removing virtualbox because of a network vulnerability means users who do not need such capability lost the port too. Trying to follow CVEs has made it clear to me that some end up being bugs or possibly unexpected program operation that doesn't seem to have any known example of how the bug is even a security issue. > A port can be deprecated and subsequently removed if: > > - Upstream declared the version EOL or officially stopped development. > DEPRECATED should be set as soon as the planned removal date is know. > (It is up to the maintainer if they want to remove the port immediately > after the EOL date or if they want keep the port for some time with > backported patches. Option two is *not* possible without backporting > patches, see vulnerable ports) The general suggestion is that EOL > versions should not stay in the ports tree for more than 3 months > without justification. Are we thinking of 'old version' cases such as python27, or even cases where upstream EOL'd the project as a whole? Would it be handled differently if an alternative exists or not and if an alternative community can be switched to for further project coordination? > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set > to DEPRECATED after 3 months and can be removed after 6 Some ports are not hier compatible in general even though they are still useful ports. How are exceptions to be decided? Are they marked as an exception in the Makefile? > Reasons that do not warrant removal of a port: > > - Software hasn’t seen a release in a long time > - Upstream looks inactive for a long time > > Florian (on behalf of portmgr) No maintainer + no upstream maintenance when issues have arisen (security, build, infrastructure compatibility) seems like a good time for marking for removal as a general concept though it seems many ports I use, or just try out, regularly don't have maintainers. As issues arise, people often step up and report them or fix them as nonmaintainer which then get committed. I feel I'm not the best choice for maintainer as I am not active enough and often find I go periods where I don't pay active attention; my email often goes through phases where it doesn't get looked at if I'm not actively looking for something. I also found through experience that simple porting problems often go beyond my abilities. Some ports would likely benefit from just having a maintainer as someone who coordinates the effort to keep it working even creating the port+patches is beyond them. This could be a point of failure if they recommend submitted patches be committed without requesting outside help reviewing them such as for safety. Could we document more clearly if such a maintainer is desired and if it is, even recommend it in the all-too-common 'this port has no maintainer' messages? Similarly, pkg could really benefit from listing that message once with a list of ports it applies to as I find the messages basically just become noise at this point. From nobody Wed Feb 28 22:46:38 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlTxD5Ftpz5CYXG for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 22:46:40 +0000 (UTC) (envelope-from vishwin@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlTxD4hWMz4tgj; Wed, 28 Feb 2024 22:46:40 +0000 (UTC) (envelope-from vishwin@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709160400; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references:autocrypt:autocrypt; bh=zUErtMNDSOkdPeOEZIdkMx9c4urioPZwRIJgb5EIp2I=; b=ms31jUfl8qJ8ZhDXAJT8LE3MbRXRN2vs0z7HgpU4+kZ3tTys20mlfssGgi181zwdm4YjyX 4kBODL1XyLIIcgQ2ZyaaBS7zj34Zr6TYX9OGJ5kkC/Gvq2r6lZtTiUjztVdEScifkCXI8O Y0Tfsowc077pU8yPyp4gbpTdkZD6EEVJYST81NdLWlcjSabreGyztGFAJaWo62C+PJ5RA4 stBmfiojMo156Q9lgZeSebRy1C5suu/mLnwJp6iEsbw4clfBCpAhxh5Wzkbr3cmQyQ3Zab P9Ed4LQWBVqGSVHjEfCTdPz8872cztrIe/v28sWzXjamqM0Eb2JB/c8u2PJnkA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709160400; a=rsa-sha256; cv=none; b=wKmiLxsHajXQv/gqFDLVQwlqe87K+XP7OajDwG4DxIs7FJJSRq/gTKQpHvy4rtqIzyM2zU BVhFxlmnOUOHBUzCpYP3xVyXZnsmdLsnPHXeoAqI34lsNaIdKfxyfOcaHTD2wleoDc1Hy7 CW7FU8TgtTMOigZkkTeUOT6JQTn445+aLb8VT50yQ0H7GH7uGiF3m21b+C7hEEmWmXW+/O I3gEM6gv9kCmOawbsegPpsHWscDddRW7a2R9koo0jrb0B552rF1Mt23UisGEGWiJBVCxZI uJwaFma/+L6OCmVL31GnCZlzWi4fdqZsgpn0zLe5TOiKYOLccluT67pyRJDsMg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709160400; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references:autocrypt:autocrypt; bh=zUErtMNDSOkdPeOEZIdkMx9c4urioPZwRIJgb5EIp2I=; b=K9DX99n8hdmGIZJ8wbTwU1ynGtRf7SHGTCQdWiiKp+og8NNV05WmvbhtnRLhbJoZx7qCtJ lnVy/IoBvnHuQv4C3MuQYXWrbM01ikhDNGxR7B8Pn9rxp9jh3nA4yglWsXT1SViwqIv826 I3jYsTkgJBm8JXC64YW323zuRB8eR7Y4E3V8gZJdsYDjfgHCTaUNu64h/KMkEL3tlV0gE8 SuhFfkkB/soBnR+WW3I4NY6lIi2sER4FjQ1DU7m8EQx8rDuCgZV/9F3FtU29lXDLJJ4lDy F/SYgI7e+w5YSU1iBkIccrYSuT2BSgDQYB8AdtroRhBFRF+oGLKzxnW6Sk5XAg== Received: from [IPV6:2601:98a:d80:d0:56ee:75ff:fe50:69b5] (unknown [IPv6:2601:98a:d80:d0:56ee:75ff:fe50:69b5]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: vishwin/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TlTxD2ysvz1LRf; Wed, 28 Feb 2024 22:46:40 +0000 (UTC) (envelope-from vishwin@freebsd.org) Message-ID: <c8fe177a-770b-48e2-9366-abea1aead86c@freebsd.org> Date: Wed, 28 Feb 2024 17:46:38 -0500 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: en-GB To: Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <6d0a6af4-01d8-4db9-9661-ce688dc8da03@freebsd.org> <9f0610d5-c999-4b39-9175-d9a54ad0a9f1@FreeBSD.org> From: Charlie Li <vishwin@freebsd.org> Autocrypt: addr=vishwin@freebsd.org; keydata= xjMEZFWWqBYJKwYBBAHaRw8BAQdAINFDmM+bgGkT1C4nD5a3BxgcH8Xnx5qTJbPuIBxD57LN MkNoYXJsaWUgTGkgKEZyZWVCU0QgUHJvamVjdCkgPHZpc2h3aW5ARnJlZUJTRC5vcmc+wpkE ExYKAEEWIQRTQA7vBfo8y1zE1rpnj5NgWEFcygUCZFWWqAIbAwUJA+3ogAULCQgHAgIiAgYV CgkICwIEFgIDAQIeBwIXgAAKCRBnj5NgWEFcyllaAP9CGICFEvTUOv5BYh/H8m49VJ87a/wd 0obeQfVBnS464AD9FopTHbjEs0HDV0ZYmJPxzJIznjumsj9gBxX0bBqqTgzOOARkVZaoEgor BgEEAZdVAQUBAQdA6BUWuG5RuT0vmtoDyCUUqiJGdtd78GM5ic3kw2AntSADAQgHwn4EGBYK ACYWIQRTQA7vBfo8y1zE1rpnj5NgWEFcygUCZFWWqAIbDAUJA+3ogAAKCRBnj5NgWEFcyn55 AP9ezKDCUgHqAq6JX976abb9pYdbSjxxNJqnrjgNkfhgIQD/QhR+fgnUHhcGTMBy+pYHZUGH 5DCuITsK1U4+v252uws= Organization: FreeBSD Project In-Reply-To: <9f0610d5-c999-4b39-9175-d9a54ad0a9f1@FreeBSD.org> Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="------------yssiST54msP8rWZLd8Od0Wdh" This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --------------yssiST54msP8rWZLd8Od0Wdh Content-Type: multipart/mixed; boundary="------------lyNEkyzCUBA6J9gOhtJOtkhj"; protected-headers="v1" From: Charlie Li <vishwin@freebsd.org> To: Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org Message-ID: <c8fe177a-770b-48e2-9366-abea1aead86c@freebsd.org> Subject: Re: Proposed ports deprecation and removal policy References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <6d0a6af4-01d8-4db9-9661-ce688dc8da03@freebsd.org> <9f0610d5-c999-4b39-9175-d9a54ad0a9f1@FreeBSD.org> In-Reply-To: <9f0610d5-c999-4b39-9175-d9a54ad0a9f1@FreeBSD.org> --------------lyNEkyzCUBA6J9gOhtJOtkhj Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: base64 RmxvcmlhbiBTbWVldHMgd3JvdGU6DQo+IE9uIDI4LjAyLjI0IDIyOjA5LCBDaGFybGllIExp IHdyb3RlOg0KPj4gRmxvcmlhbiBTbWVldHMgd3JvdGU6DQo+Pj4gVGhpcyBwb2xpY3kgc2hv dWxkIGdpdmUgc29tZSBndWlkYW5jZSBvbiB3aGVuIHBvcnRzIGNhbiBvciBzaG91bGQgYmUg DQo+Pj4gcmVtb3ZlZC4gSW4gZ2VuZXJhbCBwb3J0cyBzaG91bGQgbm90IGJlIHJlbW92ZWQg d2l0aG91dCByZWFzb24gYnV0IGlmIA0KPj4+IGEgcG9ydCBibG9ja3MgcHJvZ3Jlc3MgaXQg c2hvdWxkIGJlIGRlcHJlY2F0ZWQgYW5kIHN1YnNlcXVlbnRseSANCj4+PiByZW1vdmVkLiBJ biBnZW5lcmFsLCBpZiBhIHBvcnRzIGJsb2NrcyBwcm9ncmVzcyBmb3Igc29tZSB0aW1lIGl0 IHdpbGwgDQo+Pj4gYmUgcmVtb3ZlZCBzbyB0aGF0IHByb2dyZXNzIGNhbiBiZSBtYWRlLiBG b3IgbW9yZSBkZXRhaWxzIHNlZSBiZWxvdy4NCj4+Pg0KPj4gVGhlIHBocmFzaW5nICJibG9j a3MgcHJvZ3Jlc3MiIGlzIHByb2JsZW1hdGljLiBQcm9ncmVzcyBvZiB3aGF0PyANCj4+IElu ZGlzY3JpbWluYXRlbHkgaHVudGluZyBkb3duIEVPTC9hcHBhcmVudGx5IGluYWN0aXZlIHNv ZnR3YXJlPyBNYXNzIA0KPj4gbWlncmF0aW5nIGZyb20gb25lIGJ1aWxkIHN5c3RlbSB0byBh bm90aGVyIGR1ZSB0byBwcmltYXJpbHkgcGVyc29uYWwgDQo+PiBwcmVmZXJlbmNlLCBldmVu IGFnYWluc3QgdXBzdHJlYW1zJyB3aWxsPyBUaGlzIHBocmFzaW5nIGlzIHZhZ3VlIA0KPj4g ZW5vdWdoIHRvIGp1c3RpZnkgZGVwcmVjYXRpbmcgYW5kIHJlbW92aW5nLCBzYXkgRU9MIChi dXQgc3RpbGwgDQo+PiBmZXRjaGFibGUgYW5kIGJ1aWxkYWJsZSkgbGlicmFyaWVzIG5lZWRl ZCBieSBhY3RpdmVseS1tYWludGFpbmVkIGFuZCANCj4+IHN1cHBvcnRlZCAoYW5kIHBvcHVs YXIpIHNvZnR3YXJlIHRoYXQgYXJlIGluIG5vIHJ1c2ggdG8gbWlncmF0ZSBhd2F5LiANCj4+ IElmIHRoaXMgdmFndWVuZXNzIGlzIGludGVuZGVkLCB0aGVuIGl0IG5lZWRzIHRvIGJlIGFj Y29tcGFuaWVkIHdpdGggDQo+PiAqdXMqIGFjdGl2ZWx5IGRldmVsb3BpbmcgaW4gdGhlIHVw c3RyZWFtIHByb2plY3QgdG8gc3VwcG9ydCBlZmZvcnRzIGhlcmUuDQo+IA0KPiBUaGUgc2Vu dGVuY2UgeW91IHJlZmVyIHRvIGlzIGp1c3QgYSByb3VnaCBzdW1tYXJ5IG9mIHdoYXQgaXMg ZGVzY3JpYmVkIA0KPiBpbiBtb3JlIGRldGFpbCBmdXJ0aGVyIGRvd24uIGUuZy4NCj4gDQo+ Pj4gLSBUaGUgcG9ydCBkb2VzIG5vdCBhZGFwdCB0byBpbmZyYXN0cnVjdHVyZSBjaGFuZ2Vz IChpLmUuIFVTRV9TVEFHRSwgDQo+Pj4gTUFOUFJFRklYLCBjb21waWxlciB1cGRhdGVzLCBl dGMuKSB3aXRoaW4gNiBtb250aHMuIFBvcnRzIHNob3VsZCBiZSANCj4+PiBzZXQgdG8gREVQ UkVDQVRFRCBhZnRlciAzIG1vbnRocyBhbmQgY2FuIGJlIHJlbW92ZWQgYWZ0ZXIgNg0KPj4+ DQo+IA0KPiANCj4+IFRoZXNlIHJlYXNvbnMgYXJlIGdvb2Qgb24gZmlyc3QgcmVhZCBidXQg dGhlIHByZW1pc2UgbmVlZHMgdG8gYmUgDQo+PiB3b3JrZWQgaW4gZWFybGllci4gQWxzbyBu ZWVkIHRvIGNvbnNpZGVyIGFjdGl2ZWx5LW1haW50YWluZWQgYW5kIA0KPj4gc3VwcG9ydGVk IHNvZnR3YXJlIHRoYXQgaGFwcGVuIHRvIHVzZSBFT0wgZGVwZW5kZW5jaWVzLg0KPj4NCj4g DQo+IEkgZG9uJ3QgdW5kZXJzdGFuZCB3aGF0IHlvdSBhcmUgdHJ5aW5nIHRvIHNheSB3aXRo IHRoZSBmaXJzdCBzZW50ZW5jZS4gDQo+IEl0J3Mga2luZCBvZiBpbXBsaWNpdCB0aGF0IHdl IHdpbGwgbm90IGFsbG93IHJlbW92YWwgb2YgbGlicmFyaWVzIHRoYXQgDQo+IHN0aWxsIGhh dmUgKGxvdHMgb2YpIHBvcnRzIGRlcGVuZGluZyBvbiB0aGVtIHdpdGggdGhpcyBwb2xpY3ku IEJ1dCB3ZSANCj4gc2hvdWxkIHByb2JhYmx5IG1ha2UgdGhpcyBleHBsaWNpdC4gSSdsbCBh ZGQgYSBub3RlIGFuZCBjb21lIHVwIHdpdGggDQo+IHNvbWV0aGluZy4NCj4gDQpVbmZvcnR1 bmF0ZWx5LCBpbXBsaWNpdG5lc3MgaW4gdGhpcyByZWdhcmQgaW4gdGhlIGJlZ2lubmluZyBv ZiB0aGUgDQpkb2N1bWVudCBpcyBlYXNpbHkgbG9zdC4gIkJsb2NrcyBwcm9ncmVzcyIgY2Fu IHN0aWxsIG1lYW4gYmxvY2tpbmcgYW4gDQppbmRpdmlkdWFsJ3Mgd2l0Y2ggaHVudCB0byBj dWxsIGFsbCBFT0wgb3IgYXBwYXJlbnRseSBpbmFjdGl2ZSBwb3J0cyANCndpdGhvdXQgZG9p bmcgYW55IHJlYWwgdXNhZ2UgYW5hbHlzaXMuIFRoaXMgaXMgY2VydGFpbmx5IG5vdCB0byB0 cmVuZCBpbiANCnN1cHBvcnQgb2YgYW55IHNvZnR3YXJlIG11c2V1bSB2aWJlcywgYnV0IHRo ZSBwb2ludCBhYm91dCBkdWUgZGlsaWdlbmNlIA0KaW4gc2F5LCBpbmFjdGl2ZSBvciBpbmZy ZXF1ZW50bHktY29tbWl0dGVkIHRvIHNvdXJjZSBjb2RlIGRvZXNuJ3QgDQphdXRvbWF0aWNh bGx5IG1lYW4gb2xkIGFuZCBhYmFuZG9uZWQgKHNvbWUgc29mdHdhcmUgbGl0ZXJhbGx5IGRv bid0IG5lZWQgDQptb3JlIGZyZXF1ZW50IGNvbW1pdHMgb3IgdXBkYXRlcykgbmVlZHMgdG8g YmUgbW9yZSB1cC1mcm9udCBhbmQgbm90IGluIA0Kc29tZSBkZXRhaWwgZnVydGhlciBhbG9u ZyBpbiB0aGUgZG9jdW1lbnQuDQoNCllvdSBkb24ndCBuZWVkIGxvdHMgb2YgY29uc3VtZXJz IG9mIGFuIEVPTCBzb2Z0d2FyZSB0byBzb3cgZnJpY3Rpb24gaW4gDQp0aGUgY29tbXVuaXR5 OyBqdXN0IG9uZSBhY3RpdmVseS1tYWludGFpbmVkIGFuZCBzdXBwb3J0ZWQgdXBzdHJlYW0g DQpzb2Z0d2FyZSB0aGF0IHVzZXMgc2FpZCBFT0wgZGVwZW5kZW5jeSBpcyBlbm91Z2guIEFu ZCB3aGVuIHNvbWVvbmUgb3RoZXIgDQp0aGFuIHRoZSBsaXN0ZWQgbWFpbnRhaW5lciB2aWVz IGZvciBkZXByZWNhdGlvbi9yZW1vdmFsIG9mIHNhaWQgRU9MIA0Kc29mdHdhcmUgd2l0aCBj b25zdW1lcnMsIHRoZSBvbnVzIGhhcyB0byBiZSBvbiB0aGUgcHJvcG9uZW50IHRvIGFjdGl2 ZWx5IA0KaGVscCB0aGUgdXBzdHJlYW0gcHJvamVjdHMgaW4gbWlncmF0aW5nIGF3YXkgKHVw c3RyZWFtIGJ1ZyByZXBvcnRzIGFyZSANCm5vdCBlbm91Z2gpLCBpbmNsdWRpbmcgY2VydGlm eWluZyB0aG9zZSBjaGFuZ2VzIG1ha2UgaXQgaW50byB1cHN0cmVhbSANCnJlbGVhc2VzLg0K DQotLSANCkNoYXJsaWUgTGkNCi4uLm5vcGUsIHN0aWxsIGRvbid0IGhhdmUgYW4gZXhpdCBs aW5lLg0KDQo= --------------lyNEkyzCUBA6J9gOhtJOtkhj-- --------------yssiST54msP8rWZLd8Od0Wdh Content-Type: application/pgp-signature; name="OpenPGP_signature.asc" Content-Description: OpenPGP digital signature Content-Disposition: attachment; filename="OpenPGP_signature.asc" -----BEGIN PGP SIGNATURE----- wnsEABYIACMWIQRTQA7vBfo8y1zE1rpnj5NgWEFcygUCZd+3zgUDAAAAAAAKCRBnj5NgWEFcyqNL AQCfz8vmlPvdMintyrpiBDyeQsf9E6LUZabAJfA4tpAHOgD+LJH/yKqhe28YJkSWH476b3ihXbQb u2Y8YOCTcijmww4= =gG4m -----END PGP SIGNATURE----- --------------yssiST54msP8rWZLd8Od0Wdh-- From nobody Wed Feb 28 23:12:13 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlVVt5V4zz5CbpD for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 23:12:22 +0000 (UTC) (envelope-from mirror176@hotmail.com) Received: from NAM10-MW2-obe.outbound.protection.outlook.com (mail-mw2nam10olkn20801.outbound.protection.outlook.com [IPv6:2a01:111:f403:2c12::801]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlVVs6HMYz4x09 for <ports@freebsd.org>; Wed, 28 Feb 2024 23:12:21 +0000 (UTC) (envelope-from mirror176@hotmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=gkzKw9Ou; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of mirror176@hotmail.com designates 2a01:111:f403:2c12::801 as permitted sender) smtp.mailfrom=mirror176@hotmail.com; arc=pass ("microsoft.com:s=arcselector9901:i=1") ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=LJdyn86BozPpyzw5PZV24jGkRglaBPQ6uKn1iO3VEJ/mPAxDhJhxVodO1j53YObkOf+91BQx48iE6sJj1H/MmHf6ZNvecSHvzCicrNOcriN4SpLnTOjqXeOndhIBrpSABEPQZ78sfakufrUKZdWXPDN5EPHYRlt0oUnF4uxuFl8ERToJsZGkJq9Dp8dqsEKV2iVTfalBP1Dd0uV4Ta6wPDzU3ZCujmz0s+Ti6GJJ8NJRAw0GijPvIl68yfzIZP377nInmcRSnrPssy/WTptU4sbqQE7DnIjJKVoZPqGbOAQ68R9J+69T2LnCj6XLn6M7EmWatkurIh3Co0nlgUjjcg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=2CIa8YuBukeen1jTxBzlBGJWSrYAH3JmryaQ7hmxGbE=; b=LCEyIB/t9+UBz4eodV7ORE3rLMnJMMAPLbbAJPuogAnxV116E5TQRxAdLoFahDmYzjeGhIf7qjchKohSTypl2ZdMLNYxnZkfMO0aXotJtEYysgA75WmR830ZZ+QclgpqdTX4mGucbETZmbUydvV2hJOAU7KTPlDPmYC7q0TEm3t9Be/YH4gd5qIQyLj52peQ0qQM9YIS6djeVdxYpSdswRN6RIwFkZAHhR0Ggsujujg2LBbj5HuTvXBJ6GyvADMF4ioHBToQKDlr9UKdJbG/7MG9zmud9AMgsDvTn8PSx4xOkRB1N0hi5AxVLD11ePm1OgHhCyfcsX80bu/3y3TrEQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=2CIa8YuBukeen1jTxBzlBGJWSrYAH3JmryaQ7hmxGbE=; b=gkzKw9Ou+48i7Gkf/anfUMg5cKXJvFTTZduOw1BdKIruSbKJ27ug+jfwM4/D6+Rf1/Z9VkewgT4y3hA/Iec2ZUuZFdx2/7QxK729c5mAagMBljBIx690PE4N8h/07pF9k5a4CY6TZaSy3JxRPV5kzrPQ9wjLZWykIN0GHrzJ1GEMqKPiMbR2gJL8t4t7czFT5mi3dLu4HlEMfHUc4HafgChPvu8dfwnfnN5108HFvTVNVzwCgA1bxqg0En6+rws6N0fzbgP7NovOoez1dNa1/o/m3ZrF0EaBVxw0HAddKLnSG1z36QLqg/6UYucIWYtowoQFgw7buMF5NXCQVuRVnA== Received: from CO1PR11MB4770.namprd11.prod.outlook.com (2603:10b6:303:94::19) by DM4PR11MB6431.namprd11.prod.outlook.com (2603:10b6:8:b8::6) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7339.23; Wed, 28 Feb 2024 23:12:17 +0000 Received: from CO1PR11MB4770.namprd11.prod.outlook.com ([fe80::e526:b74c:4798:1295]) by CO1PR11MB4770.namprd11.prod.outlook.com ([fe80::e526:b74c:4798:1295%4]) with mapi id 15.20.7339.024; Wed, 28 Feb 2024 23:12:16 +0000 Message-ID: <CO1PR11MB47704367D666EFFB003CE07FE6582@CO1PR11MB4770.namprd11.prod.outlook.com> Date: Wed, 28 Feb 2024 16:12:13 -0700 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: en-US To: ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> From: "Edward Sanford Sutton, III" <mirror176@hotmail.com> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-TMN: [v+f2qlewSMtmf5X6BPmq9KQa5mjZdfeT] X-ClientProxiedBy: BL0PR03CA0009.namprd03.prod.outlook.com (2603:10b6:208:2d::22) To CO1PR11MB4770.namprd11.prod.outlook.com (2603:10b6:303:94::19) X-Microsoft-Original-Message-ID: <8bac6d4b-d81a-4d54-a0d1-f388298340c1@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: CO1PR11MB4770:EE_|DM4PR11MB6431:EE_ X-MS-Office365-Filtering-Correlation-Id: 2ed50f86-b4a7-48eb-3f6b-08dc38b2b483 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: D2b2FgvdM5lSBGqbiv7gkveztIWmCnDFMuEH5Cz6bvQi0lkGCwA4jELMYGs2a2JLHJTfOt6Q5fiPBZ9J94wiD4fKLhVOWAOWY/NNLjjSRUWIIQFQJwpap6vIs0/KBVt3c0byFxgBRQqx5pJSnW5wjTBxzfMi+ki2VvTZR3HjEvAbyTtK02acbriHRHXKCXm9Da+2AW/G6W0NZKM2pxPbrNSMDc1p86RXhCyqtU7+wIwSmAlKLwUx7LKJV7PCzopN6EYgstgxt0i9U/14g4rPR2MSSDGt64+ZEd/ulC4d/JX3IQbgfzZZ4sKAHKJrlye83bIMvOqg2LG1Ph8zYJ/h3YAU0kTFQoTsdlJZY5eY1jv1qkaWgxFGUKZmzyJZVmw38i/VottZSc8i5Oc6hPDbDY1xqOgo59TOiVe7uOmyNBRN0cSrPv8XbO1akFABkQLgy0j3yka2BnNU2Aiik15vKbTOZCOC7HoE4t0Q0ueD8ENxuXTI7hyf3Lgg97yBPxBNYPa6Yjj/aVPj7zEWMtBh+QZdHVIEgcoobEFrw5HlErMmkRKJNEVVJxxtDTtQ/FH8 X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?bnFCd1VNbWNuaU04QzNlenZYNnRTeVNwM2JzUTJBN1YvVGdNVVJCV0I1djBz?= =?utf-8?B?a0tUMFJZT082bHFIeTQzbGo3SVJqK0xOUDZNYXRyRHdoZWk4MFFjYkR1V2pN?= =?utf-8?B?dmhwRlFTakFkWldtbG8xUUJmM2Q5a0pENlVZNVVIUlNIckVRcUh4S0xHSnZF?= =?utf-8?B?cTJVRWdDRm54WU1udzNpRjZDM1J2bWU5dkc4bSt5Z0dXNHNqbjR3NFkvV2Qw?= =?utf-8?B?aXdCY0ZTWmsrbEdubENHWDBjdlZSQXRjbmVJZ1hrUkNaR3RpdUxYUTB2NmhS?= =?utf-8?B?cTBQWDdGTkdkRlU0a29nZWcxWHE5eXlPdEswNzVhZ1BpQ2NmUFpYdUtWNXBl?= =?utf-8?B?aXlVNkwxUnkxYmw2VEVndDUzbFlXcjNEaFUxTzlUaWZpV0ozanR6NTBDNXla?= =?utf-8?B?V1N5MTdzTWZHemRQS1R0cDAzR04zenY3VVR5cHIybnkwWS9zL3hVNTk0b0xY?= =?utf-8?B?bGFkT2dsSVBKb0ZPN3hTL1pwQVJFVVFrbVJpQ3VKSHgvcFJocmJ4ejVMUmZn?= =?utf-8?B?OTNRMDJ3VWIvRkZVdTRic1VTL3ZMQ1Qyb1JHUkE5bkEwQWp2dGhqMFBFOFVG?= =?utf-8?B?U0hzdzkya0gyN1AxbEdsN0hFR0FIaDg5c0MzVVZoVjBMSldLUVErdnVvVjlQ?= =?utf-8?B?Y2VBZGtDNnpZcjJUdmp5Wm1UTGJaaVI1UWJETzlmekdGeVl2SVczRHE3bjcy?= =?utf-8?B?eEdFNkRkOGdqSWpPRm1McUZBMno4SUladC90blRGVEpaMGUvMUJSUkFIa3RF?= =?utf-8?B?b3dnMkFhazZ3dlZQWXpnRkVBekRnREpaYURLUmVIVlU1aDdGamxlbUl5N05n?= =?utf-8?B?bVRLN250bkJPa2RvbitSQjdoTTlqSEtDVnZEaER0Q3lqUmh1U2YwSWRWaXBm?= =?utf-8?B?T0k5ZjV4bm9VWXFTNlFIS1dsVUpoaCt1UllSLzNod2xXZnczSW5rZkdiYkRP?= =?utf-8?B?V3M2bVFqUjcwcHBrd2JDQVBCYnc4SFh0aktDRWkrUXhDUU5Bc1hLTktHeDM2?= =?utf-8?B?NkJrZS9DL3FYUjJTQmVJU0tVUzdBaDY1M0Z1bzR0SXFYUkxOWjMrek85RzZP?= =?utf-8?B?bnNVV0t4MG0xdFFpbWpYZUFyVk1pRjZnOTdCYVVaOU1UM2Q1NTFIdjVnSDdu?= =?utf-8?B?ZU9OdUZFN0ZSRE4rdHd3Yk44Z2FTblNxWUlvbFZQQk9BZGh1S1VIdk5uMG5E?= =?utf-8?B?QUNNS3ZWeU5TU3FWbFc1RWZhV05waGt6OURIT1NZVWhDRFNkUUdBbkgwMVJu?= =?utf-8?B?cTN6MmhhemVJbS9ZbUNreGZSazdvRHFwK0R6L2JGSHFrY05XWGwwK01MMFli?= =?utf-8?B?dzVPbHZCMDllT0tKRDdzV1ZSKzE1T09sY3VjTnFVMnJUTWltMlV3NUcvVGg2?= =?utf-8?B?TXc1UG5PYlluZmxndVdqS3R1dytiNkZWcjdOOVlyMnl2UTdGNi9jYUVkZE12?= =?utf-8?B?bTl3ZThVUnhQWDZnYmZObGk3WmEwVXpSUkJKSVh0VXpZMzhELy9zbVJrb2dk?= =?utf-8?B?MmIrQW9TUkY1N1BJM3hoaUNtTGxRM0NVbEdMM2JDaVBYUjRhWG4vbndubkFk?= =?utf-8?B?RFI2R3I1ZUxCUEZqQVJzRXJoSm5mcFNJMWdhL0VNTDMxZjhRaHErNzVvZmI3?= =?utf-8?Q?AnFMiRtjXXTC1UhiQvOXbTadkVyg2i2Zu+Spln4y5rLA=3D?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-e8f36.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: 2ed50f86-b4a7-48eb-3f6b-08dc38b2b483 X-MS-Exchange-CrossTenant-AuthSource: CO1PR11MB4770.namprd11.prod.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 28 Feb 2024 23:12:16.6343 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM4PR11MB6431 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.49 / 15.00]; FORGED_MUA_THUNDERBIRD_MSGID_UNKNOWN(2.50)[]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.996]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; R_SPF_ALLOW(-0.20)[+ip6:2a01:111:f403::/49]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; RCVD_IN_DNSWL_NONE(0.00)[2a01:111:f403:2c12::801:from]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; RCPT_COUNT_ONE(0.00)[1]; FREEMAIL_FROM(0.00)[hotmail.com]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:8075, ipnet:2a01:111:f000::/36, country:US]; MLMMJ_DEST(0.00)[ports@freebsd.org]; RCVD_TLS_LAST(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[hotmail.com:dkim]; RCVD_COUNT_TWO(0.00)[2]; TO_MATCH_ENVRCPT_ALL(0.00)[]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[hotmail.com:+] X-Rspamd-Queue-Id: 4TlVVs6HMYz4x09 On 2/28/24 12:22, Florian Smeets wrote: > Dear ports community, > > as the removal of ports is a recurring source of friction and dispute we > would like to add a ports removal and deprecation policy to the porters > handbook. If it is clear that guidelines could be interrupted/altered as discussion opens up and that it isn't necessarily a set in stone process as a result, it can put people's mind at ease that efforts are being organized instead of people are just trying to stomp out things in a quick and concise manner at the first justifiable chance. I have and still use a python2 dependent program that is so niche that I never saw it hit the ports tree (and didn't like my own porting effort's results). I have not yet successfully migrated to a non python2 solution successfully; I lost all upstream support as others moved on to new shiny things which I hope to do someday but they aren't direct replacements. Obviously no one would keep python2 in ports for my case then, but I did benefit from others having reasons that kept it there. I also know that without, I could setup an old ports tree, and package lock/jail/virtual machine my way through the problem. Watching the python2 deprecation/removals kick into gear felt like a weird clash between maintainer and user community. Looking back, I wonder if a different solution of 'let someone else become maintainer' may have been better since it was being triggered by an EOL instead of vulnerabilities and broken builds. Can EOL upstream case be clarified for when an upstream is required and what meets said upstream? Some upstreams don't accept patches and others seem to only fix things based on outside submitted patches. That seems to blur the lines between upstream, community, and port maintainer for who can do things. I figure my more extreme example above of python2 had a fight that EOL was important as vulnerabilities were common enough and project was big enough that 1 or a few people would not be able to guarantee a safe+working state; As safe is 'never' guaranteed anyways which makes it more confusing there. I forgot to mention it, but am still thankful for all who make the ports tree happen: maintainers, users who submit PRs with/without patches, general committers, and those who organize all of this structure and flow. Though not perfect, all of that effort has lead to making it a generally great experience over the years that I have used it. > We tried to find a sensible middle ground between too fast removal and > keeping unmaintained and abandoned upstream software in our ports tree > forever. > > When can or should ports be deprecated or removed? > > This policy should give some guidance on when ports can or should be > removed. In general ports should not be removed without reason but if a > port blocks progress it should be deprecated and subsequently removed. > In general, if a ports blocks progress for some time it will be removed > so that progress can be made. For more details see below. > > > Ports can be removed immediately if one of the following conditions is met: > > - Upstream distfile is no longer available from the original > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not > count as "available") > - Upstream WWW is unavailable: deprecate, remove after 3 months > - BROKEN for more than 6 months > - has known vulnerabilities that weren’t addressed in the ports tree for > more than 3 months > > > A port can be deprecated and subsequently removed if: > > - Upstream declared the version EOL or officially stopped development. > DEPRECATED should be set as soon as the planned removal date is know. > (It is up to the maintainer if they want to remove the port immediately > after the EOL date or if they want keep the port for some time with > backported patches. Option two is *not* possible without backporting > patches, see vulnerable ports) The general suggestion is that EOL > versions should not stay in the ports tree for more than 3 months > without justification. > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set > to DEPRECATED after 3 months and can be removed after 6 > > > Reasons that do not warrant removal of a port: > > - Software hasn’t seen a release in a long time > - Upstream looks inactive for a long time > > Florian (on behalf of portmgr) > From nobody Wed Feb 28 23:47:54 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlWJ14DLDz5CdpH for <ports@mlmmj.nyi.freebsd.org>; Wed, 28 Feb 2024 23:48:01 +0000 (UTC) (envelope-from mirror176@hotmail.com) Received: from NAM04-DM6-obe.outbound.protection.outlook.com (mail-dm6nam04olkn2035.outbound.protection.outlook.com [40.92.45.35]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlWJ05Zqmz50Ld for <ports@freebsd.org>; Wed, 28 Feb 2024 23:48:00 +0000 (UTC) (envelope-from mirror176@hotmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=hotmail.com header.s=selector1 header.b=bXIxjrhU; dmarc=pass (policy=none) header.from=hotmail.com; spf=pass (mx1.freebsd.org: domain of mirror176@hotmail.com designates 40.92.45.35 as permitted sender) smtp.mailfrom=mirror176@hotmail.com; arc=pass ("microsoft.com:s=arcselector9901:i=1") ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=miHKVtB5R5cUV782f6mme9sEu4fB9Vb9kvFPcX/XfGaNWE3esKYvPDGlmeQuSIlGp2ppSOISo9GZ7thfNKzWnliZc536ffRdrsNwNzcxin2wJ5Kbw2LPIInR+JAaBODu17PeMlxG/6AcIrHZ1Td+R9HOhAJn1vQolPr6Puo8NEvPrGBQcb/P9bW1eyR6Z4HE8p/2RuGHLpe/QDr9M33f+ZWjk/K8kMQjXUF4Nnlvr+tZJWz0Nhbw+r/sqALYYscVGkaTuTSa9i8jk7IH5c0DL6wwOp4DPq8rQfZIC27BeyorO6/yWTtKOH5SfNvNoIaxlpI9VuthxLUopKHXMrSfWg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=7tw13UCRn4uJ+L3REs2A+/rRKku5OjM3Wwr3tzee4yM=; b=aDgaxd85kddF8vmYqFpjoZF+A+7VtpFMql1gqeMkdzNnNpNIMtsypgnGhnkB+IWw0dNM86jx+dh/iCCN6MTeqSGt7JpLjx2JE42C29H88+1dA16HZDuWoAHGj/rj12rpKgZKlzzZ+Oo0RTi4l2QQIogrBKzn3X2OAc3U6Wlix5HBjuM1IvokoHK2IJD6r4vG4vJJmPR6IjpwLpcLVFMDUG20M8zCCNVIE3s0K/4IRPy7iOVJqVRLZYKdfVAyFSs7SS9+sc6lGxUsjSQkmcrPQ43LqdOSfS4SJFUdiyQM5Jr9jjRGodbRm9/blGxsWViXoYDz1Ar/HExqgXETbe09zA== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=7tw13UCRn4uJ+L3REs2A+/rRKku5OjM3Wwr3tzee4yM=; b=bXIxjrhUbVxPW3uGbpvVD3NF3/zEQfU0bTbRXgfsFoPd2jKZfGeQrqvXhsvsa5PzW/apGiWDud625qSRGfuBc9gjUFG7NzIBaG4IudEbXFMqRkIa6cgnOs/LENAtJ9FhQxFoWBftDQxtWdnpMt7LaYWF8MzYMPq5VMEvB6v/WIEiBAQuKk1XSQZUVBlQcCc8WdCGEqEH/kIcHCp+34w1kw3ZuGIpqagKQIRvj0pNGVxyemTc52dLXZ7ZZDIwc+uBtEYHYZBJNhkiw95w9s+c/NZ/ML9SlOde6Z/gviJlCZpfP75sjksvDydWC4blA6/mA6DC9dAnfbjuXgzqbv0TiA== Received: from CO1PR11MB4770.namprd11.prod.outlook.com (2603:10b6:303:94::19) by SN7PR11MB6800.namprd11.prod.outlook.com (2603:10b6:806:260::17) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7362.12; Wed, 28 Feb 2024 23:47:58 +0000 Received: from CO1PR11MB4770.namprd11.prod.outlook.com ([fe80::e526:b74c:4798:1295]) by CO1PR11MB4770.namprd11.prod.outlook.com ([fe80::e526:b74c:4798:1295%4]) with mapi id 15.20.7339.024; Wed, 28 Feb 2024 23:47:58 +0000 Message-ID: <CO1PR11MB4770AC3B189467872EDB17C1E6582@CO1PR11MB4770.namprd11.prod.outlook.com> Date: Wed, 28 Feb 2024 16:47:54 -0700 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: en-US To: ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <fb42e7b5-be11-4d6f-bacd-90bfd361ed48@quip.cz> <1500d4f4-2bdb-4d3b-8848-900346f4d194@FreeBSD.org> <7d2a8e8e671578f99ed05431b68cf015@bsdforge.com> From: "Edward Sanford Sutton, III" <mirror176@hotmail.com> In-Reply-To: <7d2a8e8e671578f99ed05431b68cf015@bsdforge.com> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-TMN: [z+q9gCM41SzQQdh+8IGBkHSU/LYyLD9a] X-ClientProxiedBy: MN2PR07CA0016.namprd07.prod.outlook.com (2603:10b6:208:1a0::26) To CO1PR11MB4770.namprd11.prod.outlook.com (2603:10b6:303:94::19) X-Microsoft-Original-Message-ID: <99788897-298a-4681-bf15-9c7a4b0a20de@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: CO1PR11MB4770:EE_|SN7PR11MB6800:EE_ X-MS-Office365-Filtering-Correlation-Id: 88ee04c9-86ee-47c4-529c-08dc38b7b0e1 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: qKQ2DmFSct1zK8OWH449rFRFPy0tN+b1i4nIUb6g0L8emfX2xqtnLW44AniMdLBFTGj8jYcb1bEFuehiyH9YGKrKFopuu1xbGcJsIQbpeF7sUcI4RU5/2Zj3GvpfnlFvr8i/NjUkWONhqRSAw4CFJBf8dKON6NpC+oNWHFemNWa8v9KdkvA5o9FmhftgzdCXVO5rnGz9CsecFJ12f2Bx4tZ1tYR1zBgnhb7JCqQ8f53ZX0cZUNUgP2i6xltQFMOPUWPgL1sZrxbakW99O/C7SMIDul/xubhlJIN/5Xs0yGZzOleaMu7rSIywO9WUMgOi6E43Dnzn1K5vqcUjdg3Kt1H8omPEkLMyvdaSzDvkUnku3XTxekMUwRZFhrMk9BfS7odVvNzMAvYo4fFU5zD8QJgXOAl9HKQWjOF9/BTRgD7vgJWYbH4s4YV2G4O6isbamoU94M/ek5rS/KtcRLHIOls5eH/iRo9w5Vhoy18VmtdsA9IZde+taPJ2K+3fUNGTq1VYgoMGn5fNEGoSqqEk9ACcOKYQik/FcihSMd2N8WW5ohyZjKUzPQ6l5DHbeGGm X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?OUx2Yldnb0FFd0xpMktiZ29XemlGMitTU3hXYVRiMDFXR05BVkNwbU8rNG92?= =?utf-8?B?V3VaMW5RWkVad2k3VHhJcWN4SE5uUFFMUmJ0b3hHMVpyUlNnYmtENG0yNWZH?= =?utf-8?B?UDF5ZzBtSG5MYktFdWhSaEptU0FRbVFyNFFiYmczK2NVMG5jSnArM3ZLeS9J?= =?utf-8?B?WllHK3A5ZGRleE5oV1dPdzVxalladjJmUlExdWJKTTR1Q0c4NXBmSUo2eWVG?= =?utf-8?B?aGJMdklRdDUrY0tuck9zZW16ZzlES290dWRmcEJnSkZ6dVJSbVlXNEpXR0RJ?= =?utf-8?B?aTA5U01ZTG5zYXhQdE1xQi9vYjMvcUM5c2hTbzBhclVwREdwamZPMmtjbHVz?= =?utf-8?B?L2ZEWmhSVTlUTURUZXMvVWQ0eFp6NTVxaVlkTFllWlpsRklaSzBMeUw0emhv?= =?utf-8?B?RDhGS3JSL20zRDJsY3RLQnFKUEpoTERIczIxRkU4TkZRRnZWNTBObkZpTWQr?= =?utf-8?B?OE80MVltV0FQdzBYcloxd2c0WSs1M1N1VDI3RnhtS0pGYjFuWlBYenVpQmgw?= =?utf-8?B?WkVIMU5scVM2dkVaT3FMdTB3ZVY2WlNXR0M2TFZ3dmdrL0ZwTTNtTHZuZ05J?= =?utf-8?B?K0RiY1JrN1d0dHFoSmpvbFdwMFVrak5zK29CaCtSYVp3ZUxjS0lIZ3k5SDds?= =?utf-8?B?azg2M1M2aW5RNWJ6TitRalh2WmtqazRmNVV2WmFlUGdMRFBiNzdHWEdEMEpz?= =?utf-8?B?L0w0eVFqeURMNVBnQWFlenRiR0FzaE9HaHBsWm5CV3hrUUlSNWkvckNsZEI5?= =?utf-8?B?dGxVVTYyQ2taVVJEY0hyRlZGb09VQUdmZ3F3eVZycjBHWk83VXJweXZtVEpy?= =?utf-8?B?ZkprUERaZUtHR2dnOS9qVkNYeTgxSjFMelcyMVBuVy9zSmNocTFlYnJ0bitk?= =?utf-8?B?T1VZdHhacS9DRVA2WThDcWgxSEJyQXRXbzlFKzVHL3JCRTJYek1rZ0d3TlhS?= =?utf-8?B?bzJnZmR2a0ZhbW53Y3NhUXdSTlRGTlBaVHBsL0hkRmNIdE9zMmxEOEFLT0Ny?= =?utf-8?B?Qk10akcxTHk5VlBQVHJVenFxbm83VGZaY2hybUlzM3hMdmVsSUZraVh6cUxQ?= =?utf-8?B?a09GQmpTWjlyZ0RhaXpTR3lBeHRsNnpBT2RDRTVIYUtkd25sSzREUWVjbXMz?= =?utf-8?B?dW8zeGNQcklMQjdqbUZnNE5ONm50S2lMaEhiaS9yMlBvck9Tb2laMDJkckUy?= =?utf-8?B?ajU3MGsxRmFISi9TTm5mTXNBQTlmOU0xeldwUi9ibjEza3V2WVh3cTFhR3p0?= =?utf-8?B?bW9PRkc2Tlo1aWJXTG8ycDQvSnlIU1RBVkxtRXF0bVhwQnRweSs1dWtVM3hm?= =?utf-8?B?eEVGWXRqT1FlbEpLM0xOZVVGVE5ieXdTRklhbDhGSkUzQzFFeUxCbVpCSTRP?= =?utf-8?B?T2FJQ2R1akZTVUR1Rk83NEpyZFQ4ZWt4aWoxOVJESjc2L1hEMzZ5TjRlNFZD?= =?utf-8?B?SWYxdW1lRkxoTDVva2pGUCtNUXZVWlRpMnBPM1RHZWxYOXc0WURxeUpuSTFX?