From nobody Mon Mar 18 01:27:19 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tycfl3prsz5FHfP for ; Mon, 18 Mar 2024 01:27:43 +0000 (UTC) (envelope-from me@wesleyac.com) Received: from wfhigh4-smtp.messagingengine.com (wfhigh4-smtp.messagingengine.com [64.147.123.155]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tycfl1KhGz549K for ; Mon, 18 Mar 2024 01:27:43 +0000 (UTC) (envelope-from me@wesleyac.com) Authentication-Results: mx1.freebsd.org; none Received: from compute5.internal (compute5.nyi.internal [10.202.2.45]) by mailfhigh.west.internal (Postfix) with ESMTP id 17C8E18000E6; Sun, 17 Mar 2024 21:27:41 -0400 (EDT) Received: from imap45 ([10.202.2.95]) by compute5.internal (MEProxy); Sun, 17 Mar 2024 21:27:41 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=wesleyac.com; h= cc:cc:content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm3; t=1710725260; x=1710811660; bh=AYeTF6tJjk IQQHzbSIVL4BWyRWbOthv4673cfDTiSs4=; b=baMktyttntK8CHp3tSwIaUPWHb EK4tPkJSD58vMZgniyGp04/SYRpp95Tkv5NZFegAxSkS/Z5yupvzBUgBUIFjoCdg nOdYMIml3W+m650WoFVhbzW48q1rvovyzJs6g1m7XjWe/EyIsSfaBYPNoTPqUutq 88TPcmiwHdjQ0+ntPNquy4wCpb8OPWOj/ivM0gwkD19viOUmgzLAA9XHlSWGZ4bM WVLLZFWzHiL+1cu6kPHqmZb9C5szpiuWH3uZXNxXu9reBjC/3ZjRk4CJUlD87NQS 4aHdsAYfSOPhcRkQKKOwDiPxIsj57iH4XRxBE0fFg5a9VE0jQsLOK6xyvQUg== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1710725260; x=1710811660; bh=AYeTF6tJjkIQQHzbSIVL4BWyRWbO thv4673cfDTiSs4=; b=wm6l6PjZwnkUcAFHHcDxXp+nJtK/A5btmMWr/BZDvVaB XcKlHyVGloXdZSyrEwDtlY0g+P9XC2UlG2WeiXoIT9+kpurwpMQcGckpbEDB+Hpp D/ayROJOuQdPIMJEb8Mn4gK63DYRulKQoFiHnDoJxELw9pc2U4tqmTgAZ+OY46yr HxNgYK+NJdDb9C1uG8H0Uy+BGTxLgbMHZCd5y6VJsSXjTbTAkI/T2aFImWb8KuEE bc2DWeZFGRQnaFxpkTMEfD9WmUdeQtMeaNeEgtdCTHIugY3O4guXRaeIdAD3fm+X gz84UZZjYPkTPAZWzoQHQDmV3IVD6i3fWDRcxR767g== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvledrkeeigdefhecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefofgggkfgjfhffhffvvefutgesthdtredtreertdenucfhrhhomhepfdghvghs lhgvhicutehpthgvkhgrrhdqvegrshhsvghlshdfuceomhgvseifvghslhgvhigrtgdrtg homheqnecuggftrfgrthhtvghrnhepgffggeeliedvgefgjeeggeevffeuvefffefhjeel vdehheduueelgeehgfefjedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpe hmrghilhhfrhhomhepmhgvseifvghslhgvhigrtgdrtghomh X-ME-Proxy: Feedback-ID: i0c594533:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id 2F060272007C; Sun, 17 Mar 2024 21:27:40 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.11.0-alpha0-300-gdee1775a43-fm-20240315.001-gdee1775a List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Message-Id: <12846907-f22f-4bc3-bde9-5fef439d0a36@app.fastmail.com> In-Reply-To: References: <6aee40eb-d7ac-4163-93a9-ae746da65c82@app.fastmail.com> Date: Sun, 17 Mar 2024 21:27:19 -0400 From: "Wesley Aptekar-Cassels" To: "Lexi Winter" Cc: freebsd-questions@freebsd.org Subject: Re: Filtering incoming WireGuard traffic with pf? Content-Type: text/plain X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:29838, ipnet:64.147.123.0/24, country:US] X-Rspamd-Queue-Id: 4Tycfl1KhGz549K On Sun, Mar 17, 2024, at 7:05 AM, Lexi Winter wrote: > what's likely going on here is that your local machine (the one running > pf) is creating an outgoing connection to the Wireguard peer, which pf > allows because of the 'pass out' rule. then because pf keeps state by > default, the return traffic is also allowed, and there's no need for an > incoming rule. > > you could test this by blocking traffic on the Wireguard port on both > ends of the tunnel; that should prevent the Wireguard connection from > coming up at all. however, you'll need to disable both ends of the > peers for a few minutes before