= =?utf-8?B?WVdiNXFKcTlhaXBjSmRVUENPREF6ZUxWZ3VBRkZ6Mjl3cnZQRW0wT1Bxa3V6?= =?utf-8?B?RmVpV0gwd2Fpam04TGhERjYwNWtSQlFFQkdsb1ByVWRuMFJNcjFiT3dXVUlz?= =?utf-8?Q?Jgwl/vQXlh+MeqSrwAlTIsufz/JZSeS/W1G3ixFxXXtE=3D?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-e8f36.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: 88ee04c9-86ee-47c4-529c-08dc38b7b0e1 X-MS-Exchange-CrossTenant-AuthSource: CO1PR11MB4770.namprd11.prod.outlook.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 28 Feb 2024 23:47:58.0796 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: SN7PR11MB6800 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.32 / 15.00]; FORGED_MUA_THUNDERBIRD_MSGID_UNKNOWN(2.50)[]; ARC_ALLOW(-1.00)[microsoft.com:s=arcselector9901:i=1]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-0.999]; NEURAL_HAM_SHORT(-0.83)[-0.833]; DMARC_POLICY_ALLOW(-0.50)[hotmail.com,none]; R_SPF_ALLOW(-0.20)[+ip4:40.92.0.0/16]; R_DKIM_ALLOW(-0.20)[hotmail.com:s=selector1]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; RCPT_COUNT_ONE(0.00)[1]; DWL_DNSWL_NONE(0.00)[hotmail.com:dkim]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_LAST(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_FROM(0.00)[hotmail.com]; FROM_HAS_DN(0.00)[]; FREEMAIL_ENVFROM(0.00)[hotmail.com]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[hotmail.com:+]; TO_DN_NONE(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[40.92.45.35:from]; MLMMJ_DEST(0.00)[ports@freebsd.org]; ASN(0.00)[asn:8075, ipnet:40.80.0.0/12, country:US]; RCVD_IN_DNSWL_NONE(0.00)[40.92.45.35:from] X-Rspamd-Queue-Id: 4TlWJ05Zqmz50Ld On 2/28/24 14:38, Chris wrote: > On 2024-02-28 12:13, Florian Smeets wrote: >> On 28.02.24 21:00, Miroslav Lachman wrote: >>> On 28/02/2024 20:22, Florian Smeets wrote: >>> >>>> Ports can be removed immediately if one of the following conditions >>>> is met: >>>> >>>> - Upstream distfile is no longer available from the original >>>> source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do >>>> not count as "available") >>> >>> I miss some sort of time frame like in the following cases. The way >>> the sentence is written now, it looks like there may be an immediate >>> removal on the first day of the outage. >>> >> >> Good point. Yeah, it certainly isn't the intention to remove it >> immediately. I >> will make a note to add a time frame. I'm thinking 4 weeks, as that >> feels long for >> a site to go away and reappear, but we might just make it 3 months as >> with most of >> the other points. > I'd vote for 3 (mos). But 2 also seems reasonable. So that those that > use it. But don't > update frequently get a chance to notice, and subsequently save/maintain > it. :) In general, a port could always be pulled back out of a death that happens too early as the ports tree history is always available. The 'saving' makes sense both for a webpage (especially if valid WWW is 'required', which seems debatable and unlikely). A different take on 'saving' a (port, is availability can be interrupted; I build my own packages with poudriere+latest but a quarterly package user may be hit with it disappearing unexpectedly depending on when it gets marked, if that mark is applied to their quarterly branch (committers are human so if its not automated, it will likely happen at some point), when the next quarterly/latest build finishes so that package users see it through message or package deletion. Then if it wasn't already deleted yet, pkg users for sure find out when it is and removed. Once that point is reached, users then have to wait for the port to be restored to the appropriate branch and the next build run to rebuild it; conditionally, users of quarterly branches are the ones to have the least time/chance to react and likely the most time to wait for a resolution when undone/resolved. Do 'scheduled' announcement and action times ever correspond (close) to or account for when builds complete on pkg repositories and when next quarterly update sequence occurs instead of when a Makefile is altered? If the intent is to inform users with a timeframe before action occurs then it is important to make sure the last event that could delay that information going out is considered for scheduling purposes; maybe an automated (or documented committer checklist) check should be implemented that confirms the date it hit the last relevant repository branch/mirror before the next step is performed. Remember that pkg users don't see "broken" unless dependencies were updated without it which causes removal instead of a message; only fix I see here would be like MOVED file but for scheduled/upcoming changes to be announced from. That would also require it be presented before or during delete or tracking non-automatic packages being removed without a deliberate `pkg delete` so it can be prompted from information introduced later. >> Thanks >> Florian > From nobody Thu Feb 29 00:28:40 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TlXCB71WFz5Chxp for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 00:28:54 +0000 (UTC) (envelope-from bsdkaffee@gmail.com) Received: from mail-ed1-f45.google.com (mail-ed1-f45.google.com [209.85.208.45]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TlXCB4Ghqz5697; Thu, 29 Feb 2024 00:28:54 +0000 (UTC) (envelope-from bsdkaffee@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-ed1-f45.google.com with SMTP id 4fb4d7f45d1cf-565ef8af2f5so559027a12.3; Wed, 28 Feb 2024 16:28:54 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709166533; x=1709771333; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=GQW/UXZHAvNBQ3/JWGJiPamVpmpaqvR1uzLH4RyF/l0=; b=D4WBTG4rWAYgK1vrsyMSAKx0sXTOquVyGWNTSR0VnSVt0pFk3L68A7+sJMpdKXyAl1 D8xmNhoTQf0zgBrCMGU97orY0dS9Z1uArbjcxHY7+90IMtAocLfgLUARqxLhxs5Qgyj+ 5U+RHaaMN2sO1vR84dKm7CZwlU3YTAUzAJZZ4y8m34lMPj41DYy74vqM4bLb5fZt14Zv wO+k8+t3kvHu/TPVHQVzplFf5nmt+zATcakZPxqVP3r0Pc/MF9M8ZlegDoMrGeouzEVA bV+JwDfODZV/t2IIPcbrisgTprtWt7v5GRVQROlNbwGgOR7in0BfiJwqNLcTTvMBQzRo NfFA== X-Forwarded-Encrypted: i=1; AJvYcCXvR2mbfuThE21WuIMkP6+HNSdDYIplDVF6a0TWC1KFzRx17yH34H7J7CWMzB2Uquox+/CffPFXmzGu/3rxStAIxw== X-Gm-Message-State: AOJu0Yw5LmGAPssujJDyiAB43y3iWfhQk/3OMYmMXp3dkxov6FToI5xP VixUW7MAxOOr+xERHz2s/S88Z04t7WMMc/N96dgiskLDh8DLBl2eL/aNgIqPc1YV/hJDUgmjAOT jYfUzoQvdlVmwXHAfpa96rI04rpaFCbmgviI= X-Google-Smtp-Source: AGHT+IFGrEGEtjpSClxuxQIog74H1FgY+bk3BUQVx55v85S8RyQnUca0iS4BVAbK/G3+G+4C/neTfGHWYUJCIrg77wI= X-Received: by 2002:a50:cac7:0:b0:566:9fef:1ee9 with SMTP id f7-20020a50cac7000000b005669fef1ee9mr53354edi.22.1709166532431; Wed, 28 Feb 2024 16:28:52 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <CAGBxaX=jyEEfqcE2hYs93+sKt_ax--7yJxD-17bvj9qgQnpdvA@mail.gmail.com> In-Reply-To: <CAGBxaX=jyEEfqcE2hYs93+sKt_ax--7yJxD-17bvj9qgQnpdvA@mail.gmail.com> From: "Jason E. Hale" <jhale@freebsd.org> Date: Wed, 28 Feb 2024 19:28:40 -0500 Message-ID: <CAJE75NEU4=BfCxKuqzsur0M4d=K6zq+xD23idiKnd1n_bmK2LA@mail.gmail.com> Subject: Re: Proposed ports deprecation and removal policy To: Aryeh Friedman <aryehfriedman@gmail.com> Cc: Florian Smeets <flo@freebsd.org>, ports@freebsd.org Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:15169, ipnet:209.85.128.0/17, country:US] X-Rspamd-Queue-Id: 4TlXCB4Ghqz5697 On Wed, Feb 28, 2024 at 2:31=E2=80=AFPM Aryeh Friedman <aryehfriedman@gmail= .com> wrote: > > On Wed, Feb 28, 2024 at 2:22=E2=80=AFPM Florian Smeets <flo@freebsd.org> = wrote: > > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > > MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set > > to DEPRECATED after 3 months and can be removed after 6 > > Does this include special cases such as the following comment in > devel/aegis/Makefile (which I am the maintainer of and since the > upstream is "dead" it was a single person who died in 2012)? > > # XXX Manpages are installed into ${DATADIR} too -- there's no easy way t= o > # stop this because we don't have Makefile.am provided. Maintainer w= ill > # sort this with upstream. > > Note I have updated everything to be built with the latest llvm and stuff= . > That comment was written well before we had staging support and it is simple enough to delete unwanted files from STAGEDIR before they are packaged, but I'm not seeing any manpages in DATADIR anyways, so that comment seems irrelevant. This port was fixed in [1] to install the manpages in share/man, so I don't think there is a problem. Unfortunately, some projects die with their authors, but if you still find the project useful and are willing to maintain it and keep it working with the latest libraries and llvm updates, I don't see why it would be up for removal and don't get that vibe from this policy. With all of the patches though, it might be worthwhile to make a fork of the project and create a new release. [1] https://cgit.freebsd.org/ports/commit/?id=3D85dbd77161c397abe4bcd384e61= 17096ff27d97c -Jason From nobody Thu Feb 29 04:16:06 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TldFM5nM3z5BqM0 for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 04:16:07 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TldFM2TbGz4Pd6 for <ports@freebsd.org>; Thu, 29 Feb 2024 04:16:07 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709180167; a=rsa-sha256; cv=none; b=X9BSSSz+vWDANsAeP/Z7OKr63vCd/JTnDZzcOPL2z6DiC5SHvrKMEKw83mkzCUrMFZdvj9 SYArZZcQKIgpuPS+3UJQMvGWVDGBpk5UUXQoXWmSeEnhUp7zF+t+3swa8MbWGkBvRu+CPn mjvgdoad8xuDB2zpRSUXjYlM3vW31d/y+9z1tckNRLVa1aVssaO90AzV31XMA2R0X35hHu aqbajnNuSKDNE0umzTwFsbESF1Qj433nv/C8R5x8yyN6vPJIO1ozWDsE4Rfqb+DKJW2UKg PXLi3TFho2LN7Cox1w41EO9mNthfOZyWJ/b5rd0n48NqQyGRsln6XknYD6oQog== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709180167; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=J+R5hJLrnLv2qktZznWuPpajByhDQ3w9dNQR+bAWzB0=; b=gWki13gsd4vk+G3Z+1O7Ik70vJVqFzDPUmfYQDCpk99+mBpLSEnUNGIzEjBeEF8bGA3tS8 p06NSh1sVZuxrbKJQOvFNsd4iYKZlxioKIfNTjM3O5IYPgxaTwEJUz+QclCnLzghbnN17N i13PzqW97Za5v/+H1oQ/oI9ZjYja32cSRC1lfG55LFVYsM5cNpegM0X0gQe1RNOoFg/ujW jguxtLZyxGRRzp7ssD90QbEZDd8yXjigwAHdNme0uOvvml2DPcZeOIIyrJyMFlcDaIffZ9 fz7MSDT7h3b8Nq0SVB18ud8qT5VXquhDrj2Rz4DCy+x1fJM1EF2nvMRlvD4UhA== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4TldFL75kbzR2B for <ports@freebsd.org>; Thu, 29 Feb 2024 04:16:06 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 41T4G6L8039642 for <ports@freebsd.org>; Thu, 29 Feb 2024 04:16:06 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 41T4G6RZ039641; Thu, 29 Feb 2024 04:16:06 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202402290416.41T4G6RZ039641@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Thu, 29 Feb 2024 04:16:06 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ databases/neo4j | 4.4.27 | 4.4.31 ------------------------------------------------+-----------------+------------ devel/py-archinfo | 9.0.5405 | v9.2.92 ------------------------------------------------+-----------------+------------ math/py-claripy | 9.0.5405 | v9.2.92 ------------------------------------------------+-----------------+------------ net-im/signal-cli | 0.9.0 | v0.13.1 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Thu Feb 29 09:25:41 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tlm741dzwz5CXf3 for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 09:26:08 +0000 (UTC) (envelope-from einar@isnic.is) Received: from mx01.isnic.is (mx01.isnic.is [193.4.58.133]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx01.isnic.is", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tlm731n0tz4sRl for <ports@freebsd.org>; Thu, 29 Feb 2024 09:26:07 +0000 (UTC) (envelope-from einar@isnic.is) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=isnic.is header.s=20200921 header.b=ZPnPWDdN; dmarc=pass (policy=quarantine) header.from=isnic.is; spf=pass (mx1.freebsd.org: domain of einar@isnic.is designates 193.4.58.133 as permitted sender) smtp.mailfrom=einar@isnic.is Received: from ht-mailstore01.isnic.is (ht-mailstore01.isnic.is [IPv6:2001:67c:6c:56::2]) by mx01.isnic.is (Postfix) with ESMTPS id 18298CE54 for <ports@freebsd.org>; Thu, 29 Feb 2024 09:25:58 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=isnic.is; s=20200921; t=1709198758; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=zNLLvCyAIvIIFZiUuZXBKSv/WDY2xgcDCQsDT4/OGlA=; b=ZPnPWDdNPclIxEdGlyGd48mPwOXznuG6lgKeF1zvMGRch59a0+O+EwxlRDYNXUZoUdTEhc PA0LYioPZ6YvSZIY3dVtx+74mR/NeEZgWF/jY/KxSO5q7kHFnXikpRwa8Kk62Fw/gYI7Bf nZyFd2+DGHwzErYWEC/IHftTzQ5SWFOHhpoi6Wwl8pqLSKntUC86mW/FNrmdzUQcu9AWO4 J/jplVD6QbFWFi4JjG8d3NHcPAV5q2kBH/AiEnK5KQT9XrjlTuXAivtTN9JPR5MCg+gXwt npfdLXqAMPjXql+HU8mV5ytnQl9uT2AraELgXFEEyjjQXbKW43i7hczCnETMYQ== Received: from smtpclient.apple (unknown [IPv6:2001:67c:6c:f100::194]) by ht-mailstore01.isnic.is (Postfix) with ESMTPS id 082C82717C for <ports@freebsd.org>; Thu, 29 Feb 2024 09:25:58 +0000 (UTC) From: =?utf-8?Q?Einar_Bjarni_Halld=C3=B3rsson?= <einar@isnic.is> Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.400.31\)) Subject: Poudriere broken!!! Message-Id: <50EBCDB9-6DC9-4B50-B891-5FDE989A3E9A@isnic.is> Date: Thu, 29 Feb 2024 09:25:41 +0000 To: ports@freebsd.org X-Mailer: Apple Mail (2.3774.400.31) X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.99 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.99)[-0.988]; DMARC_POLICY_ALLOW(-0.50)[isnic.is,quarantine]; R_DKIM_ALLOW(-0.20)[isnic.is:s=20200921]; R_SPF_ALLOW(-0.20)[+ip4:193.4.58.0/23]; MIME_GOOD(-0.10)[text/plain]; ASN(0.00)[asn:1850, ipnet:193.4.58.0/23, country:IS]; SUBJECT_ENDS_EXCLAIM(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; APPLE_MAILER_COMMON(0.00)[]; RCVD_TLS_ALL(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; ARC_NA(0.00)[]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[ports@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MLMMJ_DEST(0.00)[ports@freebsd.org]; DKIM_TRACE(0.00)[isnic.is:+] X-Rspamd-Queue-Id: 4Tlm731n0tz4sRl Hi, I=E2=80=99m using poudriere-devel and it=E2=80=99s completely broken = now!!!! The web UI looks modern and actually works. Safari always had a problem = not updating with info about ongoing builds, that=E2=80=99s fixed now. How am I supposed to work with something like this, when I=E2=80=99ve = gotten used to the old UI?!? I=E2=80=99m starting a petition to bring = back the old broken poudriere UI! Only joking, I love the new UI. Great work! .einar= From nobody Thu Feb 29 12:18:08 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tlqxb57Ggz5C4Lj for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 12:18:11 +0000 (UTC) (envelope-from des@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tlqxb4MQJz4JSD; Thu, 29 Feb 2024 12:18:11 +0000 (UTC) (envelope-from des@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709209091; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=LUsAhKJpz+RdPWDDC40Tnaj6sEOq6O257NL5TpT5GjA=; b=xUSDRijQ+rdOYQBQXaYhjDIDxg3pxV3cNBWbSad/31fhiG/TLFob+4t6tR7LIz4UCTWvEA cazDBkRW9A2UC1OwFkv3WEFn3cD6pqxDzw6IFRuhX8CJEltyr8mcH4IZUoIzIIJrfAdIYA lPEOS4zZmwiMHqs70SCgr3xBCOhBlKh+BU2DaaEIX/C4YhVMbqsfHdmg98d/41kiOMo3p9 Vik+3fK07hvVNh4X+8hYE0aq6/8c53vmelVUq7i93MKDDDXfJeDI1xokQ6ynRFoOo81QBa HRotqPirAy7Wx6XKBeZV0ZkH9h8JRxcil9ijH8wqoNNlatuJMAUmBxINKFOs8g== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709209091; a=rsa-sha256; cv=none; b=KWTqptdt0g6gzYszgv5Exf02CIXL5YmfUnilyQ7RzZUYlz6OZyxWwNVkC3+p5IxC1gyqAV POOGjTG3KIufkbHZe6UOPDIYu/1+AEuEBFr7h8HsXcunwgwmc+/AkjNS1EPPyU4lmzA6T6 TBXeA4zNB6gTEVqMSj54qSQ7FNgTCTvkzPFIp6FhI75qWXMfMy4vExDIOqS1MnqdKVqLqL KXsyYcPjh7vQ58NYG2OKPqwV6CQK/ds2LUAEFdM040dNOZEYLJzAMNPGzE80QDXiOiA65y Ixpy2ILxvZYEZw/EPKinhMLK6Rw/vAYhC+tv2wtVS3q3b86GK37E/RDh+xvJjw== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709209091; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=LUsAhKJpz+RdPWDDC40Tnaj6sEOq6O257NL5TpT5GjA=; b=PqzL09x9dC5ipAVTtuqWWMGgRCMFs31D29NVQ6P0vcyUm0j6FAtyNTHIkE3v9ylTmvG6Xe 9GYhKycRhK24jgOwsK23Uo5GdIIcND2OOR7MLTgf2Yge4/bjtSum6xZ40vtvLIn9z4d8NF a8SIuBfMN7LabGdZ1bOA1Qfq4WTTCVKI7EmTCy6UVBoGeiGVYLdY9LdUx/MHjZ5VXmxm7q u7DlAfqFJ2oDVFTxGJrvoHq9IFDeGo48LM+HClL7Hj2o4llpxL+tk7sITxBLFGd0U1pJEg c7VK2/Ff8S7WTX6L9UvTdvt+uHWNpS6kRerD1QFPhiDHSvBm2BhQLLpCKBb9MQ== Received: from ltc.des.dev (2a02-8428-0993-f001-922e-16ff-fef1-acef.rev.sfr.net [IPv6:2a02:8428:993:f001:922e:16ff:fef1:acef]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: des) by smtp.freebsd.org (Postfix) with ESMTPSA id 4Tlqxb3GDdzMSB; Thu, 29 Feb 2024 12:18:11 +0000 (UTC) (envelope-from des@freebsd.org) Received: by ltc.des.dev (Postfix, from userid 1001) id E7065108690; Thu, 29 Feb 2024 13:18:08 +0100 (CET) From: =?utf-8?Q?Dag-Erling_Sm=C3=B8rgrav?= <des@FreeBSD.org> To: Florian Smeets <flo@FreeBSD.org> Cc: ports@freebsd.org Subject: Re: Proposed ports deprecation and removal policy In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> (Florian Smeets's message of "Wed, 28 Feb 2024 20:22:34 +0100") References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> User-Agent: Gnus/5.13 (Gnus v5.13) Date: Thu, 29 Feb 2024 13:18:08 +0100 Message-ID: <864jdrzcov.fsf@ltc.des.dev> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Florian Smeets <flo@FreeBSD.org> writes: > Ports can be removed immediately if one of the following conditions is me= t: > > - Upstream distfile is no longer available from the original > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do > not count as "available") Strong disagree, give the maintainer a chance to find an alternate mirror or self-host. > - Upstream WWW is unavailable: deprecate, remove after 3 months That's the opposite of immediate removal > - BROKEN for more than 6 months Agree but that's hardly immediate > - has known vulnerabilities that weren=E2=80=99t addressed in the ports t= ree > for more than 3 months Agree but that's hardly immediate DES --=20 Dag-Erling Sm=C3=B8rgrav - des@FreeBSD.org From nobody Thu Feb 29 17:43:38 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tlz996D8hz5Cbs0 for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 17:43:41 +0000 (UTC) (envelope-from cy.schubert@cschubert.com) Received: from omta001.cacentral1.a.cloudfilter.net (omta001.cacentral1.a.cloudfilter.net [3.97.99.32]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "Client", Issuer "CA" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tlz992v9fz4DCy; Thu, 29 Feb 2024 17:43:41 +0000 (UTC) (envelope-from cy.schubert@cschubert.com) Authentication-Results: mx1.freebsd.org; none Received: from shw-obgw-4001a.ext.cloudfilter.net ([10.228.9.142]) by cmsmtp with ESMTPS id feClr3fYLxDxGfkRYrWpMr; Thu, 29 Feb 2024 17:43:40 +0000 Received: from spqr.komquats.com ([70.66.152.170]) by cmsmtp with ESMTPSA id fkRXric24Z0jDfkRYrZWat; Thu, 29 Feb 2024 17:43:40 +0000 X-Authority-Analysis: v=2.4 cv=P8GZhTAu c=1 sm=1 tr=0 ts=65e0c24c a=y8EK/9tc/U6QY+pUhnbtgQ==:117 a=y8EK/9tc/U6QY+pUhnbtgQ==:17 a=kj9zAlcOel0A:10 a=k7vzHIieQBIA:10 a=6I5d2MoRAAAA:8 a=YxBL1-UpAAAA:8 a=EkcXrb_YAAAA:8 a=bAVaSOL64_k-8i0X4loA:9 a=CjuIK1q_8ugA:10 a=IjZwj45LgO3ly-622nXo:22 a=Ia-lj3WSrqcvXOmTRaiG:22 a=LK5xJRSDVpKd5WXXoEvA:22 Received: from slippy.cwsent.com (slippy [10.1.1.91]) by spqr.komquats.com (Postfix) with ESMTP id 0DD84218C; Thu, 29 Feb 2024 09:43:39 -0800 (PST) Received: by slippy.cwsent.com (Postfix, from userid 1000) id 045063A4; Thu, 29 Feb 2024 09:43:39 -0800 (PST) X-Mailer: exmh version 2.9.0 11/07/2018 with nmh-1.8+dev Reply-to: Cy Schubert <Cy.Schubert@cschubert.com> From: Cy Schubert <Cy.Schubert@cschubert.com> X-os: FreeBSD X-Sender: cy@cwsent.com X-URL: http://www.cschubert.com/ To: =?utf-8?Q?Dag-Erling_Sm=C3=B8rgrav?= <des@FreeBSD.org> cc: Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org Subject: Re: Proposed ports deprecation and removal policy In-reply-to: <864jdrzcov.fsf@ltc.des.dev> References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <864jdrzcov.fsf@ltc.des.dev> Comments: In-reply-to =?utf-8?Q?Dag-Erling_Sm=C3=B8rgrav?= <des@FreeBSD.org> message dated "Thu, 29 Feb 2024 13:18:08 +0100." List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 Content-Type: text/plain; charset=us-ascii Date: Thu, 29 Feb 2024 09:43:38 -0800 Message-Id: <20240229174339.045063A4@slippy.cwsent.com> X-CMAE-Envelope: MS4xfMTsQn0EkCefOFYqLafIpfCARI7s6z0BnVXmNGeP0NnBDOrY5XIIIjivm7RuU6h6Wtgatq4AefzNB0/fWFZ6JdHQ9LWtQhMWcgZMn3ywB7Q7zVAcQ1yd St8xWuV7+W9PGpO6lKfVfLL0IZdhc5OHHQF10TW9lUaktm7kvAwvqFN2AFS2Vus8gTHW097PFlrruPI7SnnB0sc0d/+4dR8KlcYoR0lxNRqgjIn3gfc2x6i+ 4Hzi0Hoao7Iy4hbMEH0yuw== X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16509, ipnet:3.96.0.0/15, country:US] X-Rspamd-Queue-Id: 4Tlz992v9fz4DCy In message <864jdrzcov.fsf@ltc.des.dev>, =?utf-8?Q?Dag-Erling_Sm=C3=B8rgrav? = w rites: > Florian Smeets <flo@FreeBSD.org> writes: > > Ports can be removed immediately if one of the following conditions is me= > t: > > > > - Upstream distfile is no longer available from the original > > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do > > not count as "available") > > Strong disagree, give the maintainer a chance to find an alternate > mirror or self-host. +1 > > > - Upstream WWW is unavailable: deprecate, remove after 3 months > > That's the opposite of immediate removal > > > - BROKEN for more than 6 months > > Agree but that's hardly immediate > > > - has known vulnerabilities that weren=E2=80=99t addressed in the ports t= > ree > > for more than 3 months > > Agree but that's hardly immediate > > DES > --=20 > Dag-Erling Sm=C3=B8rgrav - des@FreeBSD.org > -- Cheers, Cy Schubert <Cy.Schubert@cschubert.com> FreeBSD UNIX: <cy@FreeBSD.org> Web: https://FreeBSD.org NTP: <cy@nwtime.org> Web: https://nwtime.org e^(i*pi)+1=0 From nobody Thu Feb 29 19:26:23 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tm1Ry5Rgdz5Cm7C for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 19:26:38 +0000 (UTC) (envelope-from delphij@gmail.com) Received: from mail-ej1-x62f.google.com (mail-ej1-x62f.google.com [IPv6:2a00:1450:4864:20::62f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tm1Rx6s1Rz4YYt; Thu, 29 Feb 2024 19:26:37 +0000 (UTC) (envelope-from delphij@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=ZxZ4BK9k; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of delphij@gmail.com designates 2a00:1450:4864:20::62f as permitted sender) smtp.mailfrom=delphij@gmail.com Received: by mail-ej1-x62f.google.com with SMTP id a640c23a62f3a-a3ed9cae56fso467207966b.1; Thu, 29 Feb 2024 11:26:37 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709234795; x=1709839595; darn=freebsd.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=gqpC0LLsZAmk4obVOmg1LEqeGNecCiDiiC5C0BIjtcY=; b=ZxZ4BK9ktSkUU5+M39m1GSog2ls7uiu8FWG8g3dnQdC9umDYD4BMAfGgZd/OrV2LcW Zqq4QDDwIz+Sku2Qqr2bSfWcmb5BiyejXyd8uhGE09QEWkj4h3vg6SsNsCpeI+081BSr 0gQMOX1M/dOmr4ruITGKikGaOhSBp/vmn3GunBiIdc0XFVLl9el+fBaumTZDj6xK0aUW O6oS4wWTYh0wAKDXzJZ1nlihKyna0hATVuN9obcw8pSFnMEFZ4mWzMpKZsooqKf0Btwk vpAuG95Xe+bXiYICKuNI0fuqQqlOmE4o97uzGAonJAcZQNLubnmcwoePAN/Sk1FnqhrC SMvQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709234795; x=1709839595; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=gqpC0LLsZAmk4obVOmg1LEqeGNecCiDiiC5C0BIjtcY=; b=sZJFf+ttlN+DqZXp6qddTpEt/O831CARmUg7DB8Iq1/yqQuXf8wKzoH+3E4tDoFSVR LmhTtUak5qOUS8E8Iov+/eACJqdpQgHAeTRUU4o+BW76jiQmx+Bmvidz5b95hApsZixH dwrHXvAYIZDRf/VVxRx2KCMEZFhxgGIJzMVMwG15ph1J73nvbJW9I+D34lhuQs9TETD7 qK1YE6oNOWe6hDaZ/QDSk9M7lZOyBxoSkuEJtyFpnK4tEAAestGQ/Y0dqfQfnxk6gfTZ J1P7LlarQWgboVFVqNjvEWqvxaXbYJg0C9NGScv1rxLmzZRlU3Blov9+NgexKw0qP8w8 36+Q== X-Gm-Message-State: AOJu0YyxH7r1zIxiL562MTN+vTktS/hhpwJuTjDu/CpgiRgVk13cRd22 yZOrb80MZY35Bm/Gdw81k8XhyhExlN44PK9+wmKbM+M0LYcltNbIZ4AJYp9+OTy3ch+l5DAobhm 4GOEORXKZA7khZpqHp/ygPG4wtLbDph6jGpNPKA== X-Google-Smtp-Source: AGHT+IGNoI8OC1SkNwwefjj0BDRXDo6TLRM+48Mnm7sj/SqFrLORAVd0OEJwFGcEJeDtWwx/IHitZT9eu8r6GH5/Onw= X-Received: by 2002:a17:907:1114:b0:a44:3056:1ec1 with SMTP id qu20-20020a170907111400b00a4430561ec1mr2212355ejb.6.1709234794550; Thu, 29 Feb 2024 11:26:34 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> In-Reply-To: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> From: Xin LI <delphij@gmail.com> Date: Thu, 29 Feb 2024 11:26:23 -0800 Message-ID: <CAGMYy3s8zqdvuNeiyt673uzhoqcsBZJMdUSY4tLxH+0AQftWuw@mail.gmail.com> Subject: Re: Proposed ports deprecation and removal policy To: Florian Smeets <flo@freebsd.org> Cc: ports@freebsd.org Content-Type: multipart/alternative; boundary="000000000000c45a1f06128a3c1b" X-Spamd-Bar: --- X-Spamd-Result: default: False [-4.00 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.996]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_TLS_LAST(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; ARC_NA(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TO_DN_SOME(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; FREEMAIL_FROM(0.00)[gmail.com]; FROM_HAS_DN(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::62f:from]; MLMMJ_DEST(0.00)[ports@freebsd.org]; MID_RHS_MATCH_FROMTLD(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_COUNT_ONE(0.00)[1]; FREEFALL_USER(0.00)[delphij]; MISSING_XM_UA(0.00)[]; FREEMAIL_ENVFROM(0.00)[gmail.com] X-Rspamd-Queue-Id: 4Tm1Rx6s1Rz4YYt --000000000000c45a1f06128a3c1b Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Wed, Feb 28, 2024 at 11:22=E2=80=AFAM Florian Smeets <flo@freebsd.org> w= rote: > Dear ports community, > > as the removal of ports is a recurring source of friction and dispute we > would like to add a ports removal and deprecation policy to the porters > handbook. > > We tried to find a sensible middle ground between too fast removal and > keeping unmaintained and abandoned upstream software in our ports tree > forever. > > When can or should ports be deprecated or removed? > > This policy should give some guidance on when ports can or should be > removed. In general ports should not be removed without reason but if a > port blocks progress it should be deprecated and subsequently removed. > In general, if a ports blocks progress for some time it will be removed > so that progress can be made. For more details see below. > > > Ports can be removed immediately if one of the following conditions is me= t: > > - Upstream distfile is no longer available from the original > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not > count as "available") > I have no objection with removing a port if upstream all died and nobody cared, but removing them "immediately" seems to be too harsh and not friendly for smaller software vendors. For example, bzip2 got their domain name stolen, but the project didn't really die and continued at sourceware.org. Please give the maintainer some time (e.g. by marking the port as DEPRECATED with a timeout time, maybe two weeks, maybe a month or even 3 months). > - Upstream WWW is unavailable: deprecate, remove after 3 months > Could you please explain why upstream WWW would warrant a removal? (I think removing the WWW=3D entry if the website is compromised or is no long= er available is perfectly fine, but why remove the port itself?) > - BROKEN for more than 6 months > I think if a port won't build on any of the official FreeBSD.org package cluster, the port is marked BROKEN with a deprecation period of 6 months (personally I think it's too long, 3 months should be the maximum). This should include ports that are IGNORED for all supported platforms and conditionally broken with all supported defaults: they should have correct dependency and are able to build in at least one poudriere environment. > - has known vulnerabilities that weren=E2=80=99t addressed in the ports t= ree for > more than 3 months > I think this is somewhat too vague. Known to whom? Registered at cve.mitre.org? In vuxml? Probably something like: if vuxml thinks the port is vulnerable, then it's marked FORBIDDEN immediately with a 3 month timeout (personally I think 2 weeks would be the maximum) by some automated script, and after the set time of being FORBIDDEN, the port is eligible for immediate removal. > A port can be deprecated and subsequently removed if: > > - Upstream declared the version EOL or officially stopped development. > DEPRECATED should be set as soon as the planned removal date is know. > (It is up to the maintainer if they want to remove the port immediately > after the EOL date or if they want keep the port for some time with > backported patches. Option two is *not* possible without backporting > patches, see vulnerable ports) The general suggestion is that EOL > versions should not stay in the ports tree for more than 3 months > without justification. > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set > to DEPRECATED after 3 months and can be removed after 6 > > > Reasons that do not warrant removal of a port: > > - Software hasn=E2=80=99t seen a release in a long time > - Upstream looks inactive for a long time > IMHO, a lot of "friction" comes from lack of communication and not port getting removed themselves. For example, one of my port gets marked as DEPRECATED because a dependency was deprecated and scheduled for removal after 1 month, without any email telling me so (the port doesn't have a lot of releases and there isn't any release during that "parole" month), and it gets removed after that. So in order to know there is an ongoing deprecation of the port, I as a port maintainer would have to either watch the directory for any changes, or read all ports-git commit messages or at least a filtered version of it, and that's burdensome and inefficient use of developer time at best. What I would love to see happen is that, when a port gets marked as DEPRECATED, there is an automated system that sends me notification with something like: ACTION REQUESTED: X new ports you maintain is marked as DEPRECATED or, if it's just one port: ACTION REQUESTED: category/port is marked as DEPRECATED and will be removed on 1 month =3D=3D=3D=3D Hello, This is a friendly notification from FreeBSD port deprecation bot. In the latest scan the following ports you maintain are marked as DEPRECATED: Port name | Removal date category/port | 2024-03-30 ... and that email gets sent every 7 days until the port is removed or the issue is fixed. Or a bug is created and assigned to the maintainer, etc. Cheers, --000000000000c45a1f06128a3c1b Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable <div dir=3D"ltr"><div dir=3D"ltr"><div class=3D"gmail_default" style=3D"fon= t-family:monospace,monospace"><br></div></div><br><div class=3D"gmail_quote= "><div dir=3D"ltr" class=3D"gmail_attr">On Wed, Feb 28, 2024 at 11:22=E2=80= =AFAM Florian Smeets <<a href=3D"mailto:flo@freebsd.org">flo@freebsd.org= </a>> wrote:<br></div><blockquote class=3D"gmail_quote" style=3D"margin:= 0px 0px 0px 0.8ex;border-left:1px solid rgb(204,204,204);padding-left:1ex">= Dear ports community,<br> <br> as the removal of ports is a recurring source of friction and dispute we <b= r> would like to add a ports removal and deprecation policy to the porters <br= > handbook.<br> <br> We tried to find a sensible middle ground between too fast removal and <br> keeping unmaintained and abandoned upstream software in our ports tree <br> forever.<br> <br> When can or should ports be deprecated or removed?<br> <br> This policy should give some guidance on when ports can or should be <br> removed. In general ports should not be removed without reason but if a <br= > port blocks progress it should be deprecated and subsequently removed. <br> In general, if a ports blocks progress for some time it will be removed <br= > so that progress can be made. For more details see below.<br> <br> <br> Ports can be removed immediately if one of the following conditions is met:= <br> <br> - Upstream distfile is no longer available from the original <br> source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do not <br= > count as "available")<br></blockquote><div><br></div><div><div cl= ass=3D"gmail_default" style=3D"font-family:monospace,monospace">I have no o= bjection with removing a port if upstream all died and nobody cared, but re= moving them "immediately" seems to be too harsh and not friendly = for smaller software vendors.=C2=A0 For example, bzip2 got their domain nam= e stolen, but the project didn't really die and continued at <a href=3D= "http://sourceware.org">sourceware.org</a>.=C2=A0 Please give the maintaine= r some time (e.g. by marking the port as DEPRECATED with a timeout time, ma= ybe two weeks, maybe a month or even 3 months).</div></div><div>=C2=A0</div= ><blockquote class=3D"gmail_quote" style=3D"margin:0px 0px 0px 0.8ex;border= -left:1px solid rgb(204,204,204);padding-left:1ex"> - Upstream WWW is unavailable: deprecate, remove after 3 months<br></blockq= uote><div><br></div><div><div class=3D"gmail_default" style=3D"font-family:= monospace,monospace">Could you please explain why upstream WWW would warran= t a removal?=C2=A0 (I think removing the WWW=3D entry if the website is com= promised or is no longer available is perfectly fine, but why remove the po= rt itself?)</div></div><div>=C2=A0</div><blockquote class=3D"gmail_quote" s= tyle=3D"margin:0px 0px 0px 0.8ex;border-left:1px solid rgb(204,204,204);pad= ding-left:1ex"> - BROKEN for more than 6 months<br></blockquote><div><br></div><div><div cl= ass=3D"gmail_default" style=3D"font-family:monospace,monospace">I think if = a port won't build on any of the official FreeBSD.org package=C2=A0clus= ter, the port is marked BROKEN with a deprecation period of 6 months (perso= nally I think it's too long, 3 months should be the maximum).</div></di= v><div class=3D"gmail_default" style=3D"font-family:monospace,monospace"><b= r></div><div class=3D"gmail_default" style=3D"font-family:monospace,monospa= ce">This should include ports that are IGNORED for all supported platforms = and conditionally broken with all supported defaults: they should have corr= ect dependency and are able to build in at least one poudriere environment.= </div><div>=C2=A0</div><blockquote class=3D"gmail_quote" style=3D"margin:0p= x 0px 0px 0.8ex;border-left:1px solid rgb(204,204,204);padding-left:1ex"> - has known vulnerabilities that weren=E2=80=99t addressed in the ports tre= e for <br> more than 3 months<br></blockquote><div><br></div><div><div class=3D"gmail_= default" style=3D"font-family:monospace,monospace">I think this is somewhat= too vague.=C2=A0 Known to whom?=C2=A0 Registered=C2=A0at <a href=3D"http:/= /cve.mitre.org">cve.mitre.org</a>?=C2=A0 In vuxml?</div><div class=3D"gmail= _default" style=3D"font-family:monospace,monospace"><br></div><div class=3D= "gmail_default" style=3D"font-family:monospace,monospace">Probably somethin= g like: if vuxml thinks the port is vulnerable, then it's marked FORBID= DEN immediately with a 3 month timeout (personally I think 2 weeks would be= the maximum) by some automated script, and after the set time of being FOR= BIDDEN, the port is eligible for immediate removal.</div></div><div>=C2=A0<= /div><blockquote class=3D"gmail_quote" style=3D"margin:0px 0px 0px 0.8ex;bo= rder-left:1px solid rgb(204,204,204);padding-left:1ex">A port can be deprec= ated and subsequently removed if:<br> <br> - Upstream declared the version EOL or officially stopped development. <br> DEPRECATED should be set as soon as the planned removal date is know. <br> (It is up to the maintainer if they want to remove the port immediately <br= > after the EOL date or if they want keep the port for some time with <br> backported patches. Option two is *not* possible without backporting <br> patches, see vulnerable ports) The general suggestion is that EOL <br> versions should not stay in the ports tree for more than 3 months <br> without justification.<br> - The port does not adapt to infrastructure changes (i.e. USE_STAGE, <br> MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set <br= > to DEPRECATED after 3 months and can be removed after 6<br> <br> <br> Reasons that do not warrant removal of a port:<br> <br> - Software hasn=E2=80=99t seen a release in a long time<br> - Upstream looks inactive for a long time<br></blockquote><div><br></div><d= iv class=3D"gmail_default" style=3D"font-family:monospace,monospace">IMHO, = a lot of "friction" comes from lack of communication and not port= getting removed themselves.</div><div class=3D"gmail_default" style=3D"fon= t-family:monospace,monospace"><br></div><div class=3D"gmail_default" style= =3D"font-family:monospace,monospace">For example, one of my port gets marke= d as DEPRECATED because a dependency was deprecated and scheduled for remov= al after 1 month, without any email telling me so (the port doesn't hav= e a lot of releases and there isn't any release during that "parol= e" month), and it gets removed after that.=C2=A0 So in order to know t= here is an ongoing deprecation of the port, I as a port maintainer would ha= ve to either watch the directory for any changes, or read all ports-git com= mit messages or at least a filtered version of it, and that's burdensom= e and inefficient use of developer time at best.</div><div class=3D"gmail_d= efault" style=3D"font-family:monospace,monospace"><br></div><div class=3D"g= mail_default" style=3D"font-family:monospace,monospace">What I would love t= o see happen is that, when a port gets marked as DEPRECATED, there is an au= tomated system that sends me notification with something like:</div><div cl= ass=3D"gmail_default" style=3D"font-family:monospace,monospace"><br></div><= div class=3D"gmail_default" style=3D"font-family:monospace,monospace">ACTIO= N REQUESTED: X new ports you maintain is marked as DEPRECATED</div><div cla= ss=3D"gmail_default" style=3D"font-family:monospace,monospace"><br></div><d= iv class=3D"gmail_default" style=3D"font-family:monospace,monospace">or, if= it's just one port:</div><div class=3D"gmail_default" style=3D"font-fa= mily:monospace,monospace"><br></div><div class=3D"gmail_default" style=3D"f= ont-family:monospace,monospace">ACTION REQUESTED: category/port is marked a= s DEPRECATED and will be removed on 1 month</div><div class=3D"gmail_defaul= t" style=3D"font-family:monospace,monospace">=3D=3D=3D=3D</div><div class= =3D"gmail_default" style=3D"font-family:monospace,monospace">Hello,</div><d= iv class=3D"gmail_default" style=3D"font-family:monospace,monospace"><br></= div><div class=3D"gmail_default" style=3D"font-family:monospace,monospace">= This is a friendly notification from FreeBSD port deprecation bot.=C2=A0 In= the latest scan the following ports you maintain are marked as DEPRECATED:= </div><div class=3D"gmail_default" style=3D"font-family:monospace,monospace= "><br></div><div class=3D"gmail_default" style=3D"font-family:monospace,mon= ospace">Port name=C2=A0 =C2=A0 =C2=A0| Removal date</div><div class=3D"gmai= l_default" style=3D"font-family:monospace,monospace">category/port | 2024-0= 3-30</div><div class=3D"gmail_default" style=3D"font-family:monospace,monos= pace">...</div><div class=3D"gmail_default" style=3D"font-family:monospace,= monospace"><br></div><div class=3D"gmail_default" style=3D"font-family:mono= space,monospace">and that email gets sent every 7 days until the port is re= moved or the issue is fixed.=C2=A0 Or a bug is created and assigned to the = maintainer, etc.</div><div class=3D"gmail_default" style=3D"font-family:mon= ospace,monospace"><br></div><div class=3D"gmail_default" style=3D"font-fami= ly:monospace,monospace">Cheers,</div></div></div> --000000000000c45a1f06128a3c1b-- From nobody Thu Feb 29 20:16:31 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tm2Yb4ws7z5CqjP for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 20:16:35 +0000 (UTC) (envelope-from henrichhartzer@tuta.io) Received: from w1.tutanota.de (w1.tutanota.de [81.3.6.162]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mail.tutanota.de", Issuer "Sectigo RSA Domain Validation Secure Server CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tm2YZ6Fyjz4fCP for <ports@freebsd.org>; Thu, 29 Feb 2024 20:16:34 +0000 (UTC) (envelope-from henrichhartzer@tuta.io) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=tuta.io header.s=s1 header.b="bnLQH64/"; dmarc=pass (policy=quarantine) header.from=tuta.io; spf=pass (mx1.freebsd.org: domain of henrichhartzer@tuta.io designates 81.3.6.162 as permitted sender) smtp.mailfrom=henrichhartzer@tuta.io Received: from tutadb.w10.tutanota.de (unknown [192.168.1.10]) by w1.tutanota.de (Postfix) with ESMTP id D7CF7FBF8A3 for <ports@freebsd.org>; Thu, 29 Feb 2024 20:16:31 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; t=1709237791; s=s1; d=tuta.io; h=From:From:To:To:Subject:Subject:Content-Description:Content-ID:Content-Type:Content-Type:Content-Transfer-Encoding:Content-Transfer-Encoding:Cc:Date:Date:In-Reply-To:MIME-Version:MIME-Version:Message-ID:Message-ID:Reply-To:References:Sender; bh=iWZwX7GoMJi7ltnkNJg0GE7I4yuG1235fG0+TUcdfQc=; b=bnLQH64/ae17M9CN3bmKVIQq3jH1hFZwwoIo1pDZ2yNn646UwDsyX9lrM4lUVIFU NmBfmGcGnf5jpwhuFSe9DkAVgLj5zeHs6m9YvFYqrSpMTNaX8YU8c7HygaKTBsDbVbv 3rM5caPOIzBRWFEBLjGVOCeY7Is5LNW0XEZPmuZyAY+OFd/tjh+JcG0FVDPVS+DXwS4 ETZPiXMz7jQEHjmDsmv6NbkU9+OjosmWMe37qf1R6mf9zRY2Jk2CdVijfROKun5hCMG hPQ3FMvUkhh1kQNprdzVgHjTDUX0nWInTHnNjVgEEmgVKGTNOARtLHdzcpcd4b7q5Ge 1QsuiFnlKw== Date: Thu, 29 Feb 2024 21:16:31 +0100 (CET) From: henrichhartzer@tuta.io To: Ports <ports@freebsd.org> Message-ID: <NrqVibQ--3-9@tuta.io> Subject: Merge access review + QT6 update best practices List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.10 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[tuta.io,quarantine]; R_SPF_ALLOW(-0.20)[+ip4:81.3.6.160/28]; R_DKIM_ALLOW(-0.20)[tuta.io:s=s1]; RWL_MAILSPIKE_VERYGOOD(-0.20)[81.3.6.162:from]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; FROM_NO_DN(0.00)[]; ASN(0.00)[asn:24679, ipnet:81.3.0.0/18, country:DE]; MIME_TRACE(0.00)[0:+]; RCVD_COUNT_ONE(0.00)[1]; MISSING_XM_UA(0.00)[]; ARC_NA(0.00)[]; TO_DN_ALL(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MLMMJ_DEST(0.00)[ports@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_TLS_LAST(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; DKIM_TRACE(0.00)[tuta.io:+] X-Rspamd-Queue-Id: 4Tm2YZ6Fyjz4fCP Hi everyone, I have two requests for help. First one is that I updated one of my ports, but I don't have merge access. Would appreciate it if someone can review. Ideally would merge to main + backport to quarterly. If there's something missing in the report that should be there, please let me know! https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=277386 Second is for net-im/telegram-desktop that has no maintainer. It was working great for me until a QT6 update (6.6.1->6.6.2). Surprisingly, even with that minor of a bump, Telegram Desktop quit launching. I'm not sure if that's normal for QT6 or not. I can easily contribute a patch to update it, forcing a new package version release, but it seems like there might be a better practice to link this to QT6 updates where it's automatically rebuilt when they are updated. https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=277366 One simple option might be to backport the latest version in main to quarterly, which would force a rebuild, presumably with the latest QT6. I still don't know if that's ideal, however. Thank you for your thoughts and insights. Truly, -Henrich From nobody Thu Feb 29 20:36:00 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tm30F61KKz5Crk3 for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 20:36:13 +0000 (UTC) (envelope-from SRS0=1xVm=KG=quip.cz=000.fbsd@elsa.codelab.cz) Received: from elsa.codelab.cz (elsa.codelab.cz [94.124.105.4]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tm30F3d0mz4jnD; Thu, 29 Feb 2024 20:36:13 +0000 (UTC) (envelope-from SRS0=1xVm=KG=quip.cz=000.fbsd@elsa.codelab.cz) Authentication-Results: mx1.freebsd.org; none Received: from elsa.codelab.cz (localhost [127.0.0.1]) by elsa.codelab.cz (Postfix) with ESMTP id DB8CFD7890; Thu, 29 Feb 2024 21:36:03 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1709238963; bh=meUZc9x935gLDDIGGbXLTtMh964lj7vQY2npKKPlE3c=; h=Date:Subject:To:Cc:References:From:In-Reply-To; b=JP5pka4P7e6h/xrRDB1TkjKeTxVxSkUy0q5DLhaE5gLu+0zGgLJHYBeNozl2CHs9q O9y9uC4wMm6tsskanHPmRWaKn8z+O1+1YQEwO14z2JSS+lBK1PpNtijJRXZZS3FGMy p+syoUgILVkmBqC19HohKqI06LWKFpqu/zzEVTaQ= Received: from [192.168.145.49] (ip-89-177-27-225.bb.vodafone.cz [89.177.27.225]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by elsa.codelab.cz (Postfix) with ESMTPSA id F184FD788F; Thu, 29 Feb 2024 21:36:00 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1709238961; bh=meUZc9x935gLDDIGGbXLTtMh964lj7vQY2npKKPlE3c=; h=Date:Subject:To:Cc:References:From:In-Reply-To; b=zpBuxOzsQnytrHZOkx5vbw2FLg4BGEoYGMJ+ZjCCPv1KdZefoCZZLn/JmYeIRI7Xj gKqQnUaUBVl5uJuEChVV9BX4GmQ2DydTyQCjHx+Lkx5U29wKkFFEY6qfuh/PNRiPV1 wO3plsUt31h83eQLoxRJnR+RE6dhIKVJHH4NEqIQ= Message-ID: <d8f99e62-4a2a-4373-a2b4-aa25844a5ea5@quip.cz> Date: Thu, 29 Feb 2024 21:36:00 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Proposed ports deprecation and removal policy Content-Language: cs-Cestina To: Xin LI <delphij@gmail.com>, Florian Smeets <flo@freebsd.org> Cc: ports@freebsd.org References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <CAGMYy3s8zqdvuNeiyt673uzhoqcsBZJMdUSY4tLxH+0AQftWuw@mail.gmail.com> From: Miroslav Lachman <000.fbsd@quip.cz> In-Reply-To: <CAGMYy3s8zqdvuNeiyt673uzhoqcsBZJMdUSY4tLxH+0AQftWuw@mail.gmail.com> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:42000, ipnet:94.124.104.0/21, country:CZ] X-Rspamd-Queue-Id: 4Tm30F3d0mz4jnD On 29/02/2024 20:26, Xin LI wrote: [...] > Could you please explain why upstream WWW would warrant a removal? (I > think removing the WWW= entry if the website is compromised or is no > longer available is perfectly fine, but why remove the port itself?) > > - BROKEN for more than 6 months > > > I think if a port won't build on any of the official FreeBSD.org > package cluster, the port is marked BROKEN with a deprecation period of > 6 months (personally I think it's too long, 3 months should be the maximum). > > This should include ports that are IGNORED for all supported platforms > and conditionally broken with all supported defaults: they should have > correct dependency and are able to build in at least one poudriere > environment. > > - has known vulnerabilities that weren’t addressed in the ports tree > for > more than 3 months > > > I think this is somewhat too vague. Known to whom? Registered at > cve.mitre.org <http://cve.mitre.org>? In vuxml? > > Probably something like: if vuxml thinks the port is vulnerable, then > it's marked FORBIDDEN immediately with a 3 month timeout (personally I > think 2 weeks would be the maximum) by some automated script, and after > the set time of being FORBIDDEN, the port is eligible for immediate removal. Even ports of large projects, or projects on which hundreds or thousands of other ports depend, have had an unresolved security issue for much longer. For example, Python had an unpatched bug for over a month. Removing such a port after 2 weeks does more harm than good. Each user can check the pkg audit and decide for themselves if the security issue affects their environment and whether to install/retain/uninstall such a package. Removing ports for whatever reason after 2 weeks is useless. In general, I would like to see removal time frames taken not strictly from the date of discovering the technical or security problem, but with respect to quarterly branches. A lot of users use quarterly - for stability - and then are unpleasantly surprised that a port has been removed without seeing any warning. And if somebody finds a way to revert it, it will probably get reverted after the next quarter, again more harm than good. > A port can be deprecated and subsequently removed if: > > - Upstream declared the version EOL or officially stopped development. > DEPRECATED should be set as soon as the planned removal date is know. > (It is up to the maintainer if they want to remove the port immediately > after the EOL date or if they want keep the port for some time with > backported patches. Option two is *not* possible without backporting > patches, see vulnerable ports) The general suggestion is that EOL > versions should not stay in the ports tree for more than 3 months > without justification. > - The port does not adapt to infrastructure changes (i.e. USE_STAGE, > MANPREFIX, compiler updates, etc.) within 6 months. Ports should be set > to DEPRECATED after 3 months and can be removed after 6 > > > Reasons that do not warrant removal of a port: > > - Software hasn’t seen a release in a long time > - Upstream looks inactive for a long time > > > IMHO, a lot of "friction" comes from lack of communication and not port > getting removed themselves. +1 > For example, one of my port gets marked as DEPRECATED because a > dependency was deprecated and scheduled for removal after 1 month, > without any email telling me so (the port doesn't have a lot of releases > and there isn't any release during that "parole" month), and it gets > removed after that. So in order to know there is an ongoing deprecation > of the port, I as a port maintainer would have to either watch the > directory for any changes, or read all ports-git commit messages or at > least a filtered version of it, and that's burdensome and inefficient > use of developer time at best. > > What I would love to see happen is that, when a port gets marked as > DEPRECATED, there is an automated system that sends me notification with > something like: > > ACTION REQUESTED: X new ports you maintain is marked as DEPRECATED > > or, if it's just one port: > > ACTION REQUESTED: category/port is marked as DEPRECATED and will be > removed on 1 month > ==== > Hello, > > This is a friendly notification from FreeBSD port deprecation bot. In > the latest scan the following ports you maintain are marked as DEPRECATED: > > Port name   | Removal date > category/port | 2024-03-30 > ... > > and that email gets sent every 7 days until the port is removed or the > issue is fixed. Or a bug is created and assigned to the maintainer, etc. I also remember one case that annoyed me a lot - unequal treatment of ports that should have been removed due to deprecated dependencies, but some were removed "immediately" and others worked for about another year. Yes, these were Python 2.7 dependent ports, where someone was very actively removing ports that required Python 2.7 as a build dependency. Chromium wasn't removed, but Iridium was, yet it was the same build process, same dependencies (but the Iridium takes care about privacy), and throwing out hundreds of ports prematurely when Python 2.7 had to stay in the ports tree anyway was completely unnecessary and unhelpful. From my point of view, it was just a political decision and not a technical one, that shouldn't have been there. Kind regards Miroslav Lachman From nobody Thu Feb 29 22:17:37 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tm5FL6ym1z5D14l for <freebsd-ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 22:17:42 +0000 (UTC) (envelope-from agh@riseup.net) Received: from mx0.riseup.net (mx0.riseup.net [198.252.153.6]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mx0.riseup.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tm5FK2C3sz4v4b; Thu, 29 Feb 2024 22:17:41 +0000 (UTC) (envelope-from agh@riseup.net) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=riseup.net header.s=squak header.b=Uq3XOsbh; dmarc=pass (policy=none) header.from=riseup.net; spf=pass (mx1.freebsd.org: domain of agh@riseup.net designates 198.252.153.6 as permitted sender) smtp.mailfrom=agh@riseup.net Received: from fews01-sea.riseup.net (fews01-sea-pn.riseup.net [10.0.1.109]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mx0.riseup.net (Postfix) with ESMTPS id 4Tm5FG0T1Rz9tw6; Thu, 29 Feb 2024 22:17:38 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=riseup.net; s=squak; t=1709245058; bh=k8629S9eYnOdcab82dU++J+RhWg4u/2sUkUo+PTqAvM=; h=Date:From:To:Cc:Subject:In-Reply-To:References:From; b=Uq3XOsbh4ilNT2fHdSrOK41a+EErkrkoVAf21MTGualTLTESNUdQtJ09Yc/o+2zuj vS18zjzDDzegsP6gHF/SnrGMeypOCEPAoaqrbirZhrIJW5mH+/uPrnj6JDOOFOcU+g b6kxeCNJvmXot4YWhRzcO5d5/7Ckz6bCxMpkc1Ok= X-Riseup-User-ID: 796E6083A33CE09735A44A4FED92DD7EFECCE300B8700023D64DAFBF713A05A0 Received: from [127.0.0.1] (localhost [127.0.0.1]) by fews01-sea.riseup.net (Postfix) with ESMTPSA id 4Tm5FF63mbzJrYW; Thu, 29 Feb 2024 22:17:37 +0000 (UTC) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Thu, 29 Feb 2024 22:17:37 +0000 From: Alastair Hogge <agh@riseup.net> To: Gleb Popov <arrowd@freebsd.org> Cc: freebsd-ports@freebsd.org Subject: Re: emulators/mame: Increasing option granularity woes In-Reply-To: <CALH631=TsOzONNmh3zFwR-SeqBzB9yHCc=aHTYJGBgi7U1Pukg@mail.gmail.com> References: <0f7f4f5675d1e75e504ad67d963e8874@riseup.net> <CALH631=4UCndd8NZo4Zzxop8MBCBLHTU_i1RUezxTBH0P5VaNQ@mail.gmail.com> <137c5ccbdaa6ca8e5913771d0ed737d7@riseup.net> <CALH631=TsOzONNmh3zFwR-SeqBzB9yHCc=aHTYJGBgi7U1Pukg@mail.gmail.com> Message-ID: <0d08240fcec39f7e34ddf55fa89eb48e@riseup.net> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.10 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[riseup.net:dkim]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[riseup.net,none]; R_SPF_ALLOW(-0.20)[+a:mx0.riseup.net]; R_DKIM_ALLOW(-0.20)[riseup.net:s=squak]; RCVD_IN_DNSWL_LOW(-0.10)[198.252.153.6:from]; MIME_GOOD(-0.10)[text/plain]; ARC_NA(0.00)[]; RCVD_TLS_ALL(0.00)[]; MISSING_XM_UA(0.00)[]; ASN(0.00)[asn:16652, ipnet:198.252.153.0/24, country:US]; TO_DN_SOME(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; DKIM_TRACE(0.00)[riseup.net:+] X-Rspamd-Queue-Id: 4Tm5FK2C3sz4v4b On 2024-02-27 14:24, Gleb Popov wrote: > On Tue, Feb 27, 2024 at 5:43 AM Alastair Hogge <agh@riseup.net> wrote: >> >> however, I do not know how that translates to Makefile >> targets, like do-install-NON_USER_FACING_OPT-on. Currently the Makefile >> target is of the ".if somecond FOO= .else BAR= .endif" form. > > I'm afraid you'd still have to write > > post-install: > .if ${PORT_OPTIONS:MFOO} || ${PORT_OPTIONS:MBAR} > ... > .endif > > for optionalizing targets. Thanks. From nobody Thu Feb 29 22:53:59 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tm63Y1srGz5D3kX for <ports@mlmmj.nyi.freebsd.org>; Thu, 29 Feb 2024 22:54:17 +0000 (UTC) (envelope-from junchoon@dec.sakura.ne.jp) Received: from www121.sakura.ne.jp (www121.sakura.ne.jp [153.125.133.21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tm63X4TWdz3xvQ; Thu, 29 Feb 2024 22:54:16 +0000 (UTC) (envelope-from junchoon@dec.sakura.ne.jp) Authentication-Results: mx1.freebsd.org; none Received: from kalamity.joker.local (123-1-21-232.area1b.commufa.jp [123.1.21.232]) (authenticated bits=0) by www121.sakura.ne.jp (8.17.1/8.17.1/[SAKURA-WEB]/20201212) with ESMTPA id 41TMrxue007793; Fri, 1 Mar 2024 07:53:59 +0900 (JST) (envelope-from junchoon@dec.sakura.ne.jp) Date: Fri, 1 Mar 2024 07:53:59 +0900 From: Tomoaki AOKI <junchoon@dec.sakura.ne.jp> To: Cy Schubert <Cy.Schubert@cschubert.com> Cc: Dag-Erling =?UTF-8?B?U23DuHJncmF2?= <des@FreeBSD.org>, Florian Smeets <flo@FreeBSD.org>, ports@freebsd.org Subject: Re: Proposed ports deprecation and removal policy Message-Id: <20240301075359.b4906ad16d876cbdd89856bd@dec.sakura.ne.jp> In-Reply-To: <20240229174339.045063A4@slippy.cwsent.com> References: <435edf7c-a956-4317-b327-3372de70dbef@FreeBSD.org> <864jdrzcov.fsf@ltc.des.dev> <20240229174339.045063A4@slippy.cwsent.com> Organization: Junchoon corps X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd14.0) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:7684, ipnet:153.125.128.0/18, country:JP] X-Rspamd-Queue-Id: 4Tm63X4TWdz3xvQ On Thu, 29 Feb 2024 09:43:38 -0800 Cy Schubert <Cy.Schubert@cschubert.com> wrote: > In message <864jdrzcov.fsf@ltc.des.dev>, =?utf-8?Q?Dag-Erling_Sm=C3=B8rgrav? > = w > rites: > > Florian Smeets <flo@FreeBSD.org> writes: > > > Ports can be removed immediately if one of the following conditions is me= > > t: > > > > > > - Upstream distfile is no longer available from the original > > > source/mirror (Our and other distcaches e.g. Debian, Gentoo, etc do > > > not count as "available") > > > > Strong disagree, give the maintainer a chance to find an alternate > > mirror or self-host. > > +1 +1 about this point, too. Silly service providers changes their brand and domain, WITH THEIR USERS FORCIBLY INCLUDING. This immediately causes original upstream URI unavailable, even though actual project DOES NOT AT ALL CHANGES. And more importantly, some users dislikes such a domain name policy and switch service provider. Of course, this causes original upstream URI dissappear. > > > > > > - Upstream WWW is unavailable: deprecate, remove after 3 months > > > > That's the opposite of immediate removal > > > > > - BROKEN for more than 6 months > > > > Agree but that's hardly immediate > > > > > - has known vulnerabilities that weren=E2=80=99t addressed in the ports t= > > ree > > > for more than 3 months > > > > Agree but that's hardly immediate > > > > DES > > --=20 > > Dag-Erling Sm=C3=B8rgrav - des@FreeBSD.org > > > > > -- > Cheers, > Cy Schubert <Cy.Schubert@cschubert.com> > FreeBSD UNIX: <cy@FreeBSD.org> Web: https://FreeBSD.org > NTP: <cy@nwtime.org> Web: https://nwtime.org > > e^(i*pi)+1=0 -- Tomoaki AOKI <junchoon@dec.sakura.ne.jp> From nobody Fri Mar 1 04:09:35 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TmF3N3Byxz5Bn7b for <ports@mlmmj.nyi.freebsd.org>; Fri, 1 Mar 2024 04:09:36 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TmF3M5T7Kz4TF4 for <ports@freebsd.org>; Fri, 1 Mar 2024 04:09:35 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709266175; a=rsa-sha256; cv=none; b=xfYDUTG9CLjKjCZtFPAmKLIj/8y6mNzYmmfLe3P2qvv2x2xUs3OS16ZqevLKgV4amFIkp2 eNbzoZTm47clIWeqDWoZ2ajZmRfEjyF3VpH/HoS+pxoy2epdzH5JTKg+o7VNEiJh4M/cu/ A2XGMnubDTQ4J+1wYkJYnDZD3TOINJACMelkPfF7zMJPiR+fusL3i0qADNtjXDm2AAsg0m 0BEGvv46jujYN5wAyo3alhuXvbeUuZxk4bOgKYmjxNRPe3RqllOH2BvmfitKT/5wamcj1v NGLZgYdwGCv+Xk45wNF8yS3z28QqkTFzt4JYg4BPp7sAIJ5cA3Ctv4YtMciYVw== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709266175; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=KiKP3t9L2eVEXCVu+9hsQHqSk7oa6atMIKP3Waipfcg=; b=fWq9xsRVll4/xW8yyoI0VlLNyS7wBjQymKUZoPvG9CSEMzzv9/pQWYolkQU0JyJHYRf3k+ ei9QxzXlfGRsa5DCIyjcxwe+/s1okTBjNlfC6dg7do1hqUuOSc1J1ulGXpiW2xbkanxhPL iXMgH798wzqJS4pJSQX55rrKFoFWriCe021Yil1Ff24QCchUrzSzs0XdJiozUk1iXDxUUZ 4Tge97d4WJJ753X+szNRvp23qx69tOoRsQibxqEMKDkYlBb/nFb6xZUUf6hZ44i6YV3R+2 wMMdNzRZnOM03CkzNTeiGhWZk0K4bek4WcSmGV0Y44tpzzp+QWOH04oXOi7Z3w== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4TmF3M541cz198g for <ports@freebsd.org>; Fri, 1 Mar 2024 04:09:35 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 42149ZSP048909 for <ports@freebsd.org>; Fri, 1 Mar 2024 04:09:35 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 42149ZuM048908; Fri, 1 Mar 2024 04:09:35 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202403010409.42149ZuM048908@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Fri, 1 Mar 2024 04:09:35 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ cad/ifcopenshell | 0.6.0 | blenderbim-240301 ------------------------------------------------+-----------------+------------ databases/clickhouse | 22.1.3.7 | v24.2.1.2248-stable ------------------------------------------------+-----------------+------------ devel/tinygo | 0.19.0 | v0.31.1 ------------------------------------------------+-----------------+------------ math/wxmaxima | 23.12.0 | version-24.02.2 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Fri Mar 1 09:19:21 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TmMwz72pkz5CGXC for <freebsd-ports@mlmmj.nyi.freebsd.org>; Fri, 1 Mar 2024 09:19:31 +0000 (UTC) (envelope-from jonc@chen.org.nz) Received: from egress.chen.org.nz (egress.chen.org.nz [170.75.172.82]) by mx1.freebsd.org (Postfix) with ESMTP id 4TmMwz2DVhz4w5l; Fri, 1 Mar 2024 09:19:31 +0000 (UTC) (envelope-from jonc@chen.org.nz) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of jonc@chen.org.nz designates 170.75.172.82 as permitted sender) smtp.mailfrom=jonc@chen.org.nz Received: from mail.chen.org.nz (unknown [210.54.37.164]) by egress.chen.org.nz (Postfix) with ESMTP id 0ADB1111E19; Fri, 1 Mar 2024 22:19:23 +1300 (NZDT) Received: from mail.chen.org.nz (localhost [127.0.0.1]) by filter.inside.chen.org.nz (Postfix) with ESMTP id 04C8661CC2; Fri, 1 Mar 2024 22:19:22 +1300 (NZDT) X-Spam-Checker-Version: SpamAssassin 4.0.0 (2022-12-14) on ametrine.inside.chen.org.nz Received: from [192.168.1.10] (jade.inside.chen.org.nz [192.168.1.10]) by mail.chen.org.nz (Postfix) with ESMTPS id EB6B361D8D; Fri, 1 Mar 2024 22:19:21 +1300 (NZDT) Message-ID: <b2dbf69f-b2cd-46de-90cf-9f319108656b@chen.org.nz> Date: Fri, 1 Mar 2024 22:19:21 +1300 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Content-Language: en-US To: Mikael Urankar <mikael@FreeBSD.org> Cc: freebsd-ports@freebsd.org From: Jonathan Chen <jonc@chen.org.nz> Subject: net-im/signal-desktop fetch error. Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.12 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.93)[-0.934]; R_SPF_ALLOW(-0.20)[+a:egress.chen.org.nz]; RCVD_NO_TLS_LAST(0.10)[]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; ARC_NA(0.00)[]; ASN(0.00)[asn:174, ipnet:170.75.160.0/20, country:US]; TO_DN_SOME(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; R_DKIM_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; DMARC_NA(0.00)[chen.org.nz]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; RCVD_COUNT_THREE(0.00)[3]; FROM_HAS_DN(0.00)[] X-Rspamd-Queue-Id: 4TmMwz2DVhz4w5l Hi, net-im/signal-desktop currently reports the following error with "make fetch": => signalapp-Signal-Desktop-6.48.1_GH0.tar.gz is not in /xports/net-im/signal-desktop/distinfo. => Either /xports/net-im/signal-desktop/distinfo is out of date, or => signalapp-Signal-Desktop-6.48.1_GH0.tar.gz is spelled incorrectly. *** Error code 1 The distinfo currently has: SHA256 (signalapp-Signal-Desktop-v6.48.1_GH0.tar.gz) = fb3e59e853b16a99dee5db556 b45dd19694b9c7f5e2505dcb546957c7c9bd26a SIZE (signalapp-Signal-Desktop-v6.48.1_GH0.tar.gz) = 43063584 This differs from what the port wants to fetch; ie: there's a "v" before the 6.48 in the distinfo. Cheers. -- Jonathan Chen <jonc@chen.org.nz> From nobody Fri Mar 1 18:25:02 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tmc413QM6z5CqTx for <ports@mlmmj.nyi.freebsd.org>; Fri, 1 Mar 2024 18:26:25 +0000 (UTC) (envelope-from 6yearold@gmail.com) Received: from mail-ua1-f47.google.com (mail-ua1-f47.google.com [209.85.222.47]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tmc405df5z4cd2 for <ports@freebsd.org>; Fri, 1 Mar 2024 18:26:24 +0000 (UTC) (envelope-from 6yearold@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="SPF not aligned (relaxed), No valid DKIM" header.from=freebsd.org (policy=none); spf=pass (mx1.freebsd.org: domain of 6yearold@gmail.com designates 209.85.222.47 as permitted sender) smtp.mailfrom=6yearold@gmail.com Received: by mail-ua1-f47.google.com with SMTP id a1e0cc1a2514c-7d6275d7d4dso1059137241.2 for <ports@freebsd.org>; Fri, 01 Mar 2024 10:26:24 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709317583; x=1709922383; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=r0o5pgiGc/wcrIoKMy4DeGPkAbvMozuCDmQsLu6bTCw=; b=NbDbbnbD/Hxsv1wlYXNhKpbPR1m5RXysClkvhk+sZE8aRrgbJvwAvV4BM+RJ/pKiIt FJ7AQJ6hBYY5YbE3aDQnJq/7RSpGxApvPPKyaX6CiAP9bwHpCVRVDutJfu7QCdwDgf2Q DErIy21f2TG49bXhR9OJVD1csfzQZ6qI94tluNNG1s5wmm/2K7hyC6FtFO3S8HFZYqNL qv+PNaFmbnMQog1ugLnKx4bb3vwNUYmb5U4yWP/CtTeT1TIZP+GJRlk+6F8RGockGUuV p7lnCZH/nLF2kno/SKqFmlx4wUAncOBT56cBHPooxTgYHbaFs4Cr12cYetfvxxavWO6h zN/A== X-Gm-Message-State: AOJu0Yz/nufOiUjFX1pevZewmwOSRvKs4XiLMfqhZzSjApwZWySjPtN+ Dav2qXk0GkbWTYrQygY7dBFG0KT4cc2S2vXMnrwQF5R7sE1/hfnrjTISN5/reuk= X-Google-Smtp-Source: AGHT+IFhgFlOeQpPWhM0LVZx3MQqikAiUAZhAk1LqfJfn7b78O9PhRdnErB0VPzRyiafcDIyF1KzUw== X-Received: by 2002:a05:6102:1991:b0:472:5fab:2dab with SMTP id jm17-20020a056102199100b004725fab2dabmr2384814vsb.26.1709317582492; Fri, 01 Mar 2024 10:26:22 -0800 (PST) Received: from mail-vs1-f43.google.com (mail-vs1-f43.google.com. [209.85.217.43]) by smtp.gmail.com with ESMTPSA id g18-20020a05610209d200b0046d30981a16sm693645vsi.33.2024.03.01.10.26.22 for <ports@freebsd.org> (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Fri, 01 Mar 2024 10:26:22 -0800 (PST) Received: by mail-vs1-f43.google.com with SMTP id ada2fe7eead31-47277f4db4bso643703137.0 for <ports@freebsd.org>; Fri, 01 Mar 2024 10:26:22 -0800 (PST) X-Received: by 2002:a05:6102:1613:b0:472:720e:96f2 with SMTP id cu19-20020a056102161300b00472720e96f2mr3141474vsb.7.1709317582090; Fri, 01 Mar 2024 10:26:22 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <CALH631=312+z8-1Gr32gZL_X3QduNCiMEyM3ZOwvqmAh6eRW7A@mail.gmail.com> In-Reply-To: <CALH631=312+z8-1Gr32gZL_X3QduNCiMEyM3ZOwvqmAh6eRW7A@mail.gmail.com> From: Gleb Popov <arrowd@freebsd.org> Date: Fri, 1 Mar 2024 21:25:02 +0300 X-Gmail-Original-Message-ID: <CALH631=JUZW-+cQq5t0f_F3eVxusMHRfhbSLqwfwuBZCoFS2QA@mail.gmail.com> Message-ID: <CALH631=JUZW-+cQq5t0f_F3eVxusMHRfhbSLqwfwuBZCoFS2QA@mail.gmail.com> Subject: Re: Call for help: moving manpages to share/man To: "ports@FreeBSD.org" <ports@freebsd.org> Content-Type: text/plain; charset="UTF-8" X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.89 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.99)[-0.990]; FORGED_SENDER(0.30)[arrowd@freebsd.org,6yearold@gmail.com]; R_SPF_ALLOW(-0.20)[+ip4:209.85.128.0/17:c]; MIME_GOOD(-0.10)[text/plain]; DMARC_POLICY_SOFTFAIL(0.10)[freebsd.org : SPF not aligned (relaxed), No valid DKIM,none]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; RCPT_COUNT_ONE(0.00)[1]; TO_DN_EQ_ADDR_ALL(0.00)[]; MIME_TRACE(0.00)[0:+]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:15169, ipnet:209.85.128.0/17, country:US]; FREEMAIL_ENVFROM(0.00)[gmail.com]; MLMMJ_DEST(0.00)[ports@freebsd.org]; PREVIOUSLY_DELIVERED(0.00)[ports@freebsd.org]; FROM_NEQ_ENVFROM(0.00)[arrowd@freebsd.org,6yearold@gmail.com]; MISSING_XM_UA(0.00)[]; R_DKIM_NA(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[209.85.222.47:from]; TO_DOM_EQ_FROM_DOM(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[209.85.222.47:from,209.85.217.43:received] X-Rspamd-Queue-Id: 4Tmc405df5z4cd2 A small update: we're down to 705 ports failing and 342 skipped according to the latest build run by bofh@ The updated list of failed ports can be obtained from the same URL as before [1]. It is also worth mentioning that portmgr@ will make the hard switch after 2024Q3 gets branched. This will break ports from the list, so please make sure to update them beforehand. [1] https://people.freebsd.org/~bofh/dropzone/manprefix-fail.maintainer.txt From nobody Sat Mar 2 04:07:01 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tmrxx4wvtz5Btxb for <ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 04:07:01 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tmrxx373yz4pYB for <ports@freebsd.org>; Sat, 2 Mar 2024 04:07:01 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709352421; a=rsa-sha256; cv=none; b=Gx5GXIIJWsLycEytnEtKQxiuSlDMFiPgOPyIqMjt6FyrwmegCI1AKOwTqAX2di/1noXP8Z HiKceu9u8cFO+ySnXqXk7evVC71TGio0ZXjHhF83IyZW1OE5rORkmVaKs6ELiRcJYP0fvw FnbU75tSvpmvxeUWD6pXY4OlUQPs82KASfqyKoVMBX1nhc2o6Ms0Me4ppx2wTsswHUkEHB /gxAf1M9OD7Q2VpmIJCrbEs5247vuHQGMQJbpNonsXnowdJUUHr+PksSZR1nGxohJd0ssU 0mTXhCrKCIe0p0YvHenzw8HPBJm7iWEXgdry46Q6vbsjVhwiy4U5/RefH2Tl2w== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709352421; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=dogtqtb8fe5otK9c7NghdvMlHrroVveBAZl9w3werHY=; b=w4J53kFIIf2jg5EcSzDBflvSpWzmxrXzGpNSuAouzJKcRZKjykn1JSl0FvZQKLdawTiS+l PPm+LaUzPfTV/1gqC3J5Us9gUuUO0OdOeKDihJGGjCvpi6ngdNEjNYVteDKS/JDC8gnnjk 0KFUnNGMOXMwH3L4ygauYbScCK5SEWQiOtLqEIIlV85Xhw41/ls1g3o1Zxncfj/xTlkj/+ wTjb19vsbgr7MSRQGWPT0Bg1t8GaY4vLYSyczmdvzgjupL9fuJQRfLByXpNMuHbXrl9h7h YTFQjxtZ1xGW4CV9YePjd2Yy+ZJL3rlV6sxtHGN+N0nKHkPVLdN0sS4vUcg6sQ== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4Tmrxx0zsBzvFv for <ports@freebsd.org>; Sat, 2 Mar 2024 04:07:01 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 422471cB059624 for <ports@freebsd.org>; Sat, 2 Mar 2024 04:07:01 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 422471DC059623; Sat, 2 Mar 2024 04:07:01 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202403020407.422471DC059623@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Sat, 2 Mar 2024 04:07:01 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ emulators/dosbox-x | 2023.10.06 | dosbox-x-v2024.03.01 ------------------------------------------------+-----------------+------------ textproc/redisearch | 2.2.10 | v2.8.12 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Sat Mar 2 07:34:35 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TmxYk3yCXz5CDpr for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 07:34:50 +0000 (UTC) (envelope-from xavier@groumpf.org) Received: from aragorn.amdh.fr (aragorn.groumpf.org [176.31.180.205]) by mx1.freebsd.org (Postfix) with ESMTP id 4TmxYj1q2gz46D4 for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 07:34:49 +0000 (UTC) (envelope-from xavier@groumpf.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=groumpf.org header.s=dkim header.b="M LnPrf0"; dmarc=none; spf=pass (mx1.freebsd.org: domain of xavier@groumpf.org designates 176.31.180.205 as permitted sender) smtp.mailfrom=xavier@groumpf.org Received: from numenor.groumpf.org (freebox-server.groumpf.org [82.64.247.11]) by aragorn.amdh.fr (Postfix) with ESMTP id D74B23E601AF for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:34:41 +0100 (CET) Received: from numenor.groumpf.org (localhost [127.0.0.1]) by numenor.groumpf.org (Postfix) with ESMTP id 8FFA21D5D1F for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:34:41 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=groumpf.org; h= content-transfer-encoding:content-type:content-type:subject :subject:from:from:content-language:user-agent:mime-version:date :date:message-id:received:received; s=dkim; t=1709364876; x= 1710228877; bh=+dt1i0mZJ4PQREX/ehCNBCrMYs38KDi8GOE8yVt08FI=; b=M LnPrf0nu7oCwJVyd4bWaViBNst33Vr5aGUOxobOzWPepzH1QaC8vo0bxgGTIbrsC NApgDUu8mnk9EU3QPnni+x6nyIbLhaX6CwCKRe3OUtK9ArrCVb9eJJ++o/BHjep7 L0npxPIyd5yussRxOIjg2vBLIHWXkVXB7mC2FaAB+Ie9dn7nbPWWkaBVYQQegW8E ecKE2r3PWKE9yos12wpfDxzbxnGXcec8E32HEY/lRM1/XOXl2s/hY0irg+9/MZUr ZN1MM00yNKXaVOhSn8JtxsNaO5SWmX+3/xXVuZkOvm0kYCwpTb5VMZoPCzyDblh6 SZEOqDeH5tJ54EmDqsdMqay22oiImHi7foXgimaHZjda9D3tEPOaqxXGX36VlXOE TaJb/nKJP57LM2ozsVRM2uZtxmYsPAFNrR+nJVYSe4JX2wRze/a9Ac+O65PsKhgi /6OkCQSr+4w90k+uUkqqeVtUP8sIjIrsb6HAsMbJvF4OfWzkczve+S0AsRJt5492 RU8AmcBYaYPFfXfRmBGz9FqBB6WXz6uw/6XXF9HJ86B0DIzO3EzZvcvG4sGSJLiw FiMdHR5xLLUmshxSUXMqfQfHKyEQv8Aph9jiT10D68b7nWeJN6ezY4jGjLj2dyR8 NOZgzlPzA6A4wUpgEPrZ6eozDbWIkB7DSkMXbMlru8= Received: from numenor.groumpf.org ([127.0.0.1]) by numenor.groumpf.org (ns3.groumpf.org [127.0.0.1]) (amavisd-new, port 10024) with LMTP id hP3ptyGE-5d9 for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:34:36 +0100 (CET) Received: from [192.168.100.30] (imladris.groumpf.org [192.168.100.30]) by numenor.groumpf.org (Postfix) with ESMTPSA id D05BB1D5C61 for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:34:35 +0100 (CET) Message-ID: <154c7cec-2703-4a57-b2cf-0fc94a0f8ee9@groumpf.org> Date: Sat, 2 Mar 2024 08:34:35 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Beta Content-Language: fr, en-US To: FreeBSD Ports ML <freebsd-ports@freebsd.org> From: Xavier Humbert <xavier@groumpf.org> Subject: py-setuptools-scm error Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.39 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; R_SPF_ALLOW(-0.20)[+ip4:176.31.180.205]; R_DKIM_ALLOW(-0.20)[groumpf.org:s=dkim]; MIME_GOOD(-0.10)[text/plain]; RCVD_NO_TLS_LAST(0.10)[]; XM_UA_NO_VERSION(0.01)[]; TO_DN_ALL(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_COUNT_THREE(0.00)[4]; DMARC_NA(0.00)[groumpf.org]; RCPT_COUNT_ONE(0.00)[1]; DKIM_TRACE(0.00)[groumpf.org:+]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:16276, ipnet:176.31.0.0/16, country:FR]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; RCVD_VIA_SMTP_AUTH(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MIME_TRACE(0.00)[0:+] X-Rspamd-Queue-Id: 4TmxYj1q2gz46D4 Hi, Now thet py-setuptools-scm 8 is out, tried to upgrade : [root@numenor ports]# portupgrade -vf -o devel/py-setuptools-scm py39-setuptools_scm-6.4.2 ---> Session started at: Sat, 02 Mar 2024 08:31:04 +0100 [Reading data from pkg(8) ... - 1757 packages found - done] ** Detected a package name change: py39-setuptools_scm (devel/py-setuptools_scm) -> 'py39-setuptools-scm' (devel/py-setuptools-scm) ---> Upgrade of devel/py-setuptools-scm started at: Sat, 02 Mar 2024 08:31:06 +0100 ---> Upgrading 'py39-setuptools_scm-6.4.2' to 'py39-setuptools-scm-8.0.4' (devel/py-setuptools-scm) ---> Build of devel/py-setuptools-scm started at: Sat, 02 Mar 2024 08:31:06 +0100 ---> Building '/usr/ports/devel/py-setuptools-scm' with make flags: -DDISABLE_CONFLICTS ===> Cleaning for py39-setuptools-scm-8.0.4 ===> License MIT accepted by the user ===>  py39-setuptools-scm-8.0.4 depends on file: /usr/local/sbin/pkg - found ===> Fetching all distfiles required by py39-setuptools-scm-8.0.4 for building ===> Extracting for py39-setuptools-scm-8.0.4 => SHA256 Checksum OK for setuptools-scm-8.0.4.tar.gz. ===> Patching for py39-setuptools-scm-8.0.4 ===>  py39-setuptools-scm-8.0.4 depends on package: py39-setuptools>0 - found ===>  py39-setuptools-scm-8.0.4 depends on package: py39-wheel>0 - found ===>  py39-setuptools-scm-8.0.4 depends on file: /usr/local/bin/python3.9 - found ===>  py39-setuptools-scm-8.0.4 depends on package: py39-tomli>0 - found ===>  py39-setuptools-scm-8.0.4 depends on package: py39-build>=0 - found ===>  py39-setuptools-scm-8.0.4 depends on package: py39-installer>=0 - found ===> Configuring for py39-setuptools-scm-8.0.4 ===> Building for py39-setuptools-scm-8.0.4 * Getting build dependencies for wheel... Traceback (most recent call last):  File "/usr/local/lib/python3.9/site-packages/pyproject_hooks/_in_process/_in_process.py", line 353, in <module>    main()  File "/usr/local/lib/python3.9/site-packages/pyproject_hooks/_in_process/_in_process.py", line 335, in main    json_out['return_val'] = hook(**hook_input['kwargs'])  File "/usr/local/lib/python3.9/site-packages/pyproject_hooks/_in_process/_in_process.py", line 118, in get_requires_for_build_wheel    return hook(config_settings)  File "/usr/local/lib/python3.9/site-packages/setuptools/build_meta.py", line 177, in get_requires_for_build_wheel    return self._get_build_requires(  File "/usr/local/lib/python3.9/site-packages/setuptools/build_meta.py", line 159, in _get_build_requires    self.run_setup()  File "/usr/local/lib/python3.9/site-packages/setuptools/build_meta.py", line 174, in run_setup    exec(compile(code, __file__, 'exec'), locals())  File "setup.py", line 1, in <module>  File "/usr/local/lib/python3.9/site-packages/setuptools/__init__.py", line 87, in setup    return distutils.core.setup(**attrs)  File "/usr/local/lib/python3.9/site-packages/setuptools/_distutils/core.py", line 139, in setup    _setup_distribution = dist = klass(attrs)  File "/usr/local/lib/python3.9/site-packages/setuptools/dist.py", line 476, in __init__    _Distribution.__init__(  File "/usr/local/lib/python3.9/site-packages/setuptools/_distutils/dist.py", line 275, in __init__    self.finalize_options()  File "/usr/local/lib/python3.9/site-packages/setuptools/dist.py", line 899, in finalize_options    for ep in sorted(loaded, key=by_order):  File "/usr/local/lib/python3.9/site-packages/setuptools/dist.py", line 898, in <lambda>    loaded = map(lambda e: e.load(), filtered)  File "/usr/local/lib/python3.9/site-packages/setuptools/_vendor/importlib_metadata/__init__.py", line 196, in load    return functools.reduce(getattr, attrs, module) AttributeError: module 'setuptools_scm.integration' has no attribute 'infer_version' ERROR Backend subprocess exited when trying to invoke get_requires_for_build_wheel *** Error code 1 Any idea to fix it ? Regards, Xavier -- Xavier HUMBERT - Unix/Win/MacOSX Sysadmin/Network Engineer https://www.amdh.fr From nobody Sat Mar 2 07:45:34 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TmxpY4nY6z5CFF6 for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 07:45:57 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Received: from APC01-TYZ-obe.outbound.protection.outlook.com (mail-tyzapc01olkn20801.outbound.protection.outlook.com [IPv6:2a01:111:f403:280c::801]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TmxpY0L8Jz48rv for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 07:45:57 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Authentication-Results: mx1.freebsd.org; none ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=Mc5x9ifvt1UHOMWG2wu3n9bKB1IJhI9KrIm2W+7W+BnJ+rpKuQwjAfcrcMoK/vTpF+a2RJriVoyZMNLcD23/rmGeN+u5xameNWkMTM/sa4xLP8sVXTPzM38ykUcj0vyYObAbraiwDV6O854wJE3wYs/52H61eayADTfTHB2JoIl7ViZd4jZB4oNR19cyNjR/yF1uj7qW2yKe09h5YM2Tlx3ndjpi36PaJANGUQUdyfjWkdDdcqumd5oD9GENIf8bSXyLYmadWedRQc1NaZIzF2aOP7BxF5Kp6T2WVAXuFOX+52V/QpnlENldicXXVXyCNrkRtnqmDcK3IooilVaK6Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=QN35MHg/TCMkcZxkCZxAmXIwfYYC2SuwRD1Fh6xwS/0=; b=X+SZWBdWJT69ilBg4roYu+OoCFo1H7krsKnwQSCzL45XVm9eSmRQlFqXCwlGNZvXs4q4RR6vxLCc9ucf4QKo1Rwjitkn1OXPO/eIRhwveoXVm+HD1fS6PwH2RaCiMDdWsr0KI7tDlKhyWkaPxD3h62InUTZVd91RvnkgKrljLXLElBa7CLzPkbUVtsrzwedzz1fQkGxxUTBc0iMoTvRoNHOpgdExTZsbZHYWIgd3oYmbf6x9w4vNicGxtNcHp14LDItMd+S8yEvDSsER8KANoWhcQMuY8hRIxkmuvpogQ270OxWiekXHM9uXA7+jScYGJRLN8b51aZyhJ1rm5FikGw== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=QN35MHg/TCMkcZxkCZxAmXIwfYYC2SuwRD1Fh6xwS/0=; b=qKecKCXwZ3SQHspUnEgJ7dV42GYfwUy/yeT2qwcylFAuqBlaxyEknVJVkpltuAQx5jCN+8GF9CEzBYTMT4i/86kkjhRq1au7qberNSyeBpZyAAJVu73GiMODmdcKjix2s1funPj40Gah7v2NoDqHtq9cxpHwMikp0kRmm98WLYZw5BKvhogs1HdlgT8fjshwLzAM5IfklAGxoetCkxaqpWMQiH2YBuTFuoil3JP6tcyyw/5OY2CWZl9JdSPCaDsj2FWtRqBnRIPxMBgQQOeX2ARRsJ73Lp45xi7D6ZuSEHy8ENpnZrQDx0Jj5NRQlGcRTIW8zZB6G9qgEHRqy0MuMg== Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) by JH0PR01MB5650.apcprd01.prod.exchangelabs.com (2603:1096:990:8::6) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7316.39; Sat, 2 Mar 2024 07:45:51 +0000 Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef]) by SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef%7]) with mapi id 15.20.7339.033; Sat, 2 Mar 2024 07:45:51 +0000 Subject: Re: py-setuptools-scm error To: Xavier Humbert <xavier@groumpf.org>, FreeBSD Ports ML <freebsd-ports@freebsd.org> References: <154c7cec-2703-4a57-b2cf-0fc94a0f8ee9@groumpf.org> From: Tatsuki Makino <tatsuki_makino@hotmail.com> Message-ID: <SI2PR01MB5036399445ABC3E5875137E2FA5D2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Date: Sat, 2 Mar 2024 16:45:34 +0900 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 In-Reply-To: <154c7cec-2703-4a57-b2cf-0fc94a0f8ee9@groumpf.org> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-TMN: [I2qrmpCcVMHKQpALWfPhbUdN6ZYf2aWB] X-ClientProxiedBy: TYCP286CA0363.JPNP286.PROD.OUTLOOK.COM (2603:1096:405:79::10) To SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) X-Microsoft-Original-Message-ID: <c8d5f462-f1e0-2071-cafb-78505af6e598@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: SI2PR01MB5036:EE_|JH0PR01MB5650:EE_ X-MS-Office365-Filtering-Correlation-Id: d2995d0b-76ed-43a3-1533-08dc3a8cc850 X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: 18KqEXmgvyJFt2PZjV2TrTmhLULQtD1umJfsgvB+wmP1zXnXL4BOtVIjOvBoHu3y1Zm1+uRMwQz8uw3BtbrAF5ub01sAsEgxmCGVB6KYCR/vvxuP4taYZX2YTwLzGyPU1MJe6jCt929eTtWBSUWQN3VuYepPNfEVUHmX1ZN9ggnME0sb3EOP6y+SIZo2IsRgMGqWbAM4VtYo5KS4A6OADGyBA2csieNGwGkRvNfQXc3f39Ar4ExOCSaVgF3tdAXxIw/C/2Mi5F3UxevaJDy5JRebcJ1K2pWKuXuZ928eYfpTJmDcYqmuw6F+ZPPfWbk5qcUDOnnR9LoSuBOD3QFbLiGD7MPl1YkR3qhY0gzndAsOEIdVIpuRPdSx2VLcyPcTbpobbROE6oZ2/vbr/9Xn1zm785/Tq+qNPlBkM87D/xdH20kerb2QF0kBCD++30rSfsGKgt6k8eeuPq9U0IXeVqJOGCHyiehc+bPgCOhFl+/iwc1MB+WtiOZdJzvbJgObmcibESuP41PczMg4eD3GSiBhOBwMvmXtZBSj50m9mRXeEQi90KfxzfABp8UZPpetvvkRCXmfLdkikJtWPyUA2FM2OngszrzF3bP0jAZ5ZQo= X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?Y2g0cklwUitUaHhqSG1JeS81TzN0ZDdqWkVuSytqSkhVblVKRTkwdHBjZW12?= =?utf-8?B?VWpNQ2F0Y3dRVWVxRjhNMTQyaXlHVnV4QUhhNTJMWTJndVdqVFJEV3FsdXda?= =?utf-8?B?cVdMN3lLb1I3Tm5TM1Rpc3duZ1ZwekhqUUthUE5nM1RsaWV0dHAwbklmNGJK?= =?utf-8?B?Z2pNem5OeGlxWGtXcWVRejkvUHNyMU9hNi80ZVA5UXl1dm9abndDbElCZjF0?= =?utf-8?B?UVFMWmN3Z01Za3JJcTNQcHJTN0d2K0ZKUnRmaE9XR045NjF0TG1JaVlzNHQ0?= =?utf-8?B?MTBjWVFJaEc2bUMybGd5R2VNNEpxMUNVVStiRlViYVljMGFpV0QvejFrZ0ph?= =?utf-8?B?RU5IdUFUdVgreHZEaEZoMUFYQnVQK21MWVVUaFZCRUtSVUxpb3pXOTUvYVN6?= =?utf-8?B?NnNweERCWE4xN0ZFSmFJWDE1SzdJbmtsNDFuVTZUSS9PM0tWaFlTOVBUTnQ0?= =?utf-8?B?ZFgzbll6WTdKSTl0QTc1aThnVTlxZkFRN05xaFNkazBaMGQvQVV5QnFtNWpq?= =?utf-8?B?N3I1UVNHSnNsVEYwMStJaGNkbWJrU1VJWmJiM2RKR08rVVZiemU0bWk0c2sx?= =?utf-8?B?dHVZTzJCOExEYStidXVVcEhFb1pVV1Q5UTBwdEVKcytQZ0Rhc0tramlwOUpD?= =?utf-8?B?b2hHbE1hb2F0bFRjQytRQkcrM0ovdWRucmVsSTNrdC9LQnZnczhaVC9sTUxO?= =?utf-8?B?K1ZRMGczdS9ST3Q0clZtcWJpYkIzd0RWTHExQ2E2Y3l2a0p0MUgwaXFrZ29y?= =?utf-8?B?NytKK3MzTXRvaEFySExHRkJ1bXRQam02ZjZFdGVWVitNYUlwbjUxRWhCTDVC?= =?utf-8?B?WkdmNVljVSt2WkQ0eWRMaWErL1ZmSzQ1SVpPZlhDRTZMaUxKQ0VFL1hJZjVY?= =?utf-8?B?NWVhaVBSVnZ2ekN6c3ZNUmFLbnBwczZ5S2pyYlRVLzZDUnhUMkkvMmltcEdN?= =?utf-8?B?d0VEa294RXdtU1NaRHJLR21RK2EyanRrWTBZSTlDdFl6ZDBMbTlCbzZkSyt6?= =?utf-8?B?QUFUNitldEtYOVYwNUp2R09BUzNqNEZoRGJxMjRHTm9WcWcvVVpSaXc0SEk0?= =?utf-8?B?dXZjZ2xyQ3N0MmxNdHZybFAreVNUbU0xVEFtelM2MjNCWis0ZUZtK2E5cEVu?= =?utf-8?B?VXJSc1hFQVlZcE1rWGJsVjNFYlMrOGgvYVdvTVVYRzNIalZxV0tMWWZjRmY0?= =?utf-8?B?blViUVNlUUhVSk5nWVZRVkpHQW1nU1JBY0xnK2RKTEVZKzdPRU1IeDNvUktP?= =?utf-8?B?MUZYSHkyZTQxbGo4enM0YlE0Q3JtM1hpNjlrMnNncGxiOVRkNnBsdGNNdHk5?= =?utf-8?B?SVJRTGhNWVYrcXgzL3d2MFcvSmdUa2doUnp2T3N5Sll5UkwxaGJsUGQ4TjUy?= =?utf-8?B?R2ZUWTAyNjhkKzNmQlFOOWwxSHdXUEtrdlNpL2N4TVVJSFcxcTBIa2JVczNU?= =?utf-8?B?a2xEK1czMnFPU3dVMHoxRTJuS2hiTjljdHlwMFBKNDJTOHdWQmxDNkxGM3R3?= =?utf-8?B?VVRGaVZqeTFENjFLOUo3VHAwWWdQajBUdXFTSXhXZnlyeFhxUUM3cEROcW9r?= =?utf-8?B?WmZzelpVME5VbldYdEZUbjg5b3h5SUFmbm81SjI4OWVETm1meThLeVVrVVd0?= =?utf-8?B?SE5Ddm8xRHp6ajlQYjZBbmNTVldSQ2VYTVMrc3pINUdLWjV3Y3orN1RUK0Vz?= =?utf-8?Q?d4+0Ovd8nCrN6MzJ7dof?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-d8e84.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: d2995d0b-76ed-43a3-1533-08dc3a8cc850 X-MS-Exchange-CrossTenant-AuthSource: SI2PR01MB5036.apcprd01.prod.exchangelabs.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 02 Mar 2024 07:45:51.4188 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: JH0PR01MB5650 X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:8075, ipnet:2a01:111:f000::/36, country:US] X-Rspamd-Queue-Id: 4TmxpY0L8Jz48rv Hello. It seems that py39-setuptools_scm-6.4.2 must not be installed to install py39-setuptools-scm-8.x. So we cannot use -o of portmaster or portupgrade. The only way seems to be to delete it beforehand with pkg delete -f. Then reinstall the ports that have lost their dependencies, and they will be installed with the auto-install flag also set correctly. Regards. From nobody Sat Mar 2 08:24:54 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tmygf1Py3z5CJW9 for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 08:25:02 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-wm1-x335.google.com (mail-wm1-x335.google.com [IPv6:2a00:1450:4864:20::335]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tmygd1CV4z4FD1 for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:25:01 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=Ok2QiowM; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of hubert.tournier@gmail.com designates 2a00:1450:4864:20::335 as permitted sender) smtp.mailfrom=hubert.tournier@gmail.com Received: by mail-wm1-x335.google.com with SMTP id 5b1f17b1804b1-412d67e4ec1so1239535e9.1 for <freebsd-ports@freebsd.org>; Sat, 02 Mar 2024 00:25:01 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709367897; x=1709972697; darn=freebsd.org; h=in-reply-to:from:content-language:references:cc:to:subject :user-agent:mime-version:date:message-id:from:to:cc:subject:date :message-id:reply-to; bh=pLOqL9PycTLl6T+cUjLcY+UHEnckbx67xCtVIFoQE6o=; b=Ok2QiowMBNbD+G9DsvGKerGE0q+cSE5I58VKxUlZP8IWzabt62hbCH5GEWsncG/Wjo A9xbhfDnv6ejhcJxJA7sLiQ84DsgNDRWU91YYJSqoSCud70CfUtn6M/3OqJX5ND+t1gb XlK0fIjp9Um78S6jBGZsGavvxSGhjMZ7fA1MY780w7zwD4tdzSxVWqQ8eq13bZbNnH// NuKM2vAHbt7apmsTs5hpWrkZlGLNi1wwhCLMWs5E123gAMTAjmspxiBM+asxJGdwkTMZ +BK7TYReFdoHFTaIgkKdOeQTTd5KlnMixWEgLpo2TAcQ60FRadlHZG2gaUoRVgs4A4oM RsHA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709367897; x=1709972697; h=in-reply-to:from:content-language:references:cc:to:subject :user-agent:mime-version:date:message-id:x-gm-message-state:from:to :cc:subject:date:message-id:reply-to; bh=pLOqL9PycTLl6T+cUjLcY+UHEnckbx67xCtVIFoQE6o=; b=Pt2wTmdMp1b/l23oAaEohiqVA0zwKBy0N7HKlx6nRWnp8BogPXvoGs73WmY5TOG/9h h/qlDHmUNHcNWGuFtZ8QjkodpePSD90P3b55HCmumf1kkmHCUoTYJ0GjBIsySCD3n/Zb 8PwMGIFGVnEO7UCRRDTz4hPlTYbrUF+OSiAuhozRqJEskS01ceuRZ8aL4weercOtshTC vyywbmxrSp8UdTRq+BSLc9Elo7fSixmeqn5lIxzfFAnyHPPET4Wo87BpXq9wakPUB6ON D7vAG8L1cS0rlOD7ihU9drIhwnUSYHaYp8p2+aIBCbmjFq7V6Y/KI6PPaLPR0+fXNmFf rdjg== X-Gm-Message-State: AOJu0YzluSdaokV4EuXq49vkeQZmSeoLtVRMVI0c9OB9cw362Uq/g/6W A0gmLDz3L05yJ15rfAQA/GotkdH4ZXIi9ZqyFNpFopIy8+NoaP1q X-Google-Smtp-Source: AGHT+IGpwKGSncMWT+mxigzW31g3gISdBx2rYhOWLHzkxkh9Y5HPCGTyCLI9+7KZOCGy5Z9rj1/6Kw== X-Received: by 2002:a05:600c:a384:b0:412:ae57:379 with SMTP id hn4-20020a05600ca38400b00412ae570379mr2641734wmb.17.1709367896812; Sat, 02 Mar 2024 00:24:56 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:f1cb:8029:e27a:b01e? ([2a01:e0a:80d:9d80:f1cb:8029:e27a:b01e]) by smtp.gmail.com with ESMTPSA id c21-20020a05600c0a5500b00412cb0961fasm3140537wmq.6.2024.03.02.00.24.56 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sat, 02 Mar 2024 00:24:56 -0800 (PST) Content-Type: multipart/alternative; boundary="------------xuZYr2Zd9wO5YWRG0E7622oH" Message-ID: <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> Date: Sat, 2 Mar 2024 09:24:54 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Port tree linter To: Alexander Leidinger <Alexander@Leidinger.net> Cc: freebsd-ports@freebsd.org References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> Content-Language: fr From: Hubert Tournier <hubert.tournier@gmail.com> In-Reply-To: <46af7b220502ded8fb3848f279546da3@Leidinger.net> X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.98 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.99)[-0.988]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36:c]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; XM_UA_NO_VERSION(0.01)[]; RCVD_TLS_LAST(0.00)[]; TO_DN_SOME(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; RCPT_COUNT_TWO(0.00)[2]; FREEMAIL_FROM(0.00)[gmail.com]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TAGGED_FROM(0.00)[]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; FREEMAIL_ENVFROM(0.00)[gmail.com]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::335:from] X-Rspamd-Queue-Id: 4Tmygd1CV4z4FD1 This is a multi-part message in MIME format. --------------xuZYr2Zd9wO5YWRG0E7622oH Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit Le 28/02/2024 à 08:32, Alexander Leidinger a écrit : > Am 2024-02-28 00:52, schrieb Hubert Tournier: >>> Shouldn't this make it to ports-mgmt/ as portlinter? >> >> If it's deemed useful, I could make the port next week-end. > > If you do that, I suggest to use a name which makes it clear that it > is not a replacement for portlint (which operates on 1 port), and that > makes it clear that it operates on the whole tree. Maybe > portstreelint, or portstreecheck, or ptlint, or ptcheck, or whatever, > but not "portlint*". Hello, You're right. I was lacking inspiration the day I named this :-) I made a new version named portstreelint (with aliases ptlint and ptl), which is now a Python package rather than a standalone script. It supersedes the previous one and is located at: https://github.com/HubTou/portstreelint With Python's pip it can be installed with: pip install pnu-portstreelint I also added many new checks, some inspired by the neighboring "Proposed ports deprecation and removal policy" discussion thread. On a freshly updated ports tree and index, it reports the following findings: Selected 34408 ports out of 34408 in the FreeBSD port tree, and found:  5 ports with unusual installation-prefix (warning)  338 ports with a comment string exceeding 70 characters (warning)  286 ports with an uncapitalized comment  11 ports comment ending with a dot  109 ports with a comment different between the Index and Makefile  2 ports with non existent description-file  198 ports with URL ending description-file  613 ports with description-file identical to comment  483 ports with description-file no longer than comment  10427 ports without pkg-plist/PLIST_FILES/PLIST/PLIST_SUB (info)  170 ports abusing PLIST_FILES with more than 6 entries (warning)  5 ports with a maintainer different between the Index and Makefile  34 ports referring to unofficial categories (warning)  262 ports with categories different between the Index and Makefile  1246 ports with no www-site  304 ports with an unresolvable www-site hostname  659 ports with an unaccessible www-site  2 ports with a www-site different betwwen the Index and makefile  121 ports with a BROKEN mark  39 ports with a BROKEN mark older than 180 days  232 ports with a IGNORE mark in some cases (info)  1 port with a FORBIDDEN mark  2 ports with a FORBIDDEN mark older than 90 days  114 ports with a DEPRECATED mark  13 ports with a DEPRECATED mark older than 180 days Full refreshed reports are available at the following addresses for those who are curious but don't want to install the tool: https://www.frbsd.org/xch/stdout.txt https://www.frbsd.org/xch/stderr.txt Note that packing list check is not that much interesting as one third of the ports tree is not using any of the ways documented in the Porter's Handbook to list its files. I could use some help here to make it better. Now that this tool is a Python package, it's easier to use other Python libraries. I already created a dependency on my vuxml library (https://github.com/HubTou/vuxml), which I will shortly use to add vulnerable ports reporting. I'll then study how to check unavailable distfiles (building their name in all the ports cases being the hardest part). Best regards, Hubert --------------xuZYr2Zd9wO5YWRG0E7622oH Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 8bit <!DOCTYPE html> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> </head> <body> Le 28/02/2024 à 08:32, Alexander Leidinger a écrit :<br> <blockquote type="cite" cite="mid:46af7b220502ded8fb3848f279546da3@Leidinger.net">Am 2024-02-28 00:52, schrieb Hubert Tournier: <br> <blockquote type="cite"> <blockquote type="cite">Shouldn't this make it to ports-mgmt/ as portlinter? <br> </blockquote> <br> If it's deemed useful, I could make the port next week-end. <br> </blockquote> <br> If you do that, I suggest to use a name which makes it clear that it is not a replacement for portlint (which operates on 1 port), and that makes it clear that it operates on the whole tree. Maybe portstreelint, or portstreecheck, or ptlint, or ptcheck, or whatever, but not "portlint*". </blockquote> <p></p> <p>Hello,<br> </p> <p>You're right. I was lacking inspiration the day I named this :-)</p> <p>I made a new version named portstreelint (with aliases ptlint and ptl), which is now a Python package rather than a standalone script.