testing, to make sure any existing pf > state has expired. Indeed, this was it, thanks. I was confused because I did have the same pf configuration on both machines, but I must have pinged them both from each other via the wireguard IPs, so each one was allowing traffic from the other as return traffic. I now have the following pf rule added, and everything works as expected: pass in on $ext_if proto udp from X.X.X.X to ($ext_if) port 51820 Thanks for the help! :w From nobody Mon Mar 18 21:08:08 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tz6ry2cTmz5F195 for ; Mon, 18 Mar 2024 21:08:18 +0000 (UTC) (envelope-from fquest@paz.bz) Received: from emailh.ca (emailh.ca [23.235.65.100]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tz6rx3smqz4Qy5 for ; Mon, 18 Mar 2024 21:08:17 +0000 (UTC) (envelope-from fquest@paz.bz) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of fquest@paz.bz designates 23.235.65.100 as permitted sender) smtp.mailfrom=fquest@paz.bz Received: from d75-155-251-24.bchsia.telus.net ([75.155.251.24] helo=[192.168.1.68]) by emailh.ca with esmtpsa (TLS1.3) tls TLS_AES_128_GCM_SHA256 (Exim 4.94.2) (envelope-from ) id 1rmKDJ-0001Ml-3M; Mon, 18 Mar 2024 14:08:09 -0700 Message-ID: Date: Mon, 18 Mar 2024 14:08:08 -0700 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird To: freebsd-questions@freebsd.org Content-Language: en-US From: Jim Pazarena Subject: reboot forcing a fsck Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.29 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; NEURAL_HAM_MEDIUM(-1.00)[-0.999]; R_SPF_ALLOW(-0.20)[+ip4:23.235.65.64/26]; MIME_GOOD(-0.10)[text/plain]; XM_UA_NO_VERSION(0.01)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:852, ipnet:23.235.64.0/20, country:CA]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_ALL(0.00)[]; R_DKIM_NA(0.00)[]; MLMMJ_DEST(0.00)[freebsd-questions@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[paz.bz]; TO_MATCH_ENVRCPT_ALL(0.00)[]; ARC_NA(0.00)[] X-Rspamd-Queue-Id: 4Tz6rx3smqz4Qy5 I have a server which seems to have a fs issue for my exim folder. an "ls -l" hangs. anything going near the exim folder hangs - for whatever reason. If I trigger a 'reboot', I assume the boot process will automatically enter a fsck as per the documentation. What is unclear is if the system will eventually g et to multi-user mode, or hang at a CLI question from the fsck? I have no hands or eyes available to be there. This is a bare metal chassis not a vm. Would appreciate learning the procedure which fsck uses during a boot. (beyond what the man fsck advises) which seems to exclude this question. Thanks -- Jim Pazarena fquest@paz.bz Haida Gwaii - British Columbia - Canada From nobody Tue Mar 19 00:36:03 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TzCT16tRGz5FLdN for ; Tue, 19 Mar 2024 00:36:21 +0000 (UTC) (envelope-from kob6558@gmail.com) Received: from mail-yw1-x1129.google.com (mail-yw1-x1129.google.com [IPv6:2607:f8b0:4864:20::1129]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TzCT158MPz4nBX for ; Tue, 19 Mar 2024 00:36:21 +0000 (UTC) (envelope-from kob6558@gmail.com) Authentication-Results: mx1.freebsd.org; none Received: by mail-yw1-x1129.google.com with SMTP id 00721157ae682-60a0579a968so53797747b3.3 for ; Mon, 18 Mar 2024 17:36:21 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1710808580; x=1711413380; darn=freebsd.org; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:from:to:cc:subject:date:message-id:reply-to; bh=sselGQQ523pgv6dubV59Hluy6q8n6MyTQS5SP8xAc2c=; b=IuTFxocOdlNDLfzOHSAdzwnk0FTz6hM8gRE8VJzxF3nX2vI1hFr+Mzcy1Kpkk1/m+f