<br> </p> <p>It supersedes the previous one and is located at: <a class="moz-txt-link-freetext" href="https://github.com/HubTou/portstreelint">https://github.com/HubTou/portstreelint</a> <br> </p> <p>With Python's pip it can be installed with: pip install pnu-portstreelint<br> </p> <p>I also added many new checks, some inspired by the neighboring "Proposed ports deprecation and removal policy" discussion thread.</p> <p>On a freshly updated ports tree and index, it reports the following findings:</p> <p>Selected 34408 ports out of 34408 in the FreeBSD port tree, and found:<br>  5 ports with unusual installation-prefix (warning)<br>  338 ports with a comment string exceeding 70 characters (warning)<br>  286 ports with an uncapitalized comment<br>  11 ports comment ending with a dot<br>  109 ports with a comment different between the Index and Makefile<br>  2 ports with non existent description-file<br>  198 ports with URL ending description-file<br>  613 ports with description-file identical to comment<br>  483 ports with description-file no longer than comment<br>  10427 ports without pkg-plist/PLIST_FILES/PLIST/PLIST_SUB (info)<br>  170 ports abusing PLIST_FILES with more than 6 entries (warning)<br>  5 ports with a maintainer different between the Index and Makefile<br>  34 ports referring to unofficial categories (warning)<br>  262 ports with categories different between the Index and Makefile<br>  1246 ports with no www-site<br>  304 ports with an unresolvable www-site hostname<br>  659 ports with an unaccessible www-site<br>  2 ports with a www-site different betwwen the Index and makefile<br>  121 ports with a BROKEN mark<br>  39 ports with a BROKEN mark older than 180 days<br>  232 ports with a IGNORE mark in some cases (info)<br>  1 port with a FORBIDDEN mark<br>  2 ports with a FORBIDDEN mark older than 90 days<br>  114 ports with a DEPRECATED mark<br>  13 ports with a DEPRECATED mark older than 180 days</p> <p>Full refreshed reports are available at the following addresses for those who are curious but don't want to install the tool:</p> <pre class="main">    <a class="moz-txt-link-freetext" href="https://www.frbsd.org/xch/stdout.txt">https://www.frbsd.org/xch/stdout.txt</a>    <a class="moz-txt-link-freetext" href="https://www.frbsd.org/xch/stderr.txt">https://www.frbsd.org/xch/stderr.txt</a></pre> <p></p> <p>Note that packing list check is not that much interesting as one third of the ports tree is not using any of the ways documented in the Porter's Handbook to list its files.</p> <p>I could use some help here to make it better.<br> </p> <p>Now that this tool is a Python package, it's easier to use other Python libraries.</p> <p>I already created a dependency on my vuxml library (<a class="moz-txt-link-freetext" href="https://github.com/HubTou/vuxml">https://github.com/HubTou/vuxml</a>), which I will shortly use to add vulnerable ports reporting.<br> </p> <p>I'll then study how to check unavailable distfiles (building their name in all the ports cases being the hardest part).<br> </p> <p>Best regards,<br> </p> <p>Hubert</p> </body> </html> --------------xuZYr2Zd9wO5YWRG0E7622oH-- From nobody Sat Mar 2 08:44:25 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tmz6D3Gp9z5CKyq for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 08:44:36 +0000 (UTC) (envelope-from xavier@groumpf.org) Received: from aragorn.amdh.fr (aragorn.groumpf.org [176.31.180.205]) by mx1.freebsd.org (Postfix) with ESMTP id 4Tmz6C21BTz4GhC for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:44:35 +0000 (UTC) (envelope-from xavier@groumpf.org) Authentication-Results: mx1.freebsd.org; none Received: from numenor.groumpf.org (freebox-server.groumpf.org [82.64.247.11]) by aragorn.amdh.fr (Postfix) with ESMTP id 52E803E6027B; Sat, 2 Mar 2024 09:44:34 +0100 (CET) Received: from numenor.groumpf.org (localhost [127.0.0.1]) by numenor.groumpf.org (Postfix) with ESMTP id 4BF731E3009; Sat, 2 Mar 2024 09:44:33 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=groumpf.org; h= in-reply-to:from:from:references:content-language:subject :subject:user-agent:mime-version:date:date:message-id :content-type:content-type:received:received; s=dkim; t= 1709369066; x=1710233067; bh=C8e8oiI74cTWqrWWOhSE6VFPdTjwxvps2eA 5lVONvNA=; b=ZbfNyJoFcdrSy5F5ASE6zIRp+PtIprkVPOVpX8ILQFVw3ACqGwX HI/rcjmJn65as7+Ve8ujSH1dLOHvwHsBo6EvFVX3ScJJkoeHPgxFbFjKxYdnxYsB lWHRaPhH3vJ2j5wOggQhsjuKmiE+alADK+r+ZPI/upBU38KX5IgzpReblb6jlOHL cRpP8P8OUL2K/C+uYwiaQldTqvbKdPC38ymbuXMjOm/hDOtEAGAscYBvixqe+Paw OmJ9VtuLV+8CNEro4QCXSHULPVFOx6ZhQImwBHvH0w2NBsKJq30s8q04JBQLQeWo 2kEZmGiM38owMWg0ivxgjSGJBMZWh9z27WL2A99PgMi3bGwYjYGaHOFTQCv+Q7VU nHF7SI0gnDIULXsB6xl09ZQWfx7/DYr4DzYG0+DBJjjtEVLQiK5V+8kM0FJYBzsK KMyZrLrzGYTW7DRVUIoctYtOaZQrdXZVg97haElM1xOvUW6qdVYAKg/WFtIbJAqY sM2hnxQbVAzXXDlUq/cKorL205OUCo+DmxJFFdDVxwm00kdSazSf8Wn601GHHi7Q yY0r/PNkp6XjzKSdV4xAK5zSLamxv7eJqlY0wY+vYhL4eqKPsFDEj3fwffFhKxDj SZ8eiz5qyB0G9Hwn6k68nE+6XIqWcpCU1KJa9K9ZOzXn6Xq3KjTHf6C4= Received: from numenor.groumpf.org ([127.0.0.1]) by numenor.groumpf.org (ns3.groumpf.org [127.0.0.1]) (amavisd-new, port 10024) with LMTP id txGo88b-7uk5; Sat, 2 Mar 2024 09:44:26 +0100 (CET) Received: from [192.168.100.30] (imladris.groumpf.org [192.168.100.30]) by numenor.groumpf.org (Postfix) with ESMTPSA id 4CD281E2FC8; Sat, 2 Mar 2024 09:44:26 +0100 (CET) Content-Type: multipart/alternative; boundary="------------kyfFMpYbd000LHBTKosqVPBy" Message-ID: <92209061-4925-49a6-8508-c413d18ac3c0@groumpf.org> Date: Sat, 2 Mar 2024 09:44:25 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Beta Subject: Re: py-setuptools-scm error Content-Language: fr To: Tatsuki Makino <tatsuki_makino@hotmail.com>, FreeBSD Ports ML <freebsd-ports@freebsd.org> References: <154c7cec-2703-4a57-b2cf-0fc94a0f8ee9@groumpf.org> <SI2PR01MB5036399445ABC3E5875137E2FA5D2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> From: Xavier Humbert <xavier@groumpf.org> In-Reply-To: <SI2PR01MB5036399445ABC3E5875137E2FA5D2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16276, ipnet:176.31.0.0/16, country:FR] X-Rspamd-Queue-Id: 4Tmz6C21BTz4GhC This is a multi-part message in MIME format. --------------kyfFMpYbd000LHBTKosqVPBy Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit Le 02/03/2024 08:45, Tatsuki Makino a écrit : > Hello. > > It seems that py39-setuptools_scm-6.4.2 must not be installed to install py39-setuptools-scm-8.x. > So we cannot use -o of portmaster or portupgrade. > The only way seems to be to delete it beforehand with pkg delete -f. That's what I did, with no success. > Then reinstall the ports that have lost their dependencies, and they will be installed with the auto-install flag also set correctly. > > Regards. Regards, Xavier -- Xavier HUMBERT - Unix/Win/MacOSX Sysadmin/Network Engineer https://www.amdh.fr --------------kyfFMpYbd000LHBTKosqVPBy Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 8bit <!DOCTYPE html> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> </head> <body> <div class="moz-cite-prefix">Le 02/03/2024 08:45, Tatsuki Makino a écrit :<br> </div> <blockquote type="cite" cite="mid:SI2PR01MB5036399445ABC3E5875137E2FA5D2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com"> <pre wrap="" class="moz-quote-pre">Hello. It seems that py39-setuptools_scm-6.4.2 must not be installed to install py39-setuptools-scm-8.x. So we cannot use -o of portmaster or portupgrade. The only way seems to be to delete it beforehand with pkg delete -f.</pre> </blockquote> That's what I did, with no success.<br> <blockquote type="cite" cite="mid:SI2PR01MB5036399445ABC3E5875137E2FA5D2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com"> <pre wrap="" class="moz-quote-pre"> Then reinstall the ports that have lost their dependencies, and they will be installed with the auto-install flag also set correctly. Regards. </pre> </blockquote> <br> <p>Regards,</p> <p><span style="white-space: pre-wrap">Xavier </span></p> <pre class="moz-signature" cols="72">-- Xavier HUMBERT - Unix/Win/MacOSX Sysadmin/Network Engineer <a class="moz-txt-link-freetext" href="https://www.amdh.fr">https://www.amdh.fr</a> </pre> </body> </html> --------------kyfFMpYbd000LHBTKosqVPBy-- From nobody Sat Mar 2 08:50:00 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TmzDX22yTz5CLDM for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 08:50:04 +0000 (UTC) (envelope-from xavier@groumpf.org) Received: from aragorn.amdh.fr (aragorn.groumpf.org [176.31.180.205]) by mx1.freebsd.org (Postfix) with ESMTP id 4TmzDW32lXz4HBs for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 08:50:03 +0000 (UTC) (envelope-from xavier@groumpf.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=groumpf.org header.s=dkim header.b=e6Fikj1C; dmarc=none; spf=pass (mx1.freebsd.org: domain of xavier@groumpf.org designates 176.31.180.205 as permitted sender) smtp.mailfrom=xavier@groumpf.org Received: from numenor.groumpf.org (freebox-server.groumpf.org [82.64.247.11]) by aragorn.amdh.fr (Postfix) with ESMTP id 94F253E6047F; Sat, 2 Mar 2024 09:50:02 +0100 (CET) Received: from numenor.groumpf.org (localhost [127.0.0.1]) by numenor.groumpf.org (Postfix) with ESMTP id 799111E3022; Sat, 2 Mar 2024 09:50:02 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=groumpf.org; h= content-transfer-encoding:content-type:content-type:in-reply-to :content-language:references:from:from:subject:subject :user-agent:mime-version:date:date:message-id:received:received; s=dkim; t=1709369400; x=1710233401; bh=UxSAcS0Tse7/ExfQ2TT/tiO+ jkRV6p3h0O1wVoIatAM=; b=e6Fikj1C+iQTso9BfFkeHnYImTd3Cv3nxY34476B XoHO+5rDaYjkv4Ggvd8yTUDFndRKfi9nONLqHq/H9clEBwts2/y9y7kpqYJm+sac XeMiPCQ5543+humdJdUchY42CnB2s07zSPnH04Rtq7pNPA2bQZhXA3qG6nAHLY+C pXoC903eklcGplEJwgUZSYS5BLeWXFkcI7Wn4pO29G9hISqBOEXcCt6cbKaaKMv1 RcOd3YIMxGh+Ybun2axqT4PEMeD0yKTB+BIJMD7Zh9mHZNseuLOW3FkjOrON37J8 LCzg2nK+AjiF8qoSIzDWPPspoGTL7SMx5H4S4PiF0P4H03QNY8BKJ224TvjoPJwR mvX4WC1rMoDZuiCcwNlUmNBx+XSPcClQqQkI8ld3jjsTOJXpa7X0e830UkTF+0wU jRUEuLORm6ECFwtTRKUtZ99dbD2obDZKb8Jp4ZFCWbk+c+G2vph9LjGVeuo1DcF7 A24ypRGK1bwex69HxBz3LXagDbifGrMdTNdEew49u/Zl9XfaOmg+W6RRUm3SOF46 Ebf/yPT8wX9yeZ0mexUBQnsZkhwsjI8HI4jvSrMCg+yWYHXpfwrZWzAzhM3UoEqD pjezD4PLXprKYXdsEkITkr2O3/Wgb71aDdgIs/WNL/atNJgKcgVCfUI1spEvH6gy VQk= Received: from numenor.groumpf.org ([127.0.0.1]) by numenor.groumpf.org (ns3.groumpf.org [127.0.0.1]) (amavisd-new, port 10024) with LMTP id CFF3MqtiSD1S; Sat, 2 Mar 2024 09:50:00 +0100 (CET) Received: from [192.168.100.30] (imladris.groumpf.org [192.168.100.30]) by numenor.groumpf.org (Postfix) with ESMTPSA id 612D01E2FD6; Sat, 2 Mar 2024 09:50:00 +0100 (CET) Message-ID: <208b1212-2914-41b0-8441-6192075a7611@groumpf.org> Date: Sat, 2 Mar 2024 09:50:00 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Beta Subject: Re: py-setuptools-scm error From: Xavier Humbert <xavier@groumpf.org> To: Tatsuki Makino <tatsuki_makino@hotmail.com>, FreeBSD Ports ML <freebsd-ports@freebsd.org> References: <154c7cec-2703-4a57-b2cf-0fc94a0f8ee9@groumpf.org> <SI2PR01MB5036399445ABC3E5875137E2FA5D2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> <92209061-4925-49a6-8508-c413d18ac3c0@groumpf.org> Content-Language: fr In-Reply-To: <92209061-4925-49a6-8508-c413d18ac3c0@groumpf.org> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.39 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.998]; R_SPF_ALLOW(-0.20)[+ip4:176.31.180.205]; R_DKIM_ALLOW(-0.20)[groumpf.org:s=dkim]; MIME_GOOD(-0.10)[text/plain]; RCVD_NO_TLS_LAST(0.10)[]; XM_UA_NO_VERSION(0.01)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:16276, ipnet:176.31.0.0/16, country:FR]; RCVD_VIA_SMTP_AUTH(0.00)[]; DMARC_NA(0.00)[groumpf.org]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; TO_MATCH_ENVRCPT_SOME(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FREEMAIL_TO(0.00)[hotmail.com,freebsd.org]; TO_DN_ALL(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; RCVD_COUNT_THREE(0.00)[4]; DKIM_TRACE(0.00)[groumpf.org:+] X-Rspamd-Queue-Id: 4TmzDW32lXz4HBs Le 02/03/2024 09:44, Xavier Humbert a écrit : > Le 02/03/2024 08:45, Tatsuki Makino a écrit : >> Hello. >> >> It seems that py39-setuptools_scm-6.4.2 must not be installed to install py39-setuptools-scm-8.x. >> So we cannot use -o of portmaster or portupgrade. >> The only way seems to be to delete it beforehand with pkg delete -f. > That's what I did, with no success. >> Then reinstall the ports that have lost their dependencies, and they will be installed with the auto-install flag also set correctly. >> >> Regards. > Sorry, I didn't double check, it worked. Thanks Regards Xavier -- Xavier HUMBERT - Unix/Win/MacOSX Sysadmin/Network Engineer https://www.amdh.fr From nobody Sat Mar 2 17:22:03 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnBcT6vzxz5CcPM for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 17:23:05 +0000 (UTC) (envelope-from Alexander@Leidinger.net) Received: from mailgate.Leidinger.net (mailgate.leidinger.net [IPv6:2a00:1828:2000:313::1:5]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature ECDSA (P-256) client-digest SHA256) (Client CN "mailgate.leidinger.net", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnBcS6874z4FSl for <freebsd-ports@freebsd.org>; Sat, 2 Mar 2024 17:23:04 +0000 (UTC) (envelope-from Alexander@Leidinger.net) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=leidinger.net header.s=outgoing-alex header.b=Qipu1Mwy; dmarc=pass (policy=quarantine) header.from=leidinger.net; spf=pass (mx1.freebsd.org: domain of Alexander@Leidinger.net designates 2a00:1828:2000:313::1:5 as permitted sender) smtp.mailfrom=Alexander@Leidinger.net List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=leidinger.net; s=outgoing-alex; t=1709400172; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=wVDnInVktiNAfSnb8E5Qfd5h/Ol36YsCklSLWIkur0k=; b=Qipu1Mwy8/UJR99Xv89R+IxQUTgp50ZqHrbP6Evjr0SDCZ69T2IZn7UmSd8V3f9MDzsFoD wuGVYbFwEf9aEEAtWyNrMHDfHu9cfADXOiHw5Ft+7JEMBZ8LuFQdzRfWjbs5youJVbuUx/ 2bTnh5HbBARh+Ynh28ISMsfbOkr5Fx7QjlGNP0jfj02Hvx7+q8Oa56PwiGnavuzM0k2DHg Cwf32PkCs9PI/Co4eWElSsXtXhsB1TzMnH98db9CQMaHdF+tCSZH1A6spnrFVxw3rIzsP9 9qVs0f//YWWAwTiVxuxIBJxb+ZunQYz1E+SofDgYay/WiB2WomZayNfmY72lvw== Date: Sat, 02 Mar 2024 18:22:03 +0100 From: Alexander Leidinger <Alexander@Leidinger.net> To: Hubert Tournier <hubert.tournier@gmail.com> Cc: freebsd-ports@freebsd.org Subject: Re: Port tree linter In-Reply-To: <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> Message-ID: <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> Organization: No organization, this is a private message. Content-Type: multipart/signed; protocol="application/pgp-signature"; boundary="=_219e0f8f68cffc1a8185b60966ec62dd"; micalg=pgp-sha256 X-Spamd-Bar: ------ X-Spamd-Result: default: False [-6.10 / 15.00]; SIGNED_PGP(-2.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[leidinger.net,quarantine]; R_DKIM_ALLOW(-0.20)[leidinger.net:s=outgoing-alex]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.20)[multipart/signed,multipart/alternative,text/plain]; ARC_NA(0.00)[]; ASN(0.00)[asn:34240, ipnet:2a00:1828::/32, country:DE]; DKIM_TRACE(0.00)[leidinger.net:+]; MIME_TRACE(0.00)[0:+,1:+,2:+,3:~,4:~]; HAS_ORG_HEADER(0.00)[]; TO_DN_SOME(0.00)[]; TAGGED_RCPT(0.00)[]; FREEMAIL_TO(0.00)[gmail.com]; MISSING_XM_UA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCVD_COUNT_ZERO(0.00)[0]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; HAS_ATTACHMENT(0.00)[] X-Rspamd-Queue-Id: 4TnBcS6874z4FSl This is an OpenPGP/MIME signed message (RFC 4880 and 3156) --=_219e0f8f68cffc1a8185b60966ec62dd Content-Type: multipart/alternative; boundary="=_4559efa7803e73d072cd5fc044f04457" --=_4559efa7803e73d072cd5fc044f04457 Content-Transfer-Encoding: 7bit Content-Type: text/plain; charset=US-ASCII; format=flowed Am 2024-03-02 09:24, schrieb Hubert Tournier: > Now that this tool is a Python package, it's easier to use other Python > libraries. Maybe a check for ports which could be flavourized? Most PHP and python packages could be flavourized. The issue may be false positives... PHP examples are baikal and tt-rss (for both I have patches, waiting a bit before declaring maintainer timeout). Bye, Alexander. -- http://www.Leidinger.net Alexander@Leidinger.net: PGP 0x8F31830F9F2772BF http://www.FreeBSD.org netchild@FreeBSD.org : PGP 0x8F31830F9F2772BF --=_4559efa7803e73d072cd5fc044f04457 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=UTF-8 <html><head><meta http-equiv=3D"Content-Type" content=3D"text/html; charset= =3DUTF-8" /></head><body style=3D'font-size: 10pt; font-family: Verdana,Gen= eva,sans-serif'> <p id=3D"reply-intro">Am 2024-03-02 09:24, schrieb Hubert Tournier:</p> <blockquote type=3D"cite" style=3D"padding: 0 0.4em; border-left: #1010ff 2= px solid; margin: 0"> <div id=3D"replybody1"> <div><br /> <p>Now that this tool is a Python package, it's easier to use other Python = libraries.</p> </div> </div> </blockquote> <p>Maybe a check for ports which could be flavourized? Most PHP and python = packages could be flavourized. The issue may be false positives...</p> <p>PHP examples are baikal and tt-rss (for both I have patches, waiting a b= it before declaring maintainer timeout).</p> <p>Bye,<br />Alexander.</p> <div id=3D"signature">-- <br /> <div class=3D"pre" style=3D"margin: 0; padding: 0; font-family: monospace">= <a href=3D"http://www.Leidinger.net" target=3D"_blank" rel=3D"noopener nore= ferrer">http://www.Leidinger.net</a> <a href=3D"mailto:Alexander@Leidinger.= net:">Alexander@Leidinger.net:</a> PGP 0x8F31830F9F2772BF<br /><a href=3D"h= ttp://www.FreeBSD.org" target=3D"_blank" rel=3D"noopener noreferrer">http:/= /www.FreeBSD.org</a> <a href=3D"mailto:netchild@FreeBSD.org">n= etchild@FreeBSD.org</a> : PGP 0x8F31830F9F2772BF</div> </div> </body></html> --=_4559efa7803e73d072cd5fc044f04457-- --=_219e0f8f68cffc1a8185b60966ec62dd Content-Type: application/pgp-signature; name=signature.asc Content-Disposition: attachment; filename=signature.asc; size=833 Content-Description: OpenPGP digital signature -----BEGIN PGP SIGNATURE----- iQIzBAEBCAAdFiEER9UlYXp1PSd08nWXEg2wmwP42IYFAmXjYEoACgkQEg2wmwP4 2IadNw//bJqG1emIJwuiCJle6ROvPQ+vkvguXMsWvjBrNmpH5IFl638tmJB6yita EddHfv9Mt3nCUrrmh4GdEhvkb1hGUHv5yQPJ4h7ZSBAZVuON2jyMKlAymGeW+eex KgmTeGz3w0Rmpk7Hg8Nzqd7WRSCI09PiRG/dF2jpUakJncU8VUnuJyv5uPESzduu JRcliCkB+BnxiI6YbELV9zCk8Qr8yNtXYx3ZeG0epS+keniN+PifG3svLWXbbhIZ CQcf4Jcpmg63dWcJaSlv6+qTgyNm7UvroDXq3Qv9qhNQ7Fc6yqDs3vrat3LRXff5 7lx2blxyFStmF9IwrHfETFPqsjfHZNXg6GQkWD1zHWCOTkpIAwAwck0zq4qpzVN9 aS4lox5G+QoUuXW0h8fHyU04s6wHZai9Mz0zlmRkBh5OkRLZHRhSUlVae1FwXznW uCT7gIRqHcDbaAGkyfONa2SnhmhPZdU1A3oacUh7G11ZsPukKAPaBNjsb2mTfHnQ IIL1p5JALIzVmvWDlGITGnBIBg9IEvKpM26kCpAp/m1OKEiYD1eDab6rMXi5Dhar BkICuuHBS+7zZbC2PVQioaf5Ri9k291L67Wwrr8EqGmaeW5h+HskB09Y+X7WdfOd ASiPE506wyOjL0YAZalJ/deaqhOA2RW/djCvuQUgclMRUuzTwkk= =Nih8 -----END PGP SIGNATURE----- --=_219e0f8f68cffc1a8185b60966ec62dd-- From nobody Sat Mar 2 22:59:10 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnL4T25Rcz5D707 for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 22:59:21 +0000 (UTC) (envelope-from SRS0=wRrg=KI=quip.cz=000.fbsd@elsa.codelab.cz) Received: from elsa.codelab.cz (elsa.codelab.cz [94.124.105.4]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnL4S1tjlz4mpd for <freebsd-ports@FreeBSD.org>; Sat, 2 Mar 2024 22:59:20 +0000 (UTC) (envelope-from SRS0=wRrg=KI=quip.cz=000.fbsd@elsa.codelab.cz) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=quip.cz header.s=private header.b=YqEIV8ol; dkim=pass header.d=quip.cz header.s=private header.b=De2UmEAE; dmarc=none; spf=none (mx1.freebsd.org: domain of "SRS0=wRrg=KI=quip.cz=000.fbsd@elsa.codelab.cz" has no SPF policy when checking 94.124.105.4) smtp.mailfrom="SRS0=wRrg=KI=quip.cz=000.fbsd@elsa.codelab.cz" Received: from elsa.codelab.cz (localhost [127.0.0.1]) by elsa.codelab.cz (Postfix) with ESMTP id 65277D78F7 for <freebsd-ports@FreeBSD.org>; Sat, 2 Mar 2024 23:59:12 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1709420352; bh=yZ1m2fvWZ5Sl0bWOuqG27ylAyrx4eCpTQVA6kxZ8vBQ=; h=Date:To:From:Subject; b=YqEIV8olin2GPrSSCGPX77zGpp3SOckcAIoSiMdF/k84JxxBjsE+SfBE6/KFJYRHJ 388clQMhv8AtChE4eHwjPnPMdtdGMmx/b90XBtfH8DsZYucJxU1i6gmtERwH785FNp NokEQvhBIv1tFZvHu4MqtbM/Szz4uepYdcMEMYcM= Received: from [192.168.145.49] (ip-89-177-27-225.bb.vodafone.cz [89.177.27.225]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by elsa.codelab.cz (Postfix) with ESMTPSA id 3032ED7888 for <freebsd-ports@FreeBSD.org>; Sat, 2 Mar 2024 23:59:11 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=quip.cz; s=private; t=1709420351; bh=yZ1m2fvWZ5Sl0bWOuqG27ylAyrx4eCpTQVA6kxZ8vBQ=; h=Date:To:From:Subject; b=De2UmEAEWBwWxqslkiK7KS8BzRr9I12YlHObZy7YUUT+DAVM2OSAkt1Nl5lBD8czf to6wmcGXt/af+xHnuxCnlAtY5mihkk/+AF3R4OifGD9JQ7+/GjkJuNhD/H9ewh4m5f MzT2udYvaI9Hx5aY+6UOWANIULXQR3oqa0kjsx/8= Message-ID: <47b6ed22-0013-4210-bb23-b3e54814c8dc@quip.cz> Date: Sat, 2 Mar 2024 23:59:10 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird To: freebsd-ports@FreeBSD.org Content-Language: en-US From: Miroslav Lachman <000.fbsd@quip.cz> Subject: Proposal to remove PECL ports from the PEAR category Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.99 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; FORGED_SENDER(0.30)[000.fbsd@quip.cz,SRS0=wRrg=KI=quip.cz=000.fbsd@elsa.codelab.cz]; R_DKIM_ALLOW(-0.20)[quip.cz:s=private]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; R_SPF_NA(0.00)[no SPF record]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; DMARC_NA(0.00)[quip.cz]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:42000, ipnet:94.124.104.0/21, country:CZ]; MID_RHS_MATCH_FROM(0.00)[]; ARC_NA(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@FreeBSD.org]; FROM_NEQ_ENVFROM(0.00)[000.fbsd@quip.cz,SRS0=wRrg=KI=quip.cz=000.fbsd@elsa.codelab.cz]; FROM_HAS_DN(0.00)[]; RCVD_TLS_LAST(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; TO_MATCH_ENVRCPT_ALL(0.00)[]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; DKIM_TRACE(0.00)[quip.cz:+] X-Rspamd-Queue-Id: 4TnL4S1tjlz4mpd Hello, I did a little survey on PHP PECL ports and found that almost half of the PECL ports (27 out of 68) have PEAR listed as the second category. I believe this is a mistake and PECL ports should not be listed in the PEAR category because PECL [1] ports are PHP extensions (wrappers for C libraries), but PEAR [2] ports are libraries written in PHP. Or did I miss something and there is a reasonable reason for PECL ports to be also listed in the PEAR category? These are 27 ports: archivers/pecl-lzf archivers pear archivers/pecl-rar archivers pear databases/pecl-mongodb databases pear databases/pecl-rrd databases pear devel/pecl-dio devel pear devel/pecl-excimer devel pear devel/pecl-expect devel pear devel/pecl-uploadprogress devel pear devel/pecl-uuid devel pear devel/pecl-vld devel pear devel/pecl-xdebug devel pear graphics/pecl-qrencode graphics pear net-im/pecl-stomp2 net-im pear net/pecl-amqp net pear net/pecl-oauth2 net pear net/pecl-radius net security pear net/pecl-rdkafka net pear net/pecl-smbclient net pear net/pecl-xmlrpc net pear security/pecl-krb5 security pear security/pecl-mcrypt security pear security/pecl-pam security pear security/pecl-scrypt security pear security/pecl-ssh2 security pear sysutils/pecl-proctitle sysutils pear textproc/pecl-xdiff2 textproc pear textproc/pecl-yaml textproc pear Should I submit a PR with a patch for all 27 ports? [1] https://pecl.php.net/ [2] https://pear.php.net/ Kind regards Miroslav Lachman From nobody Sat Mar 2 23:06:02 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnLDn22mgz5D7yY for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 23:06:33 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnLDn1X2wz4nvG; Sat, 2 Mar 2024 23:06:33 +0000 (UTC) (envelope-from bofh@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709420793; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=NSPWJt5Oc4EN4jSNRNKxrqp9oSq++RLA5z5jK2jaNIA=; b=uk4dTDaoKETEwWOnUaPA/UWf4xDX4dMByxHgyxUSPxR5OoiGImsqO1F6tPUGw31lsk4fXd pYF7hDNJ5U9PFMlyTS0Z7PRAeRJPJ0K1E2KVjhUNusIf3+X/8EE6jqSmqScNEtz2jcCpef SP5AK+tYqI8Yk9s8uvLbqKr5hazqgx9LcNjgp66h/PNLQpoZkSREeBY1FI9EsRMgPbpQRX ZE5q2kfV59kgJW/VWoNtZ+fgYz93qW8Ij6TC4tgTRXyhyknpRImLhuzROteveyS0HOGWT3 VDGiUp+RwSqNFhh+xM7xK/1vs/lncx9miEhrCjhMbIMa+JNvQuk4WOM43/qVKA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709420793; a=rsa-sha256; cv=none; b=UHALpEzMSKxirkkPs33oVymcoX57kiXaSsiMtuV/GeIvyN6htFTgfxf90Css1zRkXL1JSq 1mq2IakBkVKyG/qdISRyRZOrOZoWdimcERyrCKyz+18cDdgkdV8cth4UP4Mq8aIXyDg/jS nfHuhjVqQPnln6QMCg59+WSBG7eqo7lIaHYSVmm/A9E+LBVdp1z9+NKUvd0WbFd1mvOguD Pz8ujjeefHBfaANS0IzY0d849SBV4LVYYI2E6LwDYPHzzmadgKv97ffWDZH1kcKTOSGdwj H90WsNgRuDyq+sAMaxYy9z7xzsaGVEg+DnvlF8YgyBjoKUKaC5aUuppGliQxuQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709420793; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=NSPWJt5Oc4EN4jSNRNKxrqp9oSq++RLA5z5jK2jaNIA=; b=IsEpjP0XTeaWLZFF/wVSfdfJd2VV04fhDrXqttUhE5RqM77UbHDVAnYrZzeJWrCTL94T6x dKmCrAnERL4g4SfsML8hWD1+ozfxoWOnPibAmgLYhP7HLysN8Dj6p+JHamw21fohlH5wMA euGCyYoYcDwAQIJf/u+TrKj8YZRaOrDHpslgNsE53ZSYO/Ube4sLr4Pd5rVSYqIaXhYZnX 4ZUSruKCbKDNN8Pe6xBK48Zvgu9XHyXwYjzoTzSm/8bDv8DYZPe+ZEn/o4J6DPIfjO2Jpn hFBYs53xxIqhWHNqYP5IBPVB9UlG75zhdImUUsx2mu11QMGn6gxETukPSBhG3g== Received: from mx.bofh.network (mx.bofh.network [5.9.249.227]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: bofh/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TnLDm5lfwzZ9p; Sat, 2 Mar 2024 23:06:32 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtpclient.apple (<unknown> [217.117.226.147]) by mx.bofh.network (OpenSMTPD) with ESMTPSA id 0c9d9a7f (TLSv1.2:ECDHE-ECDSA-AES256-GCM-SHA384:256:NO); Sat, 2 Mar 2024 23:06:30 +0000 (UTC) Content-Type: multipart/signed; boundary="Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1"; protocol="application/pgp-signature"; micalg=pgp-sha512 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.700.6.1.1\)) Subject: Re: Proposal to remove PECL ports from the PEAR category From: Moin Rahman <bofh@freebsd.org> In-Reply-To: <47b6ed22-0013-4210-bb23-b3e54814c8dc@quip.cz> Date: Sun, 3 Mar 2024 00:06:02 +0100 Cc: "freebsd-ports@freebsd.org" <freebsd-ports@FreeBSD.org> Message-Id: <1B032656-64BF-44E1-9A43-5192806A7E82@freebsd.org> References: <47b6ed22-0013-4210-bb23-b3e54814c8dc@quip.cz> To: Miroslav Lachman <000.fbsd@quip.cz> X-Mailer: Apple Mail (2.3731.700.6.1.1) --Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=us-ascii > On Mar 2, 2024, at 11:59 PM, Miroslav Lachman <000.fbsd@quip.cz> = wrote: >=20 > Hello, >=20 > I did a little survey on PHP PECL ports and found that almost half of = the PECL ports (27 out of 68) have PEAR listed as the second category. I = believe this is a mistake and PECL ports should not be listed in the = PEAR category because PECL [1] ports are PHP extensions (wrappers for C = libraries), but PEAR [2] ports are libraries written in PHP. >=20 > Or did I miss something and there is a reasonable reason for PECL = ports to be also listed in the