LramnSLt20/FYmLZOuOYMGQ0SpWBF+URGbPo8h1fCJKdaBbOf803sWGhhq7FyXMAaqBQ f293SdtA42C21p8DnHirZ5aHpbyeuTeZFp9Rw6FNP5R24qujj5QCtFEgjTKt3zWUwO5D nuVka5ykVZWvgfqEpbV6+fOafNUFRBSLHFUnTBhTWI3G2p6pE8oQfH8DHvvt8C3sSOpE P3Lm9+5qHnwKbkto0Hv7juri11PnNjLk5GQfBdxm0btTdxMRLwkzeQJ6KLKZjSMyKwgJ vpQg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1710808580; x=1711413380; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=sselGQQ523pgv6dubV59Hluy6q8n6MyTQS5SP8xAc2c=; b=l8mYgyzZW+JgPqxWFtu//oDFe/6fpg8UIzNKMHeRpL4p8fa9i8Jl3vfNLCjkmL40t4 HXwOzxU+NZJMN9MbB/hnuDOel9M00R81qAMIy7hVPehHd+T9ULbRyL4bMuMFmOQglfyj N4NFr7yXbUJKFLFd5bF2RlSVIo6EN5QdkfcxTOnCIbb7DMTJcZesOUzeFY8S/C3Yjps7 Iwqoud96SnjWUYcqShgY3OhfsEEenkXOM0+q2xuENGJ0LfkA5R6y2JC1jcen7VQl+QbG Dl8RTJ9tiecIiSAfkjicArbBsYsyqS0Vk4AWK5h94hjROzts1T24a0y6aXCoztmV3oyH 64vw== X-Gm-Message-State: AOJu0YymuzJar9Q6l2z08CBg4WBwRfFc+tKZbjgVAai++63tgvODxtV5 frOGVnmAgxKFxU+Ntpe6bk5LiN5vqarp4nyL8UilyZS1NQo/IR81V0PiW5Dtr9X/Qbfw/eQDpOn FciSdpwgS64ZKYcQn8KBLEIMq1BU= X-Google-Smtp-Source: AGHT+IET7HFY1o12qD/eMoJT9UsFakNcomzCwWRlK2lAhHpcl6qv9o2RBjqdCWgrRQryHeUPfdbZkEVkbCmiRYPxIOM= X-Received: by 2002:a25:d60b:0:b0:dc2:2799:981a with SMTP id n11-20020a25d60b000000b00dc22799981amr9374872ybg.18.1710808580107; Mon, 18 Mar 2024 17:36:20 -0700 (PDT) List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 References: In-Reply-To: From: Kevin Oberman Date: Mon, 18 Mar 2024 17:36:03 -0700 Message-ID: Subject: Re: reboot forcing a fsck To: Jim Pazarena Cc: freebsd-questions@freebsd.org Content-Type: multipart/alternative; boundary="000000000000b23acb0613f8a93f" X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US] X-Rspamd-Queue-Id: 4TzCT158MPz4nBX --000000000000b23acb0613f8a93f Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Mon, Mar 18, 2024 at 2:08=E2=80=AFPM Jim Pazarena wrote: > I have a server which seems to have a fs issue for my exim folder. > an "ls -l" hangs. anything going near the exim folder hangs - for > whatever reason. > > If I trigger a 'reboot', I assume the boot process will automatically > enter a fsck as per the documentation. > > What is unclear is if the system will eventually g et to multi-user > mode, or hang at a CLI question from the fsck? > > I have no hands or eyes available to be there. This is a bare metal > chassis not a vm. > > Would appreciate learning the procedure which fsck uses during a boot. > (beyond what the man fsck advises) which seems to exclude this question. > > Thanks > > > -- > Jim Pazarena fquest@paz.bz > Haida Gwaii - British Columbia - Canad Booting the system will check that the root is marked CLEAN. If it is not CLEAN, and it should not be in the case you describe, it will attempt an fsck. If the fsck finds a problem, it will prompt you to select a shell. 'ENTER' runs the default, sh. You can try something like 'fsck -y VOLUME'', but it really depends on the file system settings. You can print these with 'tunefs -p VOLUME'. If journaling is enabled, you should run an 'fsck -f VOLUME' to perform a full fsck on the volume, ignoring the journal. Assuming journaling is enabled, which is default, the journal may be bad, so only an fsck -f can repair hte file system. --=20 Kevin Oberman, Part time kid herder and retired Network Engineer E-mail: rkoberman@gmail.com PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39EF1B055683 --000000000000b23acb0613f8a93f Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Mon, Mar 18, 2024 at 2:08=E2= =80=AFPM Jim Pazarena <fquest@paz.bz> wrote:
I have a server which seems to have a fs issue fo= r my exim folder.
an "ls -l" hangs. anything going near the exim folder hangs - for=
whatever reason.