PEAR category? >=20 > These are 27 ports: >=20 > archivers/pecl-lzf archivers pear > archivers/pecl-rar archivers pear > databases/pecl-mongodb databases pear > databases/pecl-rrd databases pear > devel/pecl-dio devel pear > devel/pecl-excimer devel pear > devel/pecl-expect devel pear > devel/pecl-uploadprogress devel pear > devel/pecl-uuid devel pear > devel/pecl-vld devel pear > devel/pecl-xdebug devel pear > graphics/pecl-qrencode graphics pear > net-im/pecl-stomp2 net-im pear > net/pecl-amqp net pear > net/pecl-oauth2 net pear > net/pecl-radius net security pear > net/pecl-rdkafka net pear > net/pecl-smbclient net pear > net/pecl-xmlrpc net pear > security/pecl-krb5 security pear > security/pecl-mcrypt security pear > security/pecl-pam security pear > security/pecl-scrypt security pear > security/pecl-ssh2 security pear > sysutils/pecl-proctitle sysutils pear > textproc/pecl-xdiff2 textproc pear > textproc/pecl-yaml textproc pear >=20 > Should I submit a PR with a patch for all 27 ports? >=20 > [1] https://pecl.php.net/ > [2] https://pear.php.net/ >=20 > Kind regards > Miroslav Lachman >=20 As the maintainer of php I do agree with this. The only problem is other maintainers of some of the ports do not. There was a discussion on this long time(php5) ago which did not see any fruitful result. You can create a review instead in phabricator and add the maintainers and retry again. Kind regards, Moin --Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1 Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=signature.asc Content-Type: application/pgp-signature; name=signature.asc Content-Description: Message signed with OpenPGP -----BEGIN PGP SIGNATURE----- iQKTBAEBCgB9FiEETfdREoUGjQZKBS+fvbm1phfAvJEFAmXjsNpfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldDRE Rjc1MTEyODUwNjhEMDY0QTA1MkY5RkJEQjlCNUE2MTdDMEJDOTEACgkQvbm1phfA vJH15w//eryFkaIgbFO37trUK1L+MKyGTzF6z1teci8RAKM6R8z18Zan/1OGEQ15 hXGrSm8lND+YOQyusJSpJZB1NDDykKPO9SfD3pgnOTgUzh387f68/eRrXaMyB/FG XgKnFU9riFKXGEpGDT/yqWTrJ+JWQG183S0rn2TukUMg1RevnKEETkrGpAw0dsuO IeSjXRkVmK5FspdyxBsF8ldJ4D+EUOZttg2f8VxzffJGZH7zhUsqH+3jx12jGbt5 DyKYk3FHI/N5vZTwhbjL25I0iRVq30qzEQbzx1JXDQwSCmeZlUzA9dDjG4ca9eeg ixj1B7v2uZu6J+RHs7xlym0ngQg9EvPBpneV9whlYFxrr+YNopc/BwpuJteC5Z0n CeJdqnaUo1pOOYUk9zEVD/Lncewz/SwUoIXod1+O/HyXOoLp4yI/ozhy/QYtb2gV 4CwH0WZZrGb1wifwXbNsY87a5HcP/w6Amgm3xP8g379hxDV362J1oCXzOlRtfXmN wNWusqP9XDIvr9xtvoSpluZ/fFIwg3E+bvAMIoRi4sGa62Zx1ozzIUMsWGGsr+F1 0RbS884rcXGBVcGxkCYFM0vqoXw7ZFrgRXrAHKTArtudYhxuT2u89urvTM7nRQuH RfX6txwkhpVSygZddhovTb846fe6fG8lZ66y09xdayInHodtzHU= =4rlY -----END PGP SIGNATURE----- --Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1-- From nobody Sat Mar 2 23:06:02 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnLDn6ctkz5D7lR for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sat, 2 Mar 2024 23:06:33 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnLDn4xbTz4nsH; Sat, 2 Mar 2024 23:06:33 +0000 (UTC) (envelope-from bofh@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709420793; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=NSPWJt5Oc4EN4jSNRNKxrqp9oSq++RLA5z5jK2jaNIA=; b=uk4dTDaoKETEwWOnUaPA/UWf4xDX4dMByxHgyxUSPxR5OoiGImsqO1F6tPUGw31lsk4fXd pYF7hDNJ5U9PFMlyTS0Z7PRAeRJPJ0K1E2KVjhUNusIf3+X/8EE6jqSmqScNEtz2jcCpef SP5AK+tYqI8Yk9s8uvLbqKr5hazqgx9LcNjgp66h/PNLQpoZkSREeBY1FI9EsRMgPbpQRX ZE5q2kfV59kgJW/VWoNtZ+fgYz93qW8Ij6TC4tgTRXyhyknpRImLhuzROteveyS0HOGWT3 VDGiUp+RwSqNFhh+xM7xK/1vs/lncx9miEhrCjhMbIMa+JNvQuk4WOM43/qVKA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709420793; a=rsa-sha256; cv=none; b=UHALpEzMSKxirkkPs33oVymcoX57kiXaSsiMtuV/GeIvyN6htFTgfxf90Css1zRkXL1JSq 1mq2IakBkVKyG/qdISRyRZOrOZoWdimcERyrCKyz+18cDdgkdV8cth4UP4Mq8aIXyDg/jS nfHuhjVqQPnln6QMCg59+WSBG7eqo7lIaHYSVmm/A9E+LBVdp1z9+NKUvd0WbFd1mvOguD Pz8ujjeefHBfaANS0IzY0d849SBV4LVYYI2E6LwDYPHzzmadgKv97ffWDZH1kcKTOSGdwj H90WsNgRuDyq+sAMaxYy9z7xzsaGVEg+DnvlF8YgyBjoKUKaC5aUuppGliQxuQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709420793; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=NSPWJt5Oc4EN4jSNRNKxrqp9oSq++RLA5z5jK2jaNIA=; b=IsEpjP0XTeaWLZFF/wVSfdfJd2VV04fhDrXqttUhE5RqM77UbHDVAnYrZzeJWrCTL94T6x dKmCrAnERL4g4SfsML8hWD1+ozfxoWOnPibAmgLYhP7HLysN8Dj6p+JHamw21fohlH5wMA euGCyYoYcDwAQIJf/u+TrKj8YZRaOrDHpslgNsE53ZSYO/Ube4sLr4Pd5rVSYqIaXhYZnX 4ZUSruKCbKDNN8Pe6xBK48Zvgu9XHyXwYjzoTzSm/8bDv8DYZPe+ZEn/o4J6DPIfjO2Jpn hFBYs53xxIqhWHNqYP5IBPVB9UlG75zhdImUUsx2mu11QMGn6gxETukPSBhG3g== Received: from mx.bofh.network (mx.bofh.network [5.9.249.227]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: bofh/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TnLDn2BWPzZwr; Sat, 2 Mar 2024 23:06:33 +0000 (UTC) (envelope-from bofh@freebsd.org) Received: from smtpclient.apple (<unknown> [217.117.226.147]) by mx.bofh.network (OpenSMTPD) with ESMTPSA id dd429383 (TLSv1.2:ECDHE-ECDSA-AES256-GCM-SHA384:256:NO); Sat, 2 Mar 2024 23:06:30 +0000 (UTC) Content-Type: multipart/signed; boundary="Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1"; protocol="application/pgp-signature"; micalg=pgp-sha512 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3731.700.6.1.1\)) Subject: Re: Proposal to remove PECL ports from the PEAR category From: Moin Rahman <bofh@freebsd.org> In-Reply-To: <47b6ed22-0013-4210-bb23-b3e54814c8dc@quip.cz> Date: Sun, 3 Mar 2024 00:06:02 +0100 Cc: "freebsd-ports@freebsd.org" <freebsd-ports@FreeBSD.org> Message-Id: <1B032656-64BF-44E1-9A43-5192806A7E82@freebsd.org> References: <47b6ed22-0013-4210-bb23-b3e54814c8dc@quip.cz> To: Miroslav Lachman <000.fbsd@quip.cz> X-Mailer: Apple Mail (2.3731.700.6.1.1) --Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=us-ascii > On Mar 2, 2024, at 11:59 PM, Miroslav Lachman <000.fbsd@quip.cz> = wrote: >=20 > Hello, >=20 > I did a little survey on PHP PECL ports and found that almost half of = the PECL ports (27 out of 68) have PEAR listed as the second category. I = believe this is a mistake and PECL ports should not be listed in the = PEAR category because PECL [1] ports are PHP extensions (wrappers for C = libraries), but PEAR [2] ports are libraries written in PHP. >=20 > Or did I miss something and there is a reasonable reason for PECL = ports to be also listed in the PEAR category? >=20 > These are 27 ports: >=20 > archivers/pecl-lzf archivers pear > archivers/pecl-rar archivers pear > databases/pecl-mongodb databases pear > databases/pecl-rrd databases pear > devel/pecl-dio devel pear > devel/pecl-excimer devel pear > devel/pecl-expect devel pear > devel/pecl-uploadprogress devel pear > devel/pecl-uuid devel pear > devel/pecl-vld devel pear > devel/pecl-xdebug devel pear > graphics/pecl-qrencode graphics pear > net-im/pecl-stomp2 net-im pear > net/pecl-amqp net pear > net/pecl-oauth2 net pear > net/pecl-radius net security pear > net/pecl-rdkafka net pear > net/pecl-smbclient net pear > net/pecl-xmlrpc net pear > security/pecl-krb5 security pear > security/pecl-mcrypt security pear > security/pecl-pam security pear > security/pecl-scrypt security pear > security/pecl-ssh2 security pear > sysutils/pecl-proctitle sysutils pear > textproc/pecl-xdiff2 textproc pear > textproc/pecl-yaml textproc pear >=20 > Should I submit a PR with a patch for all 27 ports? >=20 > [1] https://pecl.php.net/ > [2] https://pear.php.net/ >=20 > Kind regards > Miroslav Lachman >=20 As the maintainer of php I do agree with this. The only problem is other maintainers of some of the ports do not. There was a discussion on this long time(php5) ago which did not see any fruitful result. You can create a review instead in phabricator and add the maintainers and retry again. Kind regards, Moin --Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1 Content-Transfer-Encoding: 7bit Content-Disposition: attachment; filename=signature.asc Content-Type: application/pgp-signature; name=signature.asc Content-Description: Message signed with OpenPGP -----BEGIN PGP SIGNATURE----- iQKTBAEBCgB9FiEETfdREoUGjQZKBS+fvbm1phfAvJEFAmXjsNpfFIAAAAAALgAo aXNzdWVyLWZwckBub3RhdGlvbnMub3BlbnBncC5maWZ0aGhvcnNlbWFuLm5ldDRE Rjc1MTEyODUwNjhEMDY0QTA1MkY5RkJEQjlCNUE2MTdDMEJDOTEACgkQvbm1phfA vJH15w//eryFkaIgbFO37trUK1L+MKyGTzF6z1teci8RAKM6R8z18Zan/1OGEQ15 hXGrSm8lND+YOQyusJSpJZB1NDDykKPO9SfD3pgnOTgUzh387f68/eRrXaMyB/FG XgKnFU9riFKXGEpGDT/yqWTrJ+JWQG183S0rn2TukUMg1RevnKEETkrGpAw0dsuO IeSjXRkVmK5FspdyxBsF8ldJ4D+EUOZttg2f8VxzffJGZH7zhUsqH+3jx12jGbt5 DyKYk3FHI/N5vZTwhbjL25I0iRVq30qzEQbzx1JXDQwSCmeZlUzA9dDjG4ca9eeg ixj1B7v2uZu6J+RHs7xlym0ngQg9EvPBpneV9whlYFxrr+YNopc/BwpuJteC5Z0n CeJdqnaUo1pOOYUk9zEVD/Lncewz/SwUoIXod1+O/HyXOoLp4yI/ozhy/QYtb2gV 4CwH0WZZrGb1wifwXbNsY87a5HcP/w6Amgm3xP8g379hxDV362J1oCXzOlRtfXmN wNWusqP9XDIvr9xtvoSpluZ/fFIwg3E+bvAMIoRi4sGa62Zx1ozzIUMsWGGsr+F1 0RbS884rcXGBVcGxkCYFM0vqoXw7ZFrgRXrAHKTArtudYhxuT2u89urvTM7nRQuH RfX6txwkhpVSygZddhovTb846fe6fG8lZ66y09xdayInHodtzHU= =4rlY -----END PGP SIGNATURE----- --Apple-Mail=_2C482CE7-EA37-4FB6-9842-3EEE64A960D1-- From nobody Sun Mar 3 01:22:45 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnPG11L9Hz5DL8y for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 01:22:49 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-wm1-x32a.google.com (mail-wm1-x32a.google.com [IPv6:2a00:1450:4864:20::32a]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnPG06Cjdz50Vc for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 01:22:48 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-wm1-x32a.google.com with SMTP id 5b1f17b1804b1-412d691c4cdso3149295e9.1 for <freebsd-ports@freebsd.org>; Sat, 02 Mar 2024 17:22:48 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709428965; x=1710033765; darn=freebsd.org; h=in-reply-to:from:content-language:references:cc:to:subject :user-agent:mime-version:date:message-id:from:to:cc:subject:date :message-id:reply-to; bh=RmQLMUMgi0wu+eNFnMrvPP0gdSaC8hAGmFWFojL6luM=; b=D0aqlXkwQN32TgmU/EMR5/HCuXgJb22YaLJZ7BqLamyo4S4RavNxz+OSrrEdHi9/U9 wEpqKIOnBIyRLOwPrR5KHRw1hbuVAeeZB51cTdAxcMcJOO7dzaaRnLcgcF/Weqfa1dCz ZhuNgBhXWc+612ADfp/0f9vlmXr+yqVshEH+IoT/ZcFK67Hln+VixL0oqWnbmuN1Y3iZ NbOfVJ+vVnoz0C6I4u6aAxiQOkaPq4zcOXIgjd05MlMSsI90k8wN1mr5IIe4uealV6/V RfBOKpwLTsx9qdlh38kU80BIyMrKTBqBw9qaGGlhg2dSxR6/jK5vgVhhFs+ycWsKt+Y0 BK6w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709428965; x=1710033765; h=in-reply-to:from:content-language:references:cc:to:subject :user-agent:mime-version:date:message-id:x-gm-message-state:from:to :cc:subject:date:message-id:reply-to; bh=RmQLMUMgi0wu+eNFnMrvPP0gdSaC8hAGmFWFojL6luM=; b=exnfZqJ6pYxMCbh9iGXWddJmLPZygd2d4HysyrQGE4XrZgqMloxbaax9GTeu4BCUF2 WvzfEc0mkRAOKH32SWHEMSBv1pkVzBtBjv2AyWjg8HAOlqrcT4x2oVjN3YwQbFIcSAwS pRv6lkgdvERWECrterYA/O9MG4j0OzBKXlSURY3eJrBEQkaXzzRlJgvzFo9VOeqG7h3i mH9ZP58UBqAv/sl9E5Sa/X05VjufpcNny1BJ2BrVTfbZ1Um8+gLDxhYT2XXJ2q6F8YO2 TyCB3ub8bQBgDUNhBHK1Q+5+O+2BKOGQe5O4/PN8EzRHwgej48LLBMtm4NVdbhfGEOAv 5BUA== X-Gm-Message-State: AOJu0Yx6+3gPBq7Uv4QRgx969EU5kRbz4yYVi5mfkE9wnH8/7QCfpWEI fCiHnXuUwgtKpDvtkbX0Am7c8jZzHTtYwYnr0rB//0KbgMWfgQ+w X-Google-Smtp-Source: AGHT+IH3IsEMaNJxGYOuoptHQzcIHbVRXys6ZG2kXWY7BDWwYip+4V6Mu3DkcMrfBH/SJR42Q+gKZw== X-Received: by 2002:a05:600c:4447:b0:412:dcf4:143c with SMTP id v7-20020a05600c444700b00412dcf4143cmr465411wmn.13.1709428965236; Sat, 02 Mar 2024 17:22:45 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:12d:1878:26dd:4881? ([2a01:e0a:80d:9d80:12d:1878:26dd:4881]) by smtp.gmail.com with ESMTPSA id i4-20020a05600c354400b004101f27737asm13428835wmq.29.2024.03.02.17.22.44 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sat, 02 Mar 2024 17:22:44 -0800 (PST) Content-Type: multipart/alternative; boundary="------------hv1zm9TpwJZZM9ePee3imeC0" Message-ID: <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> Date: Sun, 3 Mar 2024 02:22:45 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Port tree linter To: Alexander Leidinger <Alexander@Leidinger.net> Cc: freebsd-ports@freebsd.org References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> Content-Language: fr From: Hubert Tournier <hubert.tournier@gmail.com> In-Reply-To: <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; TAGGED_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Rspamd-Queue-Id: 4TnPG06Cjdz50Vc This is a multi-part message in MIME format. --------------hv1zm9TpwJZZM9ePee3imeC0 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit Le 02/03/2024 à 18:22, Alexander Leidinger a écrit : > > Am 2024-03-02 09:24, schrieb Hubert Tournier: > >> Now that this tool is a Python package, it's easier to use other >> Python libraries. >> > Maybe a check for ports which could be flavourized? Most PHP and > python packages could be flavourized. The issue may be false positives... > > PHP examples are baikal and tt-rss (for both I have patches, waiting a > bit before declaring maintainer timeout). > Unless there is a way to deduce that from a port's Makefile, I do not see how to implement it? For example, taking Python packages, it would require downloading the distfiles, analyzing their content (for example, sections [options.extras_require] in setup.cfg), and looking if there are corresponding port flavours (assuming they have been named similarly). But downloading all ports distfiles would be very long and would consume a lot of disk space (with a possible Denial of Service risk, should a file system be saturated!). If there's another simpler way, I would be happy to know about it. Best regards, Hubert --------------hv1zm9TpwJZZM9ePee3imeC0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 8bit <!DOCTYPE html> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> </head> <body> <div class="moz-cite-prefix">Le 02/03/2024 à 18:22, Alexander Leidinger a écrit :<br> </div> <blockquote type="cite" cite="mid:c0fe4a0083554b11559b83fa64b591d2@Leidinger.net"> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> <p id="reply-intro">Am 2024-03-02 09:24, schrieb Hubert Tournier: </p> <blockquote type="cite" style="padding: 0 0.4em; border-left: #1010ff 2px solid; margin: 0"> <div id="replybody1"> <div> <p>Now that this tool is a Python package, it's easier to use other Python libraries.</p> </div> </div> </blockquote> <p>Maybe a check for ports which could be flavourized? Most PHP and python packages could be flavourized. The issue may be false positives...</p> <p>PHP examples are baikal and tt-rss (for both I have patches, waiting a bit before declaring maintainer timeout).</p> </blockquote> <p>Unless there is a way to deduce that from a port's Makefile, I do not see how to implement it?<br> </p> <p>For example, taking Python packages, it would require downloading the distfiles, analyzing their content (for example, sections [options.extras_require] in setup.cfg), and looking if there are corresponding port flavours (assuming they have been named similarly).</p> <p>But downloading all ports distfiles would be very long and would consume a lot of disk space (with a possible Denial of Service risk, should a file system be saturated!).</p> <p>If there's another simpler way, I would be happy to know about it.<br> </p> <p>Best regards,</p> <p>Hubert<br> </p> <p><br> </p> </body> </html> --------------hv1zm9TpwJZZM9ePee3imeC0-- From nobody Sun Mar 3 01:48:09 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnPqH4sGkz5DMgJ for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 01:48:11 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-wr1-x433.google.com (mail-wr1-x433.google.com [IPv6:2a00:1450:4864:20::433]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnPqG5cjLz52vQ for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 01:48:10 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=VIYwg0y1; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of hubert.tournier@gmail.com designates 2a00:1450:4864:20::433 as permitted sender) smtp.mailfrom=hubert.tournier@gmail.com Received: by mail-wr1-x433.google.com with SMTP id ffacd0b85a97d-33d36736d4eso2061034f8f.1 for <freebsd-ports@freebsd.org>; Sat, 02 Mar 2024 17:48:10 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709430489; x=1710035289; darn=freebsd.org; h=subject:from:cc:to:content-language:user-agent:mime-version:date :message-id:from:to:cc:subject:date:message-id:reply-to; bh=NamfPG35UWwfTtstqzvLgZQAXLpQ4MOaUI6oeOvsWzo=; b=VIYwg0y1JsypE7TnYDdsSsRk8nZdpZc37gevDw8Cq7ZGLbPwxBWxteR7zhap/EnoHE Y+pUzYxzHz2a5KPMVrbBi3WXu2kTgvHZo/D3UWUhJ9LQA5sJ+5aMBXsONJaBkhQDmOGe xSBbv9SerpM2sEMMGKT/nO7bvxwwvv31qq4FgWAU8Y189YKKLMb6SRC+J5UYlK+kGTXL K889SUAX3oGRR0x192QBviuT2pIKMgjLAKS7Lm4k3HWngRMQVgsbfTXGWxnmsyDvXHDF xzDB3eBOzgNpxk5YP7BUMAzdK7aZ9A5CX47iPUgYM6PmPtHlCdOjVyJjcnStWURP4fka ftEw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709430489; x=1710035289; h=subject:from:cc:to:content-language:user-agent:mime-version:date :message-id:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=NamfPG35UWwfTtstqzvLgZQAXLpQ4MOaUI6oeOvsWzo=; b=UEVH5ZeJT8TndnCIU2fbglu4BsIuyeIlYhdGhNy8m3EjgvxL9O1dEgZLGsoftM6BXi LrFpnF5MdwPCQ6cMHI4ZxtsFz3x+39faSXrtex+Woev3bkzPa0NLM7a99ufhNmXBzLhf imNVHBy4RCkmW3E5e20X+OIV/noRG8SWPvQ6NzhBk9x65dVhO7ynt+zRyaPOMs/+eCxk Kdg1GXl/lGKCjlXGexuU8N1yRH9nMWndxgPiNjSBm9HQz2tC4W6YvwkQZ4Evjew0kXQi Fc7E+LiAczMqhLgxxUoOlG19KHxiGmzzs0J2HneaUk/Mhl94LKBQAevkXhfXyri39MRA 6VYw== X-Gm-Message-State: AOJu0YwMMgWIcSo/cot6AEm36CE6sXrXRtkQSqIzg2KSJS1ZHcqwheMp dLivt+SQd6K2M2lO+GVQzXv5vEw60AOgf/j4W1l8CDSnRkl35rTYx0vSfsyw/q4= X-Google-Smtp-Source: AGHT+IHNUg9o/KW6vcXj41HG0BKlQgJuWQBW9Il8HqxGDeKlwQW27iXZWJBnFvM0XXPRf/KP0OgMCA== X-Received: by 2002:adf:e9d1:0:b0:33d:c6dd:b4b2 with SMTP id l17-20020adfe9d1000000b0033dc6ddb4b2mr3870085wrn.54.1709430488837; Sat, 02 Mar 2024 17:48:08 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:12d:1878:26dd:4881? ([2a01:e0a:80d:9d80:12d:1878:26dd:4881]) by smtp.gmail.com with ESMTPSA id l9-20020a056000022900b0033cf2063052sm8413947wrz.111.2024.03.02.17.48.08 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sat, 02 Mar 2024 17:48:08 -0800 (PST) Content-Type: multipart/alternative; boundary="------------6SepmZHSLXbozTyNjxsHDyqj" Message-ID: <c8f5b343-98d4-4122-87f5-016dfd69a409@gmail.com> Date: Sun, 3 Mar 2024 02:48:09 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Content-Language: fr To: Xin LI <delphij@gmail.com> Cc: freebsd-ports@FreeBSD.org From: Hubert Tournier <hubert.tournier@gmail.com> Subject: Re: Proposed ports deprecation and removal policy X-Spamd-Bar: / X-Spamd-Result: default: False [-0.50 / 15.00]; THREAD_HIJACKING_FROM_INJECTOR(2.00)[]; FAKE_REPLY(1.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.51)[-0.507]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; XM_UA_NO_VERSION(0.01)[]; FREEMAIL_TO(0.00)[gmail.com]; RCPT_COUNT_TWO(0.00)[2]; FROM_HAS_DN(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; ARC_NA(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_SOME(0.00)[]; RCVD_TLS_LAST(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::433:from]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; TAGGED_FROM(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim] X-Rspamd-Queue-Id: 4TnPqG5cjLz52vQ This is a multi-part message in MIME format. --------------6SepmZHSLXbozTyNjxsHDyqj Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit On Thu, 29 Feb 2024 19:26:23 UTC, Xin LI wrote: > For example, one of my port gets marked as DEPRECATED because a dependency > was deprecated and scheduled for removal after 1 month, without any email > telling me so (the port doesn't have a lot of releases and there isn't any > release during that "parole" month), and it gets removed after that. So in > order to know there is an ongoing deprecation of the port, I as a port > maintainer would have to either watch the directory for any changes, or > read all ports-git commit messages or at least a filtered version of it, > and that's burdensome and inefficient use of developer time at best. > What I would love to see happen is that, when a port gets marked as > DEPRECATED, there is an automated system that sends me notification with > something like: > ACTION REQUESTED: X new ports you maintain is marked as DEPRECATED [...] > and that email gets sent every 7 days until the port is removed or the > issue is fixed. Or a bug is created and assigned to the maintainer, etc. Alternately, you could just create a periodic batch on your own machine to do that check on the ports you maintain. The tool I mentioned in the neighboring "Port tree linter" thread can do that for you with the following command: $ portstreelint -hu -mdelphij@freebsd.org 2> /dev/null It would check BROKEN, FORBIDDEN, IGNORE (poorly) and DEPRECATED marks, as well as vulnerabilities reported in VuXML (in the version I will upload tomorrow) and many other things, automatically on your 31 ports. Best regards, Hubert --------------6SepmZHSLXbozTyNjxsHDyqj Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit <!DOCTYPE html> <html> <head> <meta http-equiv="content-type" content="text/html; charset=UTF-8"> </head> <body> <pre class="main">On Thu, 29 Feb 2024 19:26:23 UTC, Xin LI wrote: > For example, one of my port gets marked as DEPRECATED because a dependency > was deprecated and scheduled for removal after 1 month, without any email > telling me so (the port doesn't have a lot of releases and there isn't any > release during that "parole" month), and it gets removed after that. So in > order to know there is an ongoing deprecation of the port, I as a port > maintainer would have to either watch the directory for any changes, or > read all ports-git commit messages or at least a filtered version of it, > and that's burdensome and inefficient use of developer time at best. > What I would love to see happen is that, when a port gets marked as > DEPRECATED, there is an automated system that sends me notification with > something like: > ACTION REQUESTED: X new ports you maintain is marked as DEPRECATED [...] > and that email gets sent every 7 days until the port is removed or the > issue is fixed. Or a bug is created and assigned to the maintainer, etc. Alternately, you could just create a periodic batch on your own machine to do that check on the ports you maintain. The tool I mentioned in the neighboring "Port tree linter" thread can do that for you with the following command: $ portstreelint -hu -m <a class="moz-txt-link-abbreviated" href="mailto:delphij@freebsd.org">delphij@freebsd.org</a> 2> /dev/null It would check BROKEN, FORBIDDEN, IGNORE (poorly) and DEPRECATED marks, as well as vulnerabilities reported in VuXML (in the version I will upload tomorrow) and many other things, automatically on your 31 ports. Best regards, Hubert </pre> <p></p> </body> </html> --------------6SepmZHSLXbozTyNjxsHDyqj-- From nobody Sun Mar 3 04:08:53 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnSxd6wpDz5Brcn for <ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 04:08:53 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnSxd20hnz40ws for <ports@freebsd.org>; Sun, 3 Mar 2024 04:08:53 +0000 (UTC) (envelope-from portscout@FreeBSD.org) ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709438933; a=rsa-sha256; cv=none; b=EbacfcT1yILMMtHnU5cENwOtYM5Yyk9o9PaDQjPrY0JzwtutDNBCRnNVvMoGCdbkh/vEud gqC96LpNw3jJ+Ktmkr/SWsK9IBzJzC8mIWPaIsxDjBMl/4BU5wb2tcW5HlLeyTLrxyxC/E qo4U0SZzZmQPPJ3YlOujBR/lut6fbwQt4uCMk8VfgDFe7+Exi2rgN+r4DPlrUf5B5fh+yj 4Lt48V5W937HUVgrjVPIK+CbvebHZ1E+PAu3MV9gWbjhQrsoUtoEwB9r2rlG2dk3FYo03e 66tkQuU5ZpMrghnx7togBxn0gEiKEjuBgl8ts1eobtpeViTh+ELyM2Hei2n18w== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709438933; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding; bh=e3ul3Z5D9EtCu0hgITsrvY2JP/Se+KQln4D1s4c5Egg=; b=MQOdRmlrtNNCbCUjJ9satvgM96+SH0JYVkTyCWc1U78KgT3YkGjev87l5wQCocxi5XSrZQ 3WNNDyxLYIstR4h3+8MOxg0YFg7iibYU1+YQUK7GLUfr/pQ8uF7qkuV398R6hU5VmNQN9o BW7q31rVNKUw/6oXMCQ6Ws10EUkIyOYsA9DzuorXcQFoZLXojD3sqSfKtj8UBK3a1W8063 KZ82ioV9yTQ5UmMeqO5euLelBh881dZHtjn31wtdZveiqA7Jh7F1u+XM7TC/GrmfQjD9dH ABzBBS2QJq+dhK0V0AVIUxVUgx01ZhGXf2wmfTXIfb1EuoaqLwPARHrtLjJteQ== Received: from portscout.nyi.freebsd.org (portscout.nyi.freebsd.org [IPv6:2610:1c1:1:606c::50:21]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4TnSxd1c2YzNT0 for <ports@freebsd.org>; Sun, 3 Mar 2024 04:08:53 +0000 (UTC) (envelope-from portscout@FreeBSD.org) Received: from portscout.nyi.freebsd.org ([127.0.1.10]) by portscout.nyi.freebsd.org (8.17.1/8.17.1) with ESMTP id 42348r1c070319 for <ports@freebsd.org>; Sun, 3 Mar 2024 04:08:53 GMT (envelope-from portscout@FreeBSD.org) Received: (from portscout@localhost) by portscout.nyi.freebsd.org (8.17.1/8.17.1/Submit) id 42348rjA070318; Sun, 3 Mar 2024 04:08:53 GMT (envelope-from portscout@FreeBSD.org) Message-Id: <202403030408.42348rjA070318@portscout.nyi.freebsd.org> X-Authentication-Warning: portscout.nyi.freebsd.org: portscout set sender to portscout@FreeBSD.org using -f Content-Disposition: inline Content-Transfer-Encoding: 8bit Content-Type: text/plain List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Date: Sun, 3 Mar 2024 04:08:53 +0000 From: portscout@FreeBSD.org To: ports@freebsd.org Subject: Unmaintained FreeBSD ports which are out of date X-Mailer: portscout/0.8.1 Dear port maintainers, The portscout new distfile checker has detected that one or more unmaintained ports appears to be out of date. Please take the opportunity to check each of the ports listed below, and if possible and appropriate, submit/commit an update. Please consider also adopting this port. If any ports have already been updated, you can safely ignore the entry. An e-mail will not be sent again for any of the port/version combinations below. Full details can be found at the following URL: http://portscout.freebsd.org/ports@freebsd.org.html Port | Current version | New version ------------------------------------------------+-----------------+------------ cad/ifcopenshell | 0.6.0 | blenderbim-240303 ------------------------------------------------+-----------------+------------ If any of the above results are invalid, please check the following page for details on how to improve portscout's detection and selection of distfiles on a per-port basis: http://portscout.freebsd.org/info/portscout-portconfig.txt Reported by: portscout! From nobody Sun Mar 3 08:22:58 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnZb14q8lz5CHgh for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 08:23:09 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnZb148h2z4Njb for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 08:23:09 +0000 (UTC) (envelope-from eduardo@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709454189; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=ruOOmPXgo846tKgsdNhqmjGaQqpiprf3OvhDIrZ3LFg=; b=DI3iFdaTD9bXT5vczG1QtDokPtM/AhhKqg/Bd6VM/dMfIWqqENyGP7ArlkloNOhZlbim/w sSLqYl6Hqr7tpiATH1gGz7g2+Cl6Rj4jKOF8lkD+sA0ydq/bFrqDH3yQazxweytDhtCQyj P7PLhGJgppbrk22uZEnQhuAgv8wmFF+JntYoIgK8rfTTddvlJI6wskimep2IacYLa2EqDi u6sa1CKOTgCkrMZZRbrC5qPKydC/f1cpMdgU+zNCsJ111jFGieAPeBxeC80HOIOWnpYYcV gbDJ8w4LDuYX3PpqqB+BL8mrMQRkjVtI/Xk+BjgpgQES60RJSmVGL73ETQWLjg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709454189; a=rsa-sha256; cv=none; b=DlMyhsrsvr6d++IjZGMH3IR53eEndCm6+3ZJtvqKhgkupBfDtPP4sUhvyUyIhGBLjaRvRK wK/sxwSOIF3RL3dS2x8G55Ccj/kiEWu5Rsuvo38azf0hiMLZe4YyAcipjl0uowSgkM2UX0 NkWD00Q8cIGuvBmEbgbzEvXpTBN4fyhTBcdAc4DkBNz8DpcVddkUCnWpPfVWng2uFKlTUd BBO6Qt3SZsSsFzXVR9B/iFIuhPS3zdrRQsbsdcRx98o/j6M/1xPrrmUmZZRN/xGIOCv0DI Hl0ucKsqLU986Bmmf7YaeRZjPa+1BwrVoPrMVBzH1uUZdbQbHlKHmhCKep8vpQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709454189; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=ruOOmPXgo846tKgsdNhqmjGaQqpiprf3OvhDIrZ3LFg=; b=nJ4Cww+pY0iroybEMRkx0g4HptVBMybUgImK4Jhppo/Nez+uBSqg8KSIaWDbf9zvMz4j2i 9HmTzNHIUQBriptiwUfBplrUAShuuv4rrEqoFEgN3BxsLXhHxf74somxvsEuePDjF6y+9j ADIWEindBKkeGd31P4miS36vKf2RRbXhtmWBnsi1zngIUT7v6ATf7ageRWq1v9sP3B7JM/ cVo1yBssnKg3G/PRro7Jic13NeLKZyRSi5ANbwLo5GG+jU1DShxUXQd8VDh6uUcUU6OFmo EYWqnlH5bvTm/JqKdpSwx8W0nARN55ABNaGp9VK6WkewhXZqJQjaYEMQmi5g6w== Received: from mail-qt1-f170.google.com (mail-qt1-f170.google.com [209.85.160.170]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) (Authenticated sender: eduardo) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TnZb13f4cz12Pq for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 08:23:09 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: by mail-qt1-f170.google.com with SMTP id d75a77b69052e-42e5e16559cso25073611cf.0 for <freebsd-ports@freebsd.org>; Sun, 03 Mar 2024 00:23:09 -0800 (PST) X-Forwarded-Encrypted: i=1; AJvYcCXOw6p2Zm37AnTlNOaunMAsH7MSpw/jAHHQaMY/MOhh35ACEjTlCxLaqyw828z5VmVTYznTeaoiO6xBIb+ZGjiVwpUv4WIT4sGO X-Gm-Message-State: AOJu0YwoRwMdYbGefJJGefEHdlZ163AnAj/16QytoPMWtV86mFdRH6gf SyRij2Rxum8L1m1sldo6YYoVWx3f1Itw5Sy5BhzN9NvbBYgySIznNqjh4Oh6aFYnuKGZnAPjLnN 0czYtBLYxojn+TLeUm86xkgsMGrQ= X-Google-Smtp-Source: AGHT+IG3hzuwBKqlSalQ+BaseY51SzEO1HlDwXNJctRGHAi0F4zH1kR1Fx2wDAiWG4W99i2eVyQkauMZHu/ncZkTvjU= X-Received: by 2002:a05:622a:1210:b0:42e:701a:ceb7 with SMTP id y16-20020a05622a121000b0042e701aceb7mr8464678qtx.22.1709454189158; Sun, 03 Mar 2024 00:23:09 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> In-Reply-To: <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> From: Nuno Teixeira <eduardo@freebsd.org> Date: Sun, 3 Mar 2024 08:22:58 +0000 X-Gmail-Original-Message-ID: <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> Message-ID: <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> Subject: Re: Port tree linter To: Hubert Tournier <hubert.tournier@gmail.com> Cc: Alexander Leidinger <Alexander@leidinger.net>, freebsd-ports@freebsd.org Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Hello, Is there plans to add it to our ports tree? Seems that we don't have PNU deps ported yet. Cheers Hubert Tournier <hubert.tournier@gmail.com> escreveu (domingo, 3/03/2024 =C3=A0(s) 01:23): > > Le 02/03/2024 =C3=A0 18:22, Alexander Leidinger a =C3=A9crit : > > Am 2024-03-02 09:24, schrieb Hubert Tournier: > > Now that this tool is a Python package, it's easier to use other Python l= ibraries. > > Maybe a check for ports which could be flavourized? Most PHP and python p= ackages could be flavourized. The issue may be false positives... > > PHP examples are baikal and tt-rss (for both I have patches, waiting a bi= t before declaring maintainer timeout). > > Unless there is a way to deduce that from a port's Makefile, I do not see= how to implement it? > > For example, taking Python packages, it would require downloading the dis= tfiles, analyzing their content (for example, sections [options.extras_requ= ire] in setup.cfg), and looking if there are corresponding port flavours (a= ssuming they have been named similarly). > > But downloading all ports distfiles would be very long and would consume = a lot of disk space (with a possible Denial of Service risk, should a file = system be saturated!). > > If there's another simpler way, I would be happy to know about it. > > Best regards, > > Hubert > > --=20 Nuno Teixeira FreeBSD Committer (ports) From nobody Sun Mar 3 11:48:03 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tng7W1Q5pz5CdD9 for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 11:48:07 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-lj1-x22e.google.com (mail-lj1-x22e.google.com [IPv6:2a00:1450:4864:20::22e]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tng7V6GWwz4kQy; Sun, 3 Mar 2024 11:48:06 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-lj1-x22e.google.com with SMTP id 38308e7fff4ca-2d180d6bd32so42339221fa.1; Sun, 03 Mar 2024 03:48:06 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709466483; x=1710071283; darn=freebsd.org; h=in-reply-to:from:content-language:references:cc:to:subject :user-agent:mime-version:date:message-id:from:to:cc:subject:date :message-id:reply-to; bh=g7PfMahNuUtX5LvKHSiANUh3bBVEhiAdtlBkMlAQPR0=; b=ie05HastQeerL3sI1zX4bC6OdV61KrlyFYqLdZFbCrvIh25Q+Ng0aA6C73hlhvh39M Zt6KKxfOjj5jnvJ8CECnawq66ozMkHzjzmVwWkv+Qju3+QTHGFv3PxA0DTS0ti0v5r1K gM79vGtMoF8VCDaAzrgjxq/Gku8Bj9y+0k9vE8AQNm8Rf1/SAcQfGS2+3rTbDjRoIlmv 1WoWBVM15HiSNwxbt4hbj8225qiLgTgwtieb378jhNDodThXZPyFxNNVGFwMkFOmvT9m ubD15Si+InEv5bP5gXCRkhZYCWDC+doFik+Rt8ihWzZSXzQBN6bPnn6qwaUhZXkB/bBL xo7g== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709466483; x=1710071283; h=in-reply-to:from:content-language:references:cc:to:subject :user-agent:mime-version:date:message-id:x-gm-message-state:from:to :cc:subject:date:message-id:reply-to; bh=g7PfMahNuUtX5LvKHSiANUh3bBVEhiAdtlBkMlAQPR0=; b=owuEG7Q7EytR5onhN8GLhyoYvFmiIUJhEsy2AUqHE/Ui8LlquK+PQqDqv/cLG82j/A F6tvpK+B6odyVUT+rHlIGnAbzfHg9gGq9TEPAGqNZm6ZfFk/ApR/www6BXgVN/lV6Y68 XT/XDXERX3ds2RmtX/eOI2TVHK+rgsiPOaG3UQh3cG+V1UAI/xCNyKiwhON0x4+VHDjW YJNffaT2565pDxIBu/wmmJ4ElKTa/+nvqOcuWnGjoRaZTXHSvuG6vLVVZOPffOoPHslz NDEYHF0MsBsXkgZuh2l4PxCPfxy/PMgUcAr5+7L4rQ/8MJciwa5Xie4FWu5+djkAeKSj T4AQ== X-Forwarded-Encrypted: i=1; AJvYcCV1wcTe/+yqoyA3zkZSS7o08R8che0YY716Tdx1P4Bl8kuffxryvEleq6At+NybLLM7Ye/9QJ2XvA4BTvkzhlauRBuazFGtfmGZ X-Gm-Message-State: AOJu0YwKCl2pRqWGhOlLuGywDgBZV74jxq3JTaXOdgsEZ4UiGNGQwLwy sKxbo1Wuj+EulIhnw4wURkz0yhbQDXCgjb2pydMQSLsj+CF0UU2gSYjHwwI/378= X-Google-Smtp-Source: AGHT+IECpQ7cQtJKwmROYS/5kHdtsSjT8h0l6ByPZbUQcoELVI2sQ66I7xwUtNo0n0YP2ewOCaghww== X-Received: by 2002:a05:651c:1258:b0:2d3:32e2:f953 with SMTP id h24-20020a05651c125800b002d332e2f953mr4791549ljh.18.1709466482781; Sun, 03 Mar 2024 03:48:02 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:f01a:a9b9:eb18:5477? ([2a01:e0a:80d:9d80:f01a:a9b9:eb18:5477]) by smtp.gmail.com with ESMTPSA id o6-20020a05600c4fc600b00412656ba919sm3630166wmq.20.2024.03.03.03.48.02 (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sun, 03 Mar 2024 03:48:02 -0800 (PST) Content-Type: multipart/alternative; boundary="------------O3HF0V511vcFPkJpQM04w9wg" Message-ID: <518ac54a-8d2d-4145-a356-43020fa1e2d6@gmail.com> Date: Sun, 3 Mar 2024 12:48:03 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Port tree linter To: Nuno Teixeira <eduardo@freebsd.org> Cc: Alexander Leidinger <Alexander@leidinger.net>, freebsd-ports@freebsd.org References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> Content-Language: fr From: Hubert Tournier <hubert.tournier@gmail.com> In-Reply-To: <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; TAGGED_FROM(0.00)[]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US] X-Rspamd-Queue-Id: 4Tng7V6GWwz4kQy This is a multi-part message in MIME format. --------------O3HF0V511vcFPkJpQM04w9wg Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit Le 03/03/2024 à 09:22, Nuno Teixeira a écrit : > Is there plans to add it to our ports tree? > Seems that we don't have PNU deps ported yet. Yes, I'll do that, but I want to finish one or two functionalities first: - VuXML vulnerabilities check, that I'll roll out this afternoon - distfiles availability And maybe think a little about alternative computer-friendly outputs (json, csv, other?), besides human-friendly text output? But in the meantime it's available as a Python package for those who don't fear installing that (it works without superuser access so could be installed as local user Python packages). Best regards, Hubert PS: only little parts of the PNU project would have to be added to the ports tree (libpnu and vuxml), and maybe some third parties Python packages too --------------O3HF0V511vcFPkJpQM04w9wg Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 8bit <!DOCTYPE html> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> </head> <body> <div class="moz-cite-prefix">Le 03/03/2024 à 09:22, Nuno Teixeira a écrit :<br> </div> <blockquote type="cite" cite="mid:CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com"> <pre class="moz-quote-pre" wrap="">Is there plans to add it to our ports tree? Seems that we don't have PNU deps ported yet.</pre> </blockquote> <p>Yes, I'll do that, but I want to finish one or two functionalities first:</p> <p>- VuXML vulnerabilities check, that I'll roll out this afternoon</p> <p>- distfiles availability<br> </p> <p>And maybe think a little about alternative computer-friendly outputs (json, csv, other?), besides human-friendly text output?<br> </p> <p><span style="white-space: pre-wrap">But in the meantime it's available as a Python package for those who don't fear installing that (it works without superuser access so could be installed as local user Python packages). </span></p> <p><span style="white-space: pre-wrap">Best regards,</span></p> <p><span style="white-space: pre-wrap">Hubert</span></p> <p><span style="white-space: pre-wrap">PS: only little parts of the PNU project would have to be added to the ports tree (libpnu and vuxml), and maybe some third parties Python packages too </span></p> </body> </html> --------------O3HF0V511vcFPkJpQM04w9wg-- From nobody Sun Mar 3 12:39:51 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnhHR439wz5Cjqp for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 12:40:03 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnhHR3ZZYz4thS for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 12:40:03 +0000 (UTC) (envelope-from eduardo@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709469603; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=tSgRTzGoS4/5LS10KaQmFktGTPlzIL6MBcy1zJuekT4=; b=jdkV/TO3SSaet1N94JHn6R6TL1wtKC4wEG8RH+agUbXP2v+1Rc+rss/VGwldpEoEx7HPJa Z2CKm0G1zVkkj6FHKNNY69sftJQvavKUvsPftleDdVf3bur2qI4E3o3OR5XMN5B4dEJCMN k4bVHbfZHMxKjPTJ2QQTBE2R2nL9WAXDkkqw8/WVyUue5z3u0Hhsa2F3V6CcV1PtN94lAT N5q2hKB0HUKBN+C5D+ciRQsLeiCE+KY1e8PUGpTRimkC0kMmY5zSRD0LnQdcpwqXkxa2ez mJC5lvOHAo1IizNrNE7v+5amvEO30cxR15aX5h6eUs6/nLOYe1eIbUwfOM71Ww== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1709469603; a=rsa-sha256; cv=none; b=IpvYDjqgdZxacQS4uxgOnK0R4pha89pXyL5FK/Aq00CL8ROlDT5VjCi5sqLixOQgrW7ICX MV+1uP35BxXatvDbFZjhHqCeyyICZzCeIUfmMKeWIkdPZcDRYPl/zJ47oSw56Ea9x/moJo 7qbtQeXVPSvxe1M2dyrf+CYkjrbQO8lkt0K1Icj7zD7azVWP3F8Y3DlH3RnEA0ZAfFdaNs 2G4DNU0M0oVmY17g6Alsm4fmWqZs7nohiZTyfeGfM1BQMfXddyNuqI2P/6mSQYL1wlTdB5 gLh9wE21M5R4lovaiBzFbZQENI8URD9t56rFpe2cENS/Lf/pS48gd/b/FqlNMQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1709469603; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=tSgRTzGoS4/5LS10KaQmFktGTPlzIL6MBcy1zJuekT4=; b=XxcbfVgddo7XEYuzY57tIkKK9N5iP+02el0GC9tsFZgU95rvcV1EoYY0RjF9+pE/z0I97y zUQKsxkn/niucbh3Lh9Oh7qcyVne/WVSNPj0zmknoG/fGx9JpgBmfqYJ3qLhV11KWuJ/ix wuwrIxKMNGkBr2s4wglLEuZbpn6A6ufTO0QKvyaxk26stgq9lf/FY/vfJrFfw+oYV8KMq/ Dh7WNLAtEZHW2Yd+6a44dgVjeD0AByHp1nSjO+zJyCMm6pnmSVM+44At4TCn9sAECd94uI KKKWa7rP7SfYIV0PEhnoBS+pTyT2g9tg4AcjKC06n9L1LLlo8JDjg5v8j0TbYA== Received: from mail-qt1-f179.google.com (mail-qt1-f179.google.com [209.85.160.179]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) (Authenticated sender: eduardo) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TnhHR38xlz168G for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 12:40:03 +0000 (UTC) (envelope-from eduardo@freebsd.org) Received: by mail-qt1-f179.google.com with SMTP id d75a77b69052e-42e5e1643adso23992361cf.3 for <freebsd-ports@freebsd.org>; Sun, 03 Mar 2024 04:40:03 -0800 (PST) X-Forwarded-Encrypted: i=1; AJvYcCW1A31bHXjzHGZAjASIOlSh8qLWYQBgxX30ANR85U+hHQEEf61AVi1iw9oGVB0qHXxmh2pvmsPjcvWt9/Be9DJp7ggIB7nKtAL8 X-Gm-Message-State: AOJu0Yxd3XOoOQaQQ8OfQlDNduEtlj/2xYAXzi/F6xKx4Ugo8+v/l+rI yZrdsZYUorh9AkOQX+JKhMF5m3PBoZKQgcmz6A2bVEBpe6rhIbsEvLn23b/BqR6ulLgQ0WfrdEQ HOOVCESz2YNZMbvmgsp9MMkJ4zZI= X-Google-Smtp-Source: AGHT+IH5VK+1rsD6TGocf4fV4MHeme/NicmR1kGT78DMMTvmnJLKQFsHSJJt8z/krJcJVa4oloLhqS0/1yXofh/IC4E= X-Received: by 2002:ac8:5bcf:0:b0:42e:7999:3f58 with SMTP id b15-20020ac85bcf000000b0042e79993f58mr7356137qtb.57.1709469602734; Sun, 03 Mar 2024 04:40:02 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> <518ac54a-8d2d-4145-a356-43020fa1e2d6@gmail.com> In-Reply-To: <518ac54a-8d2d-4145-a356-43020fa1e2d6@gmail.com> From: Nuno Teixeira <eduardo@freebsd.org> Date: Sun, 3 Mar 2024 12:39:51 +0000 X-Gmail-Original-Message-ID: <CAFDf7UL9b+pTZ54+Rpd=CdneFvKSG=bbbWQf1JvWArBbe0Pgng@mail.gmail.com> Message-ID: <CAFDf7UL9b+pTZ54+Rpd=CdneFvKSG=bbbWQf1JvWArBbe0Pgng@mail.gmail.com> Subject: Re: Port tree linter To: Hubert Tournier <hubert.tournier@gmail.com> Cc: Alexander Leidinger <Alexander@leidinger.net>, freebsd-ports@freebsd.org Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Really nice! I will wait until it gets added to tree to try it out. Cheers, Hubert Tournier <hubert.tournier@gmail.com> escreveu (domingo, 3/03/2024 =C3=A0(s) 11:48): > > Le 03/03/2024 =C3=A0 09:22, Nuno Teixeira a =C3=A9crit : > > Is there plans to add it to our ports tree? > Seems that we don't have PNU deps ported yet. > > Yes, I'll do that, but I want to finish one or two functionalities first: > > - VuXML vulnerabilities check, that I'll roll out this afternoon > > - distfiles availability > > And maybe think a little about alternative computer-friendly outputs (jso= n, csv, other?), besides human-friendly text output? > > But in the meantime it's available as a Python package for those who don'= t fear installing that (it works without superuser access so could be insta= lled as local user Python packages). > > Best regards, > > Hubert > > PS: only little parts of the PNU project would have to be added to the po= rts tree (libpnu and vuxml), and maybe some third parties Python packages t= oo --=20 Nuno Teixeira FreeBSD Committer (ports) From nobody Sun Mar 3 12:53:31 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnhbD24Y8z5CkkR for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 12:53:44 +0000 (UTC) (envelope-from oliver.epper@gmail.com) Received: from mail-ot1-x32f.google.com (mail-ot1-x32f.google.com [IPv6:2607:f8b0:4864:20::32f]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnhbC4SjJz3xxJ for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 12:53:43 +0000 (UTC) (envelope-from oliver.epper@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=GxhY2XQQ; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of oliver.epper@gmail.com designates 2607:f8b0:4864:20::32f as permitted sender) smtp.mailfrom=oliver.epper@gmail.com Received: by mail-ot1-x32f.google.com with SMTP id 46e09a7af769-6e47a9f4b70so2047190a34.1 for <freebsd-ports@freebsd.org>; Sun, 03 Mar 2024 04:53:43 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709470422; x=1710075222; darn=freebsd.org; h=to:subject:message-id:date:from:mime-version:from:to:cc:subject :date:message-id:reply-to; bh=FCJCdbRZMqFPS4H8Ro7pmdCOy7o4ZQMyiVMlIQ84tNg=; b=GxhY2XQQfFmsBSamcVhwftUg7wMtoOxAEyhBqIdft7Wwrfpf4oKjPXUlCj7AhqxNsl ktF37kUx5jynvDb9M+bZy0gFAKvoGF/fY8tFDoNknXD9qAI0emWCMLcE1sRKmfDi0R2/ iiWew+ZbAr1rGqwVUDyCOyoP+X4tHLDn5794UGoa7o1HC45yZ6vmFndi+yKfXkm4mnKr LNHIctVyFrDsX71nExtLwjOqv+P8FlYzxx4J7QCBcRgdR4F1pLMlYwkJhnefbuv98nFR agnUokmnLcTLVa38HNuoFlra9ZcvtFpBMa1Rbfzd7O6zL0OILNhXJlkKEdVi6/qW7ZMH fDbw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709470422; x=1710075222; h=to:subject:message-id:date:from:mime-version:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=FCJCdbRZMqFPS4H8Ro7pmdCOy7o4ZQMyiVMlIQ84tNg=; b=vtz2QNp92pyODhhetio8nU3X3v2OqdFiwePnxBefktyhMCEE+LKcTeRcjbJCGJ79ei z+aT9HlTD38dNhP9tZ2T4l98NUm8kcQ+3OmqG9aRLpMaWJ2d4YhLf8B8KMQvgaVZUC9I L0MRxPkSOGuqt7hZoOqRQGKCh1iEtn708dNVwf/L+5gqS8B+eEpAnsrOSReQU/Tzc8bk RNuZk7cSLLhjtGvT5BTO/yoHVskA4jKwkIT2HfDdCfHWN0OeF8Ip3Ww286HrjDftWHLl hROC3cRjO8JZDCDEy0TC4MY37XrSvpfxMiEZafESkN75vSivnUNQ9UkStkoNHFX2v6uu h/+Q== X-Gm-Message-State: AOJu0YwPPlwgRCOoXCBpRykGboEAnXqNqz+2WfdE2v8yqVHVHsUI+QEo IY5uvI1GxyHH+eMF7+wzlIu3Ld4ZOp4muS0U+IlhVgC3AfF2tvUJ8eMXTHyPwYHnub9DLmr3hDI hiZVVhFIHD3koBmi0JaJB+XBJetVngXEe X-Google-Smtp-Source: AGHT+IEF2OtFbANHwO7ioF3iEdpGZVuQthiU0I9qimUjdudSh87ucmJOLha5VTOGrpcMV5EHBdGE+Zjkp9N9qkERwEc= X-Received: by 2002:a05:6870:1594:b0:21f:c7fa:78f5 with SMTP id j20-20020a056870159400b0021fc7fa78f5mr6725665oab.7.1709470422045; Sun, 03 Mar 2024 04:53:42 -0800 (PST) List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 From: Oliver Epper <oliver.epper@gmail.com> Date: Sun, 3 Mar 2024 13:53:31 +0100 Message-ID: <CAP8tsuQ=j4CSMno75nbh32-FEcvAtrrEDxup5d1u5n_3fibuuA@mail.gmail.com> Subject: compiling for other architecture To: FreeBSD Ports <freebsd-ports@freebsd.org> Content-Type: multipart/alternative; boundary="00000000000042993a0612c119a1" X-Spamd-Bar: --- X-Spamd-Result: default: False [-4.00 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.996]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; R_SPF_ALLOW(-0.20)[+ip6:2607:f8b0:4000::/36]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCPT_COUNT_ONE(0.00)[1]; FREEMAIL_ENVFROM(0.00)[gmail.com]; FREEMAIL_FROM(0.00)[gmail.com]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; MID_RHS_MATCH_FROMTLD(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; TAGGED_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US]; MISSING_XM_UA(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2607:f8b0:4864:20::32f:from] X-Rspamd-Queue-Id: 4TnhbC4SjJz3xxJ --00000000000042993a0612c119a1 Content-Type: text/plain; charset="UTF-8" Hi all, I am currently working on an updated port of net/pjsip. I have a personal use case building for the raspberry-pi, too. All the information that I found so far seemed outdated. Many are talking about building a cross-compiler. With clang that should not be necessary, right? Can anyone point me to more recent information on how I can build for armv6 on a x86_64 machine? greetings Oliver P.S.: I know how to build for different architectures. My questions are all about the "dos and don'ts" and best practices when it comes to the FreeBSDs ports system. --00000000000042993a0612c119a1 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable <div dir=3D"ltr">Hi all,<div><br></div><div>I am currently working on an up= dated port of net/pjsip. I have a personal use case building for the raspbe= rry-pi, too. All the information that I found so far seemed outdated. Many = are talking about building a cross-compiler. With clang that should not be = necessary, right?</div><div><br></div><div>Can anyone point me to more rece= nt information on how I can build for armv6 on a x86_64 machine?</div><div>= <br></div><div>greetings</div><div>Oliver</div><div><br></div><div>P.S.: I = know how to build for different architectures. My questions are all about t= he "dos and don'ts" and best practices when it comes to the F= reeBSDs ports system.</div></div> --00000000000042993a0612c119a1-- From nobody Sun Mar 3 16:11:34 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tnmzl0TH4z5BqL7 for <ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 16:11:47 +0000 (UTC) (envelope-from ps.ports@smyrak.com) Received: from ipv6.s149.cyber-folks.pl (ipv6.s149.cyber-folks.pl [IPv6:2a02:1778::113:254]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tnmzk07FBz4PW2 for <ports@freebsd.org>; Sun, 3 Mar 2024 16:11:46 +0000 (UTC) (envelope-from ps.ports@smyrak.com) Authentication-Results: mx1.freebsd.org; dkim=none ("invalid DKIM record") header.d=smyrak.com header.s=x header.b=I8mK3QqM; dmarc=pass (policy=none) header.from=smyrak.com; spf=pass (mx1.freebsd.org: domain of ps.ports@smyrak.com designates 2a02:1778::113:254 as permitted sender) smtp.mailfrom=ps.ports@smyrak.com DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=smyrak.com; s=x; h=Content-Transfer-Encoding:Content-Type:MIME-Version:References: In-Reply-To:Message-ID:Subject:To:From:Date:Sender:Reply-To:Cc:Content-ID: Content-Description:Resent-Date:Resent-From:Resent-Sender:Resent-To:Resent-Cc :Resent-Message-ID:List-Id:List-Help:List-Unsubscribe:List-Subscribe: List-Post:List-Owner:List-Archive; bh=xGNZnmWuGWkfN0wUoQZ+O1IloHOQYI/GsC6BY3pwmQU=; b=I8mK3QqMocmWhzB6izIOZghGL4 +hraK8CjnSL4dvYaXgMACmNl23XDbcmhuibIOidVhya6j6RsUJdRLYGgokljLthZIJNf0heGoF5/a +eYu0fuOPnaIQB1M3K6QgUv+X803wAEgU46pA6Lb3LqJF6sAzhF12TLOYzsHbzEA/4HmmNdr9ctHg hfhVEu2RvRdeVZOS9FbpyZyL2b/qBQGoKG+TNQEE2Z2so6hNcan3VzDUxNBkdMeoW3U0m6aV9JpHu yQpI7GvF9NAlnnviXcwDE4oXdld42xoap9n+81ti2CCCILebk/Cn4w7waYEv/lyGQ1ks+phy90/n6 vVOdvVVw==; Received: from 93-181-165-201.internetia.net.pl ([93.181.165.201] helo=daleth.home) by s149.cyber-folks.pl with esmtpsa (TLS1.3) tls TLS_AES_256_GCM_SHA384 (Exim 4.97.1) (envelope-from <ps.ports@smyrak.com>) id 1rgoRE-0000000760E-3qWY for ports@freebsd.org; Sun, 03 Mar 2024 17:11:44 +0100 Date: Sun, 3 Mar 2024 17:11:34 +0100 From: Piotr Smyrak <ps.ports@smyrak.com> To: ports@freebsd.org Subject: Re: Port tree linter Message-ID: <20240303171134.0a61b218@daleth.home> In-Reply-To: <518ac54a-8d2d-4145-a356-43020fa1e2d6@gmail.com> References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> <518ac54a-8d2d-4145-a356-43020fa1e2d6@gmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Authenticated-Id: piero@smyrak.com X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.24 / 15.00]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-0.91)[-0.908]; NEURAL_HAM_LONG(-0.63)[-0.627]; DMARC_POLICY_ALLOW(-0.50)[smyrak.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a02:1778::113:0/116]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; ASN(0.00)[asn:41079, ipnet:2a02:1778::/48, country:PL]; RCVD_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; R_DKIM_PERMFAIL(0.00)[smyrak.com:s=x]; MISSING_XM_UA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; RCVD_TLS_ALL(0.00)[]; MLMMJ_DEST(0.00)[ports@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_NONE(0.00)[]; ARC_NA(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DKIM_TRACE(0.00)[smyrak.com:~] X-Rspamd-Queue-Id: 4Tnmzk07FBz4PW2 On Sun, 3 Mar 2024 12:48:03 +0100 Hubert Tournier <hubert.tournier@gmail.com> wrote: > Le 03/03/2024 =C3=A0 09:22, Nuno Teixeira a =C3=A9crit=C2=A0: > > Is there plans to add it to our ports tree? > > Seems that we don't have PNU deps ported yet. =20 >=20 > Yes, I'll do that, but I want to finish one or two functionalities > first: Could you announce when its available? Thank you for contributing this. --=20 Piotr Smyrak From nobody Sun Mar 3 18:33:05 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tnr6r4Mf6z5C4J2 for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 18:33:08 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tnr6q3y6nz4kwN for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 18:33:07 +0000 (UTC) (envelope-from david@catwhisker.org) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of david@catwhisker.org designates 107.204.234.170 as permitted sender) smtp.mailfrom=david@catwhisker.org Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.18.1/8.18.1) with ESMTP id 423IX5TA048873 for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 18:33:05 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.18.1/8.18.1/Submit) id 423IX5sR048872 for freebsd-ports@freebsd.org; Sun, 3 Mar 2024 10:33:05 -0800 (PST) (envelope-from david) Date: Sun, 3 Mar 2024 10:33:05 -0800 From: David Wolfskill <david@catwhisker.org> To: freebsd-ports@freebsd.org Subject: How do I clear no-longer-usable packages from poudriere? Message-ID: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> Reply-To: freebsd-ports@freebsd.org List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="QT7NY3DP5lP4HMNR" Content-Disposition: inline X-Spamd-Bar: / X-Spamd-Result: default: False [0.60 / 15.00]; REPLYTO_EQ_TO_ADDR(5.00)[]; SIGNED_PGP(-2.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; R_SPF_ALLOW(-0.20)[+ip4:107.204.234.170:c]; RCPT_COUNT_ONE(0.00)[1]; FREEFALL_USER(0.00)[david]; DMARC_NA(0.00)[catwhisker.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; ARC_NA(0.00)[]; MISSING_XM_UA(0.00)[]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US]; FROM_HAS_DN(0.00)[]; MID_RHS_MATCH_FROMTLD(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TO_DN_NONE(0.00)[]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; R_DKIM_NA(0.00)[]; HAS_REPLYTO(0.00)[freebsd-ports@freebsd.org] X-Rspamd-Queue-Id: 4Tnr6q3y6nz4kwN --QT7NY3DP5lP4HMNR Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable I have a local package-builder that's (generally) been working quite well for me since Jul 2015 (through a couple of hardware replacements, sure, but the approach remains the same). Today, in trying to chase down what was causing my central "hub" machine to whine: ld-elf.so.1: /usr/local/lib/libtasn1.so.6: version LIBTASN1_0_3 required by= /usr/local/lib/libgnutls.so.30 not defined I found (via the "pkg_libchk" script from ports-mgmt/bsdadminscripts2) that some just-installed packages are apparently expecting to use libc.so.6, which hasn't existed on anything here since 18 February. (My machines run stable/14 for getting things done; the development machines also track head, so I have some clue what's coming.) The package-builder also builds FreeBSD for its "client" machines. The package-builder (and my laptop) track stable/14 daily; the package-builder does a 2-pass weekend run of package-building (first pass on Saturday, after updating FreeBSD; second on Sunday). Once the packages are built, the client machines update FreeBSD (to the latest snapshot from the package-builder, which is already running that code). The package-builder is thus running the same revision of FreeBSD that the clients are about to run. And poudriere is using the package-builder's /usr/src and /usr/ports to construct jails & build stuff. I am trying to ensure a certain level of consistency, here. And today appears to show that I have failed to do that. Is there something less drastic than clearing all poudriere caches of packages and rebuilding all packages all over again??!? (that will get me a set of packages consistent with the current state of FreeBSD sources and ports (stable/14-n266921-8a7d5d73b849 and main-n654175-6928d3a11398, respectively (at the moment)))? At least name resolution isn't broken this time, but printing seems to have been a casualty. Peace, david --=20 David H. Wolfskill david@catwhisker.org Alexey Navalny was a courageous man; Putin has made him a martyr. See https://www.catwhisker.org/~david/publickey.gpg for my public key. --QT7NY3DP5lP4HMNR Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iNUEARYKAH0WIQSTLzOSbomIK53fjFliipiWhXYx5QUCZeTCYV8UgAAAAAAuAChp c3N1ZXItZnByQG5vdGF0aW9ucy5vcGVucGdwLmZpZnRoaG9yc2VtYW4ubmV0OTMy RjMzOTI2RTg5ODgyQjlEREY4QzU5NjI4QTk4OTY4NTc2MzFFNQAKCRBiipiWhXYx 5VYcAQCFUyb+t0jh5vdeZrQ8VH8bjEpQuh6ZWb3mjKu00nudTgEA3rPphcuxwQDQ ks/EajGMOeqDE2jirAzj0R4HF+EQIgY= =Jc/T -----END PGP SIGNATURE----- --QT7NY3DP5lP4HMNR-- From nobody Sun Mar 3 18:56:59 2024 X-Original-To: ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TnrfR0hCkz5C6DV for <ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 18:57:03 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Received: from mail-lj1-x231.google.com (mail-lj1-x231.google.com [IPv6:2a00:1450:4864:20::231]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TnrfQ2mrYz4p0l for <ports@freebsd.org>; Sun, 3 Mar 2024 18:57:02 +0000 (UTC) (envelope-from hubert.tournier@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gmail.com header.s=20230601 header.b=nNZso9EM; dmarc=pass (policy=none) header.from=gmail.com; spf=pass (mx1.freebsd.org: domain of hubert.tournier@gmail.com designates 2a00:1450:4864:20::231 as permitted sender) smtp.mailfrom=hubert.tournier@gmail.com Received: by mail-lj1-x231.google.com with SMTP id 38308e7fff4ca-2d2305589a2so55022341fa.1 for <ports@freebsd.org>; Sun, 03 Mar 2024 10:57:02 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1709492220; x=1710097020; darn=freebsd.org; h=in-reply-to:from:content-language:references:to:subject:user-agent :mime-version:date:message-id:from:to:cc:subject:date:message-id :reply-to; bh=5zwcx3QVE5yhem0hpJ5TTtGA8Wtgc3Q1uX/14yc/oqA=; b=nNZso9EMq39OTRdswi1PkHI8j/MKMap0/AYFGN8Absd2mHrYOJ/ebOhufDH/zWs3O8 fobmBJs6DD72Z8TJfdmkL7AT16TsMkFCm/gfQQQbfZMO89Y/kDMDW03EWawPoYg1HQkn 9dccOXjqkrEWDRPG468LVKsHhITG58PZYnABEpOjeedRc/jN+hXQEoc0oA+DHUu33OTr eTWDaqG1vowpeWDXUHBKxIEYgT46dFmGmek59K8CnI+1OFOFK3WRfIvUAohwC8iH+9Ik KoAXAZh0ufmqJsFGfBWjCqBdoBRfsVOPNFyXlFPYJta3b8wdPm1QOZA+K8I7GEJ8ITy1 oh9w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1709492220; x=1710097020; h=in-reply-to:from:content-language:references:to:subject:user-agent :mime-version:date:message-id:x-gm-message-state:from:to:cc:subject :date:message-id:reply-to; bh=5zwcx3QVE5yhem0hpJ5TTtGA8Wtgc3Q1uX/14yc/oqA=; b=NN2p4p5Vx5y6tgx5sXzUEDPNWLyq1qunYzsA1CA47ztxAShUb69N1yb4EQLyGLzTu3 vZTRJsgFefQseNT6+RIXNMP8lVMoZtmFNac8vVQhtm4iwSum0KHZ/jK6iFwhM78ZfGol OXi4juOCqsOQ0qrCJEt767UHUd4+TYBTFGLCfLQojPmKzM7ZtsMEJNRwisiqQTn04R3Y iA+MXE9kxJuTZ5mUIL3WUKwI/EdMW79ByTQGMb203Ql74i3ZS1Rj1nyvkK02zcuYKIoX fCT2Jd7OkoxgAoeBjeGsFX+CYAXT1frbfgp/qpqkYIOWbn49JaH1Owyn3SiK6OL/D+6J ehag== X-Gm-Message-State: AOJu0YxMAu+EGUhu9yHzYmwQdw9wb4lyl1j5DYhSYuOqqSJ8HyOeMUc6 jon8mQ6exqa5RIDWpCfZ3cQMdmxC/gVUbRjqQlsZihIhlusC13+OpXB9PsWO/C0= X-Google-Smtp-Source: AGHT+IFTM0K8VELRz0ZJ4dj1JyTVgxo1CmI7xyTKgpdlMv3Vye9QKOpUDE5qG/y5Vz9sEY1lrqyRxA== X-Received: by 2002:a2e:7c18:0:b0:2d3:8c1f:c0ff with SMTP id x24-20020a2e7c18000000b002d38c1fc0ffmr1717874ljc.16.1709492220296; Sun, 03 Mar 2024 10:57:00 -0800 (PST) Received: from ?IPV6:2a01:e0a:80d:9d80:f01a:a9b9:eb18:5477? ([2a01:e0a:80d:9d80:f01a:a9b9:eb18:5477]) by smtp.gmail.com with ESMTPSA id l21-20020a05600c4f1500b004101543e843sm15510856wmq.10.2024.03.03.10.56.59 for <ports@freebsd.org> (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Sun, 03 Mar 2024 10:56:59 -0800 (PST) Content-Type: multipart/alternative; boundary="------------IeFqV8ZSAMrIEdElR680rDRt" Message-ID: <ea350f63-e212-4d68-9d64-991ba5d89841@gmail.com> Date: Sun, 3 Mar 2024 19:56:59 +0100 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Port tree linter To: ports@freebsd.org References: <cb6f89d3-3f7b-4beb-bd6a-83c95faec3c3@gmail.com> <1d9568c9-b2b6-468e-8bc5-509d9aa4ed99@gmail.com> <46af7b220502ded8fb3848f279546da3@Leidinger.net> <bb131eb7-cc75-448e-8ff2-54721bcfe3da@gmail.com> <c0fe4a0083554b11559b83fa64b591d2@Leidinger.net> <28d5cf8a-c3eb-419d-ba36-9594c829cad1@gmail.com> <CAFDf7U+VSOA1Zx_TB-J4e3Kps5Fn_MY_zPGSnvmdT5y5Fo_HBw@mail.gmail.com> <518ac54a-8d2d-4145-a356-43020fa1e2d6@gmail.com> <20240303171134.0a61b218@daleth.home> Content-Language: fr From: Hubert Tournier <hubert.tournier@gmail.com> In-Reply-To: <20240303171134.0a61b218@daleth.home> X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.99 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[gmail.com,none]; R_SPF_ALLOW(-0.20)[+ip6:2a00:1450:4000::/36]; R_DKIM_ALLOW(-0.20)[gmail.com:s=20230601]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; XM_UA_NO_VERSION(0.01)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FREEMAIL_ENVFROM(0.00)[gmail.com]; RCVD_TLS_LAST(0.00)[]; FREEMAIL_FROM(0.00)[gmail.com]; ARC_NA(0.00)[]; TAGGED_FROM(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; DWL_DNSWL_NONE(0.00)[gmail.com:dkim]; TO_DN_NONE(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[gmail.com:+]; PREVIOUSLY_DELIVERED(0.00)[ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[ports@freebsd.org]; ASN(0.00)[asn:15169, ipnet:2a00:1450::/32, country:US]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2a00:1450:4864:20::231:from] X-Rspamd-Queue-Id: 4TnrfQ2mrYz4p0l This is a multi-part message in MIME format. --------------IeFqV8ZSAMrIEdElR680rDRt Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit Le 03/03/2024 à 17:11, Piotr Smyrak a écrit : > On Sun, 3 Mar 2024 12:48:03 +0100 > Hubert Tournier<hubert.tournier@gmail.com> wrote: >> Le 03/03/2024 à 09:22, Nuno Teixeira a écrit : >>> Is there plans to add it to our ports tree? >>> Seems that we don't have PNU deps ported yet. >> Yes, I'll do that, but I want to finish one or two functionalities >> first: > Could you announce when its available? Yes! I'll need to submit ports for pnu-libpnu, pnu-vuxml (which, besides being a library, is a "search engine" command-line tool inside the VuXML vulnerabilities list that would probably be interesting too for readers of this mailing list) and pnu-portstreelint. All the other required dependencies are already in the port tree, with the peculiar case of py39-html2text which is a bit old (version 2020.1.16, while I have 2024.2.26 on my system). Meanwhile: - the Python package version including ports vulnerabilities reporting and CSV output is now available on GitHub - the tools (refreshed) results on the whole ports tree are on the previously given links > Thank you for contributing this. With pleasure. Best regards, Hubert --------------IeFqV8ZSAMrIEdElR680rDRt Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 8bit <!DOCTYPE html> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> </head> <body> <div class="moz-cite-prefix">Le 03/03/2024 à 17:11, Piotr Smyrak a écrit :<br> </div> <blockquote type="cite" cite="mid:20240303171134.0a61b218@daleth.home"> <pre class="moz-quote-pre" wrap="">On Sun, 3 Mar 2024 12:48:03 +0100 Hubert Tournier <a class="moz-txt-link-rfc2396E" href="mailto:hubert.tournier@gmail.com"><hubert.tournier@gmail.com></a> wrote: </pre> <blockquote type="cite"> <pre class="moz-quote-pre" wrap="">Le 03/03/2024 à 09:22, Nuno Teixeira a écrit : </pre> <blockquote type="cite"> <pre class="moz-quote-pre" wrap="">Is there plans to add it to our ports tree? Seems that we don't have PNU deps ported yet. </pre> </blockquote> <pre class="moz-quote-pre" wrap="">Yes, I'll do that, but I want to finish one or two functionalities first: </pre> </blockquote> <pre class="moz-quote-pre" wrap="">Could you announce when its available? </pre> </blockquote> <p>Yes! I'll need to submit ports for pnu-libpnu, pnu-vuxml (which, besides being a library, is a "search engine" command-line tool inside the VuXML vulnerabilities list that would probably be interesting too for readers of this mailing list) and pnu-portstreelint.</p> <p>All the other required dependencies are already in the port tree, with the peculiar case of py39-html2text which is a bit old (version 2020.1.16, while I have 2024.2.26 on my system).<br> </p> <p>Meanwhile:</p> <p>- the Python package version including ports vulnerabilities reporting and CSV output is now available on GitHub</p> <p>- the tools (refreshed) results on the whole ports tree are on the previously given links <br> </p> <blockquote type="cite" cite="mid:20240303171134.0a61b218@daleth.home"> <pre class="moz-quote-pre" wrap="">Thank you for contributing this.</pre> </blockquote> <p><span style="white-space: pre-wrap">With pleasure.</span></p> <p>Best regards,</p> <p>Hubert<br> <span style="white-space: pre-wrap"></span></p> <span style="white-space: pre-wrap"> </span> </body> </html> --------------IeFqV8ZSAMrIEdElR680rDRt-- From nobody Sun Mar 3 19:01:36 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tnrm72XQFz5C6Rb for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 19:01:59 +0000 (UTC) (envelope-from robert@rrbrussell.com) Received: from wfout7-smtp.messagingengine.com (wfout7-smtp.messagingengine.com [64.147.123.150]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tnrm70GXfz4qQm for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 19:01:59 +0000 (UTC) (envelope-from robert@rrbrussell.com) Authentication-Results: mx1.freebsd.org; none Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by mailfout.west.internal (Postfix) with ESMTP id 4157F1C000D7 for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 14:01:57 -0500 (EST) Received: from imap52 ([10.202.2.102]) by compute1.internal (MEProxy); Sun, 03 Mar 2024 14:01:57 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rrbrussell.com; h=cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1709492516; x=1709578916; bh=yX9cyWNWtDnoYXhHQAyG8Eh+SLraj1NXb3VdN+L1U4g=; b= SUAiKbupyUbRr0gLmzBR/sp/1P0OvoBB4NZ/sHHpbKcfOeqbJnbKt6VJpoR3IQR6 LarEUWIwyDRWdWzb9KbmgOjPYYUynKWu5a+TFjtz+C6xinGqiV/ZnuYeCWcpl3Ne RDUDhBcJU815oSckgRl0yGaP4nuRLn7yn+ub17zTHtckS7ECucWf+IhQIoDf9/Nf XRbRLs0bxG95P5AVqcYt/UfSKNrrDcYd8ZLY1Z5KHdC+8pfVtwdsnerFWVEF2/hE 6bzIV/YSQKx16CO3k3AnrfGxRfr7QvRVWE6TJHtFm4evJKQoyBuSKExLp9k2Nwbg aQkb9q8sfWAk3PpowGQ8PQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :content-type:date:date:feedback-id:feedback-id:from:from :in-reply-to:in-reply-to:message-id:mime-version:references :reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1709492516; x= 1709578916; bh=yX9cyWNWtDnoYXhHQAyG8Eh+SLraj1NXb3VdN+L1U4g=; b=K AgJHEiHnFcTX7ftkuzt6O8J41suQo9nwoRoy01ZRsGeN3nL0/F2oxgvHeX0zxnzB zCCHfZvydw977IYMuercUIjtAXgbBO1SKCcgKvMPcxlPHcCOy9sdmYMvv0g3zHN9 s10z20jJmahXCxGZO3kafoTVApqivgR7XSXuWv7AlWxID0lpuOTb3TxyCZobs5MK HAMR8sX6wEqWpxXrZZKCLnU4p4ZsoKrlbJWX/g7+2N6AIdzeraX5iBvXGVaQTS6c pZ8rQhQ3WhMwLp8Mza6vCIeQXlwYtvBsrFViJZkZ/dS/YVz01llrKq+uO4dJfLKG k/m8vugAzMTqG0ovdhPGA== X-ME-Sender: <xms:JMnkZWpnSVvav20FqHRa2U5Nq2Qc-2WRkbDKqYbqdKedpwsV43sZ5Q> <xme:JMnkZUpg2FqLOQuwLoac0wrZqaNdPkhzH1abGRuKbqmPaDnq3AxiMxoYpD-mGujST AuviAAuGQd78meGr84> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvledrheehgdduudelucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpefofgggkfgjfhffhffvufgtgfesth hqredtreerjeenucfhrhhomheprhhosggvrhhtsehrrhgsrhhushhsvghllhdrtghomhen ucggtffrrghtthgvrhhnpeekhedtleeffeffteeglefgfeekudehtdelvddvtdfhueefgf ehteevvedtffdtffenucffohhmrghinheptggrthifhhhishhkvghrrdhorhhgnecuvehl uhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomheprhhosggvrhhtse hrrhgsrhhushhsvghllhdrtghomh X-ME-Proxy: <xmx:JMnkZbPTO_zKwsVimyBMzDhylz3F0StWgO7pnVTOI-GOReMXdw76JQ> <xmx:JMnkZV5hk80td9D2QkcKZHyPjQAR08BlCmibQa6IEKOEBlB9HrbynA> <xmx:JMnkZV6tJnThO8m-tyJTIzjpSxZ8avx1K1VfVRpntDdEbbD17dyGXg> <xmx:JMnkZSiUXpr4VngQ-8IZ-nqtClg49I0Bc-ckqASv_3efJ2EpIw_tifW0AW8> Feedback-ID: ie421460a:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id 853E8C60097; Sun, 3 Mar 2024 14:01:56 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.11.0-alpha0-205-g4dbcac4545-fm-20240301.001-g4dbcac45 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Message-Id: <1d8a7022-7aa5-44f2-8492-59321747eb56@app.fastmail.com> In-Reply-To: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> References: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> Date: Sun, 03 Mar 2024 13:01:36 -0600 From: robert@rrbrussell.com To: freebsd-ports@freebsd.org Subject: Re: How do I clear no-longer-usable packages from poudriere? Content-Type: text/plain;charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:29838, ipnet:64.147.123.0/24, country:US] X-Rspamd-Queue-Id: 4Tnrm70GXfz4qQm On Sun, Mar 3, 2024, at 12:33, David Wolfskill wrote: > I have a local package-builder that's (generally) been working quite > well for me since Jul 2015 (through a couple of hardware replacements, > sure, but the approach remains the same). > > Today, in trying to chase down what was causing my central "hub" machi= ne > to whine: > > ld-elf.so.1: /usr/local/lib/libtasn1.so.6: version LIBTASN1_0_3=20 > required by /usr/local/lib/libgnutls.so.30 not defined > > I found (via the "pkg_libchk" script from ports-mgmt/bsdadminscripts2) > that some just-installed packages are apparently expecting to use > libc.so.6, which hasn't existed on anything here since 18 February. > > (My machines run stable/14 for getting things done; the development > machines also track head, so I have some clue what's coming.) > > The package-builder also builds FreeBSD for its "client" machines. The > package-builder (and my laptop) track stable/14 daily; the > package-builder does a 2-pass weekend run of package-building (first > pass on Saturday, after updating FreeBSD; second on Sunday). Once the > packages are built, the client machines update FreeBSD (to the latest > snapshot from the package-builder, which is already running that code). > > The package-builder is thus running the same revision of FreeBSD that > the clients are about to run. And poudriere is using the > package-builder's /usr/src and /usr/ports to construct jails & build > stuff. > > I am trying to ensure a certain level of consistency, here. And today > appears to show that I have failed to do that. > > Is there something less drastic than clearing all poudriere caches of > packages and rebuilding all packages all over again??!? (that will get > me a set of packages consistent with the current state of FreeBSD > sources and ports (stable/14-n266921-8a7d5d73b849 and > main-n654175-6928d3a11398, respectively (at the moment)))? > > At least name resolution isn't broken this time, but printing seems to > have been a casualty. > > Peace, > david > --=20 > David H. Wolfskill david@catwhisker.org > Alexey Navalny was a courageous man; Putin has made him a martyr. > > See https://www.catwhisker.org/~david/publickey.gpg for my public key. > > Attachments: > * signature.asc Is this error in a Poudri=C3=A8re build log or spit out to the console w= hen running a command on a client? From nobody Sun Mar 3 19:12:34 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tns0N2gLkz5C7nW for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 19:12:36 +0000 (UTC) (envelope-from david@catwhisker.org) Received: from mx.catwhisker.org (mx.catwhisker.org [107.204.234.170]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tns0N0QY0z4s9d for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 19:12:35 +0000 (UTC) (envelope-from david@catwhisker.org) Authentication-Results: mx1.freebsd.org; none Received: from albert.catwhisker.org (localhost [127.0.0.1]) by albert.catwhisker.org (8.18.1/8.18.1) with ESMTP id 423JCYfP049207; Sun, 3 Mar 2024 19:12:34 GMT (envelope-from david@albert.catwhisker.org) Received: (from david@localhost) by albert.catwhisker.org (8.18.1/8.18.1/Submit) id 423JCYAX049206; Sun, 3 Mar 2024 11:12:34 -0800 (PST) (envelope-from david) Date: Sun, 3 Mar 2024 11:12:34 -0800 From: David Wolfskill <david@catwhisker.org> To: robert@rrbrussell.com Cc: freebsd-ports@freebsd.org Subject: Re: How do I clear no-longer-usable packages from poudriere? Message-ID: <ZeTLooNGfl241xB6@albert.catwhisker.org> Reply-To: freebsd-ports@freebsd.org References: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> <1d8a7022-7aa5-44f2-8492-59321747eb56@app.fastmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="ohpUncHRTBv9rt4N" Content-Disposition: inline In-Reply-To: <1d8a7022-7aa5-44f2-8492-59321747eb56@app.fastmail.com> X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:7018, ipnet:107.192.0.0/12, country:US] X-Rspamd-Queue-Id: 4Tns0N0QY0z4s9d --ohpUncHRTBv9rt4N Content-Type: text/plain; charset=iso-8859-1 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Sun, Mar 03, 2024 at 01:01:36PM -0600, robert@rrbrussell.com wrote: > On Sun, Mar 3, 2024, at 12:33, David Wolfskill wrote: > > I have a local package-builder that's (generally) been working quite > > well for me since Jul 2015 (through a couple of hardware replacements, > > sure, but the approach remains the same). > > > > Today, in trying to chase down what was causing my central "hub" machine > > to whine: > > > > ld-elf.so.1: /usr/local/lib/libtasn1.so.6: version LIBTASN1_0_3=20 > > required by /usr/local/lib/libgnutls.so.30 not defined > ... > Is this error in a Poudri=E8re build log or spit out to the console when = running a command on a client? > .... The above occurred (checking the typescript file) during "pkg install"; I also saw it while trying to run a command on the client machine. Checking the last set of poudriere build logs, I do not find any similar whines in any of them, nor do I find any in the typescript (from running "poudriere bulk"). Meanwhile, I am about to copy over a backup copy of libc.so.6 to try to work around the other part of this. Peace, david --=20 David H. Wolfskill david@catwhisker.org Alexey Navalny was a courageous man; Putin has made him a martyr. See https://www.catwhisker.org/~david/publickey.gpg for my public key. --ohpUncHRTBv9rt4N Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iNUEARYKAH0WIQSTLzOSbomIK53fjFliipiWhXYx5QUCZeTLoV8UgAAAAAAuAChp c3N1ZXItZnByQG5vdGF0aW9ucy5vcGVucGdwLmZpZnRoaG9yc2VtYW4ubmV0OTMy RjMzOTI2RTg5ODgyQjlEREY4QzU5NjI4QTk4OTY4NTc2MzFFNQAKCRBiipiWhXYx 5dlyAQC1N8RtM3OzLHAgRQ5PnSxiAA51qdv+HUISCYdV0kyJAgD/Q6uRPmpyAzV2 XeryPhiVEkOZ0Cn5HqmpuyYsFRwciQ8= =UxTX -----END PGP SIGNATURE----- --ohpUncHRTBv9rt4N-- From nobody Sun Mar 3 20:21:23 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TntXB4CGFz5CF8W for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 20:21:46 +0000 (UTC) (envelope-from robert@rrbrussell.com) Received: from wout2-smtp.messagingengine.com (wout2-smtp.messagingengine.com [64.147.123.25]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4TntXB2CRXz40Hx for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 20:21:46 +0000 (UTC) (envelope-from robert@rrbrussell.com) Authentication-Results: mx1.freebsd.org; none Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by mailout.west.internal (Postfix) with ESMTP id A0D9D320010B for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 15:21:44 -0500 (EST) Received: from imap52 ([10.202.2.102]) by compute1.internal (MEProxy); Sun, 03 Mar 2024 15:21:44 -0500 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rrbrussell.com; h=cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1709497304; x=1709583704; bh=gHrFH2w8GybCBvYl8x0l8y0Fyfhmq96t9rywwu72oVQ=; b= eVsl52XKCK4KJFVxn5ymS+qUqkdtJmIc5aQd7bfvKGPHMAGT91kXzYXZhDZmOzdw XhgB5WXRh7SkubZo+dAvZNkONcnN2AQIMcsMPgmrJqA7o08kzCUVbGrwgCu1IEAo 1wXGb8HxW4YTSFYS+U2C124YStFd7/Ts9SKW5Ne9gA8gKWbQF71c30dk3M5SNter laQG3XUIin5myIHvmUJTmViELdW+G4IdjPCRtzcSZJbf0yWP2d2tqKA0V3ZvxoMT k/ZHfnNNc2XoGKJZ1JdMaDjTxg2Okp3Lj9y36RXB7AOvsRl3aJ6x9JivaUFhZBuH wYP0dwMEQxTYb2YMTdbQ6Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :content-type:date:date:feedback-id:feedback-id:from:from :in-reply-to:in-reply-to:message-id:mime-version:references :reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1709497304; x= 1709583704; bh=gHrFH2w8GybCBvYl8x0l8y0Fyfhmq96t9rywwu72oVQ=; b=O XO0fCP/HzXBUzBUJJU7myYsZmaq5Yaw0YCkoY9pDoMRO64sUbu5dbmdeWYAl0e1D wR2noX1o8G0VWgivGAUDtqVX58G86BLBWvyYrSKBVc5rl1ZcjVGJnqaMy+f8v8Lr NkXxZBv5lBZfH+idziPyZ5+pxrPAcBWuQUDCcJWaUnXoqqOoymmP4cYQ7hM+vabw xyRevox2B6Oz0CPg4lxxprJ4j8vuDtYMJiPdYaEfmTiMQgp6ZG8ZltAo1+1WvGfu ypuTpnfVjEdw4+AethHZ4YwdojLHKFsF5/z0QDJ8CgzXOjpEGtGZpwKxl6qxze+P +nqTpSPDhM5xZre7iqOvQ== X-ME-Sender: <xms:19vkZY5qKhPYq_BkV9FW8bCXZ_5WNPozQ6Lo6iatxZSjAxdKhsS1VA> <xme:19vkZZ4OqesJo9Z5I3O-xtI4f2rFlpZu8xCc5RjZmfCLSvbM0Gen3L-xkMrbMcf5w i2QPdnybRBy_7uucYY> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvledrheehgddufeehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpefofgggkfgjfhffhffvufgtgfesth hqredtreerjeenucfhrhhomheprhhosggvrhhtsehrrhgsrhhushhsvghllhdrtghomhen ucggtffrrghtthgvrhhnpeekhedtleeffeffteeglefgfeekudehtdelvddvtdfhueefgf ehteevvedtffdtffenucffohhmrghinheptggrthifhhhishhkvghrrdhorhhgnecuvehl uhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomheprhhosggvrhhtse hrrhgsrhhushhsvghllhdrtghomh X-ME-Proxy: <xmx:2NvkZXeFJa_MLXTpkMQyZJMVIxB_S2NspIG9A6kXZ3wOdrsnFDHy4w> <xmx:2NvkZdIpeslTnvDmIbcohRRiJyvRPPhVkcPGAvpyy375QLeAeJHRqg> <xmx:2NvkZcI-cnCY6txDjjteIPmDzTEoZsaZwHApnh7fVrvERz6ccxR3-g> <xmx:2NvkZTk3eQ_hEXxsr8Vpc8SBkSVx99uWo0VLWbwSUtPD3648-t4oWA> Feedback-ID: ie421460a:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id E2428C60097; Sun, 3 Mar 2024 15:21:43 -0500 (EST) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.11.0-alpha0-205-g4dbcac4545-fm-20240301.001-g4dbcac45 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Message-Id: <9df2e4b6-c9b4-441f-91b3-c19454c6aac8@app.fastmail.com> In-Reply-To: <ZeTLooNGfl241xB6@albert.catwhisker.org> References: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> <1d8a7022-7aa5-44f2-8492-59321747eb56@app.fastmail.com> <ZeTLooNGfl241xB6@albert.catwhisker.org> Date: Sun, 03 Mar 2024 14:21:23 -0600 From: robert@rrbrussell.com To: freebsd-ports@freebsd.org Subject: Re: How do I clear no-longer-usable packages from poudriere? Content-Type: text/plain;charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:29838, ipnet:64.147.123.0/24, country:US] X-Rspamd-Queue-Id: 4TntXB2CRXz40Hx On Sun, Mar 3, 2024, at 13:12, David Wolfskill wrote: > On Sun, Mar 03, 2024 at 01:01:36PM -0600, robert@rrbrussell.com wrote: >> On Sun, Mar 3, 2024, at 12:33, David Wolfskill wrote: >> > I have a local package-builder that's (generally) been working quite >> > well for me since Jul 2015 (through a couple of hardware replacemen= ts, >> > sure, but the approach remains the same). >> > >> > Today, in trying to chase down what was causing my central "hub" ma= chine >> > to whine: >> > >> > ld-elf.so.1: /usr/local/lib/libtasn1.so.6: version LIBTASN1_0_3=20 >> > required by /usr/local/lib/libgnutls.so.30 not defined >> ... >> Is this error in a Poudri=C3=A8re build log or spit out to the consol= e when running a command on a client? >> .... > > The above occurred (checking the typescript file) during "pkg install"; > I also saw it while trying to run a command on the client machine. > > Checking the last set of poudriere build logs, I do not find any simil= ar > whines in any of them, nor do I find any in the typescript (from runni= ng > "poudriere bulk"). > > Meanwhile, I am about to copy over a backup copy of libc.so.6 to try to > work around the other part of this. > > Peace, > david > --=20 > David H. Wolfskill david@catwhisker.org > Alexey Navalny was a courageous man; Putin has made him a martyr. > > See https://www.catwhisker.org/~david/publickey.gpg for my public key. > > Attachments: > * signature.asc Okay, find out which package provides libtasn1.so.6 and do a forced rein= stall of it with pkg install -f. I ran into a similar issue recently wit= h the exported symbols list being updated without a revision update that= notified pkg of the change. A forced reinstall of the package solved th= e problem. Mine was a different library but the error message matches. From nobody Sun Mar 3 22:05:30 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tnwqy08NFz5CPXG for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 22:05:34 +0000 (UTC) (envelope-from bruce@hawaii-pacific.com) Received: from mout.perfora.net (mout.perfora.net [74.208.4.194]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.ionos.com", Issuer "GeoTrust TLS RSA CA G1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tnwqx0nWzz4Mbd for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 22:05:33 +0000 (UTC) (envelope-from bruce@hawaii-pacific.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of bruce@hawaii-pacific.com designates 74.208.4.194 as permitted sender) smtp.mailfrom=bruce@hawaii-pacific.com Received: from [192.168.0.93] ([147.81.40.99]) by mrelay.perfora.net (mreueus003 [74.208.5.2]) with ESMTPSA (Nemesis) id 0MeQHZ-1rVY7238kp-00QEnv for <freebsd-ports@freebsd.org>; Sun, 03 Mar 2024 23:05:31 +0100 From: bruce <bruce@hawaii-pacific.com> Subject: math/sage misc/xiphos To: "freebsd-ports@freebsd.org" <freebsd-ports@freebsd.org> Message-ID: <3f3c81a4-2494-cea4-c39b-8e9b12fa79a8@hawaii-pacific.com> Date: Sun, 3 Mar 2024 12:05:30 -1000 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:91.0) Gecko/20100101 Firefox/91.0 List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Provags-ID: V03:K1:87UYdV8D5nP1NWVUPvv8VM5HZCeJ0qKe92LjVL/p8u36/Don6Ke tfXYbYKQ4G7ndb9UDMCiyzX67E3HE8880eDvZz9cQBrlwdShyiVOr1fWMPiz012CiNwDVeP xJAAO4RnWFkHj4e/I01qgVL3+M7Pya+vf2O/3JIwNSzJcII6PFXmhhBVmlfrvyZY+cWHjGt 3B+0e6fGTi1aGc27/+7FQ== X-Spam-Flag: NO UI-OutboundReport: notjunk:1;M01:P0:kswBRjy1IMk=;Ejpiii//K3WsudyD6GlYbtRpjAz V6d6EQKETl56J6uWXfFLfFDaOA3Q0eGkTiTNl44IhEnDhAwmM5AwG9Y51aBSoG+7aIJD9KbzD qVc9YLgJMc+STaUmY3BnS1aF0HrkDHOuEiR9JBnYXqUboKICgNUYqhYAqwEWcrzKk/sPXWYvx MUfuWPApRd7uy1NcXnZsKDINDk7vkkZmP4mEqy/BjTs/0dp9qYY5GAs7ZlnIK6G44Cs4wDUzJ NYEIU7c8EMsEKSU8J+/uJrK7SsdHwUv2sSXi7+nZKLruz8csnWeOQ53gqtC3jyinAX+IdjzRC APPsC5PY4H/aJU+hbLypyukDBZYhH2zFQqyjMVTzN8fQMmhEuH9ar0F62QK33zPCWIjsve6ZU k1awoBCJD0NldaQOw/u+XuKNQu/qMUofqcJkhY6kM8weUl8Zw4zu02zV5pc7CDm4Tqo0FqL3h o09pugI/Cg0rhSHdNp4zjXTAalY/6V+Qtm1OcE2/Bs9mZFBysNOdj2Hvy7iYhHEJEq9GBGMAq CrHDQU1zbjlgBY1jbtIvLZ/PpTLlGAH18zXGC87sllHAK17yzxU2IhTx/2wCl8jWWeF6N0qvc qxaBgB128WCY2RiyiF1/3YfPQsrOu0ykK2amM9Kgd+bdGE2FrXXhf3lPtNGAPACeptR+kWnen iuRcm4jn2hj6NEE/816cBOSUmF6RC98zwhUXePfc0r/C30f2tRzla4hP7glveXGkblT1M65Jb SSgFoSzKpZqbGcy657AbKUN7OCllnuD//ofY7ZncE4wepFXULTdXCs= X-Spamd-Bar: / X-Spamd-Result: default: False [-0.77 / 15.00]; FORGED_MUA_MOZILLA_MAIL_MSGID_UNKNOWN(2.50)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-0.99)[-0.989]; NEURAL_HAM_LONG(-0.98)[-0.977]; R_SPF_ALLOW(-0.20)[+ip4:74.208.4.192/26]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; RWL_MAILSPIKE_GOOD(-0.10)[74.208.4.194:from]; RCVD_TLS_ALL(0.00)[]; TO_DN_EQ_ADDR_ALL(0.00)[]; DMARC_NA(0.00)[hawaii-pacific.com]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; ARC_NA(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:8560, ipnet:74.208.0.0/16, country:DE]; MIME_TRACE(0.00)[0:+]; PREVIOUSLY_DELIVERED(0.00)[freebsd-ports@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; MLMMJ_DEST(0.00)[freebsd-ports@freebsd.org]; MID_RHS_MATCH_FROM(0.00)[]; R_DKIM_NA(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[74.208.4.194:from] X-Rspamd-Queue-Id: 4Tnwqx0nWzz4Mbd What has happened to math/sage? The port still exists but hasn't built in well over a year. Also misc/xiphos. From nobody Sun Mar 3 23:03:53 2024 X-Original-To: freebsd-ports@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tny7k0JSdz5CVcB for <freebsd-ports@mlmmj.nyi.freebsd.org>; Sun, 3 Mar 2024 23:04:18 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Received: from APC01-TYZ-obe.outbound.protection.outlook.com (mail-tyzapc01olkn2042.outbound.protection.outlook.com [40.92.107.42]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "mail.protection.outlook.com", Issuer "DigiCert Cloud Services CA-1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tny7j1q7zz4VJv for <freebsd-ports@freebsd.org>; Sun, 3 Mar 2024 23:04:17 +0000 (UTC) (envelope-from tatsuki_makino@hotmail.com) Authentication-Results: mx1.freebsd.org; none ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=QYfk3MlbI8/DcWexyJEXS8ObHNN3+rpaZ+6p5QKEAl/4E0sSIHQMmVxuLWAEsqaKI0OzCpRNL6vzBOl66kYnvS+timYP3DcTiTcFER2jSCRgWHB8SeMVh3fwf/2psOqtvjoC1wNw19XjusL2Fikip9xul6IsQ21N7B2QKkJEdty/W3pCoor1yh/+QQvJvD+ASKdqnkAye/0gVS2lWtRmiMon+4nfDmHG+9ITMZ44AlNYJqwGTG7CMD7/ENDXQBPb4n3Ke0rlZX8sDNaVPH5YMMMW8Zv1iye3cJqVZNg5ZTuhrVnFTy0z6k5z/dU+2OA4bAuZTCCfG7FnhAqlrgSD+Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=ZrC0rDZhvC8uC7O5QuzFQ5zeuTnJ0jnuVZt96hFpV7c=; b=fnIg9cnNY3jIbbduZzjaAlYEwiWU5j7Glg7rNEXuaP66cnPaW6pTXE1YjG7yW37ptt/BFEITp2GbaxKi9ao2jxjkgQCZPS+Wbx7HuUtZXcVum9ZKWqk0cPWPv/u1FddnNwYo9aL4/JPloEmlJ6yKAbhRT4kHr4jTbSRJEm1ldA/u/SlzzpSJoABUKlkruRyd9yze5/Rh/XyZcczm9QoQeihBcMAUy1eZJ+PncnTF9S1xEDXf/yN0UImX5X8y9KZ7PY3IJ36aa3/hr2+mD0Lc+aYPdDZ9Jwf4WcJVBr/U0wu1yjKmHm16h1oI5qJo7L2KFreLKHEBq/vy4rml4p/QvQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none; dkim=none; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=hotmail.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=ZrC0rDZhvC8uC7O5QuzFQ5zeuTnJ0jnuVZt96hFpV7c=; b=kMuhXQ4waPOYDdGFal8yhrD0DeUKOQHBZwFMYN0LRiMj/ym5rd+dkXp3QB7Fd478mp554/CabiDiMGrTLJ4SaCvR1cgUxJ8u+rJKBbWyrNdCi63clUhLe/cSre2u2k4NNd5yzTubsZz/yi8hP8Qaj2Y7joisI+2YCPLvjlsoMKF5F5dqPjvN66VcPvj+RlQPUG8OXGSk1uOC5qmpW+B8QVEeKdIpaTjeWfSaSkz11JLGlU4faESoH8NF4T0vQyoJvabU6li6dQrE9TrStdqSbnpu3LOsVFKAMnwfPhHvM8PIXidbOMdVvMdeFaMg+h0nxYZIwY9dPYJM3PeKIr2KPw== Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) by TY0PR01MB5824.apcprd01.prod.exchangelabs.com (2603:1096:405:14::8) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7316.31; Sun, 3 Mar 2024 23:04:13 +0000 Received: from SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef]) by SI2PR01MB5036.apcprd01.prod.exchangelabs.com ([fe80::c37:9a9a:7a46:89ef%7]) with mapi id 15.20.7339.033; Sun, 3 Mar 2024 23:04:13 +0000 Subject: Re: How do I clear no-longer-usable packages from poudriere? To: freebsd-ports@freebsd.org, David Wolfskill <david@catwhisker.org> References: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> From: Tatsuki Makino <tatsuki_makino@hotmail.com> Message-ID: <SI2PR01MB503659B034FB871D749A13FDFA5C2@SI2PR01MB5036.apcprd01.prod.exchangelabs.com> Date: Mon, 4 Mar 2024 08:03:53 +0900 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 In-Reply-To: <ZeTCYZsGM1zpLKa9@albert.catwhisker.org> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-TMN: [KzWq9aoPXrq3yN1FFcY4PKbvKLAWEaRD] X-ClientProxiedBy: TYCP301CA0008.JPNP301.PROD.OUTLOOK.COM (2603:1096:400:386::6) To SI2PR01MB5036.apcprd01.prod.exchangelabs.com (2603:1096:4:1f8::9) X-Microsoft-Original-Message-ID: <eb178ba5-f983-6438-33af-0ebe241c67cc@hotmail.com> List-Id: Porting software to FreeBSD <freebsd-ports.freebsd.org> List-Archive: https://lists.freebsd.org/archives/freebsd-ports List-Help: <mailto:ports+help@freebsd.org> List-Post: <mailto:ports@freebsd.org> List-Subscribe: <mailto:ports+subscribe@freebsd.org> List-Unsubscribe: <mailto:ports+unsubscribe@freebsd.org> Sender: owner-freebsd-ports@freebsd.org X-BeenThere: freebsd-ports@freebsd.org MIME-Version: 1.0 X-MS-Exchange-MessageSentRepresentingType: 1 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: SI2PR01MB5036:EE_|TY0PR01MB5824:EE_ X-MS-Office365-Filtering-Correlation-Id: f6dea9cc-0604-42f8-abea-08dc3bd63dfe X-Microsoft-Antispam: BCL:0; X-Microsoft-Antispam-Message-Info: tNyknf9+XTPKvN0Q0T8X5uM0VSFA/cxT9ZoSheOAh2gjdwB2Cc031kVVryBZ5BQilb8rLc+zE+N2IzJzMvafXbtFq4B/fjeW1NMlCw+NTES7YmvOdlCBKFvAP7N+ofHOrxt+V5e/3Szx+tRQOIJ2OtN/Pmr/F1rJdeVMpr8iLUOqFXgqCWEYSnLhJ2VNXkw9yW0Du8qm+Hs0thFFPTSybGjLLMoUC9gB8v8d8uSpqb4kLURzWfFd/SGGzN2YdUvGtcANFudj/bZ7RWUQtSsY2+jk/NgMSoZltUL1wF63suyjV/vv81EfzY7UKlnUPqDOuGPwsmIbsQ3K++Qm43yRFX5V73c3/fdkSw5NuTy85SnZ6CMmrcfO3eVo60y5XKqlVWT3MriX7UJF7REtAWi4X92eBsVmqBewz5/cpwK/eazOdL1UP5hghLGuNv/uWE4kwQb0Azgu8iVyTD7gSWhrWA3QdIJoBSx82lWaMIHDVE1Q7FKKckiCLhnJj7eFj0048rOV+n0OOcDkm/H/E6RFrCj5TwUfwSKpsdYGIbp4p22ev2Pu/cSMPPgwwaR1T0v8HQG83gaZpDyi1lcyfbVwzT1Z6wy54rQ5OLCs7lfdLMA= X-MS-Exchange-AntiSpam-MessageData-ChunkCount: 1 X-MS-Exchange-AntiSpam-MessageData-0: =?utf-8?B?SGRZY04reWRuV3A3amRuRUdudkNPb2YwNG9YQWNVVHlBWUpWVkZ4Qi9rMU1w?= =?utf-8?B?S1JEaDZjb0UwOU9ldkFvL1A5cS83VEwyUjZvZ0ZjOG5UaXNnMmJrRjFBZStq?= =?utf-8?B?WFlWUGxDZHo5VlltN05YWVJtUTNLYnQwTytuUzVnU1c4N1JkeWlRRk4vM2Nx?= =?utf-8?B?ZS9TODAwWG5uUEpwa3YyMFl2czFXaTFIMTM3WmIvTmY5RWI5TzZoNzc0dHFq?= =?utf-8?B?VU9iWjQxZDB0Rk95ODdJc3ZCYmw1SWpkYWw4NlhodElTNktPaHczOTh6ZDla?= =?utf-8?B?b2ovZys0S0c4eHJoNFpMZVN2aFBydmNPQyt2WUlVOXBUMmRxOVFxU04wUkM3?= =?utf-8?B?UklaQmJuWGZQK25JMndCQTBlem9Qd0grK1Q2ZzJzalJQTmpRbTFWcTNjR0xB?= =?utf-8?B?d1ZyeHZGM2M1Tjk3SUNPcmk0ZklwcnJob0lGaCtLbm81OGwwODI2YWxwbU9T?= =?utf-8?B?aTV3NWZrVmdtRlM5eEVEcm5qL29sOExSOE54NUxuSi9oVHZKSGUrRFVJYlI1?= =?utf-8?B?U3NsT1l1aWJOUHd4SGcwS3RQMktBbWdBZnJBSmdtaGJOUWRDNUZFZGJKZWJQ?= =?utf-8?B?VWVnQzhLS01Ib0hjWGRzNmI0T08vdUVjVXd2OWFENjZQM2psQ1NEbi9OT0FY?= =?utf-8?B?NkhXRU52SzV5OUhHMytaeHUxd0VPamFGQkNmMWtiZFMyckR3VzkrR3Rva2Vs?= =?utf-8?B?bHJmVG0wVVBTdDRHT2xDMW1yUDFTS2FNTGx1dHBlRU5MU3F0YkU1ckJWdnVL?= =?utf-8?B?SjBPMFVMUTR3cHdabml3NjZpcUUvaG9aN3l4MytMaGt0UjdsdTloWGZNN0kw?= =?utf-8?B?UERrVVdQcnJHUXVWbzJVajM3MmU4ZnRiZERoRllkQWhsWWlpYjFGYlkvc2Vl?= =?utf-8?B?K1hkUEgvall5N1pYVXp1RmNkYUcvek1UUlg3aXdJcXZjVThESUlHaXJlTWZr?= =?utf-8?B?SXpLYWNQY3gvRCtCZ0NzcHVPM1RqM1Vsd1ZCYTY4WTZFRXdQaWl6bSs2OXM4?= =?utf-8?B?d0lyYVhIdi9yYXQvaFhGWjNPUG5wNjZ5OWh2OHlEbHhBelpLYnYwbm9id1cx?= =?utf-8?B?SjdoNzNQRFFOQXpoZDJoOVF4TTFBNXk4WWZPMDZORk5tQjNyMFlGRDVHLzRP?= =?utf-8?B?VEpvV2x2MGtoWXlpRHdNajJxdUpSTHNSaXFiempPeGVZR0JjU3JrSDVmQTdt?= =?utf-8?B?OU5DOTNuaGEzNW5odDhIaWdEdkhyYUZwTSsxQlRwcXdRTmtlRkU2ZzlyeFZz?= =?utf-8?B?alpCTnI0cEdSRkMrb3dXR1JlS3FoeVlJRk1jdWN2cUFJcXd6YzI3WXdLYjVS?= =?utf-8?B?TjdDcFJ2RXFvS3hvRWVSaFhXNGlrVCt3Nm9hZFdzTFZlWG5Jd3Z6YlFhSDlY?= =?utf-8?B?dEdvMGdDV2NoaXc0YVFvdUtmM0dSdkNSQUFhMFQ1bi84c2podjlWU0tNSXN2?= =?utf-8?B?d1hjbXcxYVlQd0ZBTUxQVXE3YlltcFRncjUrN2JvRXFTVUhPM1JEZVVPU2My?= =?utf-8?B?MVBqUDhzbHM1bk9xbm5CZkNkMU41RjdwMEwvU0U4bDJkZjNWdjdmZDFnZ0Jn?= =?utf-8?B?dmpKS1h1OTR3b21lbjRvc0FrUGQ4R2krM1A2SzgrS09PYTZUSEl0WUc4UFBl?= =?utf-8?B?NnpRUEQwdzdMYm5MRjZrcEFsZ0RBWEVmTUJUUDJTdWdlL3Z0NnZuRHJRbExN?= =?utf-8?Q?68uU6LKQNazixuE974Ql?= X-OriginatorOrg: sct-15-20-4755-11-msonline-outlook-d8e84.templateTenant X-MS-Exchange-CrossTenant-Network-Message-Id: f6dea9cc-0604-42f8-abea-08dc3bd63dfe X-MS-Exchange-CrossTenant-AuthSource: SI2PR01MB5036.apcprd01.prod.exchangelabs.com X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-OriginalArrivalTime: 03 Mar 2024 23:04:13.1475 (UTC) X-MS-Exchange-CrossTenant-FromEntityHeader: Hosted X-MS-Exchange-CrossTenant-Id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000 X-MS-Exchange-Transport-CrossTenantHeadersStamped: TY0PR01MB5824 X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:8075, ipnet:40.80.0.0/12, country:US] X-Rspamd-Queue-Id: 4Tny7j1q7zz4VJv Hello. David Wolfskill wrote on 2024/03/04 03:33: > ld-elf.so.1: /usr/local/lib/libtasn1.so.6: version LIBTASN1_0_3 required by /usr/local/lib/libgnutls.so.30 not defined I don't know what it. If you want to have them rebuilt only for those packages in poudriere, the command will be as follows. poudriere bulk -j somejail -C security/gnutls security/libtasn1 Is this it? Regards.