If I trigger a 'reboot', I assume the boot process will automatical= ly
enter a fsck as per the documentation.

What is unclear is if the system will eventually g et to multi-user
mode, or hang at a CLI question from the fsck?

I have no hands or eyes available to be there. This is a bare metal
chassis not a vm.

Would appreciate learning the procedure which fsck uses during a boot.
(beyond what the man fsck advises) which seems to exclude this question.
Thanks


--
Jim Pazarena=C2=A0 =C2=A0 =C2=A0 =C2=A0 =C2=A0fquest@paz.bz
Haida Gwaii - British Columbia - Canad

Booting the system=C2=A0 will check that the root is marked CLEAN. If it i= s not CLEAN, and it should not be in the case you describe, it will attempt= an fsck. If the fsck finds a problem, it will prompt you to select a shell= . 'ENTER' runs the default, sh.

= You can try something like 'fsck -y VOLUME'', but it really dep= ends on the file system settings. You can print these with 'tunefs -p V= OLUME'. If journaling is enabled, you should run an 'fsck -f VOLUME= ' to perform a full fsck on the volume, ignoring the journal. Assuming = journaling is enabled, which is default, the journal may be bad, so only an= fsck -f can repair hte file system.
--
Kevin Oberman, Part time kid herder and retired Network Engineer
E= -mail: rkoberman@g= mail.com
PGP Fingerprint: D03FB98AFA78E3B78C1694B318AB39E= F1B055683
--000000000000b23acb0613f8a93f-- From nobody Tue Mar 19 00:44:53 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TzCg060gfz5FLjl for ; Tue, 19 Mar 2024 00:45:00 +0000 (UTC) (envelope-from grog@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TzCg05XC4z4pdq; Tue, 19 Mar 2024 00:45:00 +0000 (UTC) (envelope-from grog@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1710809100; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=UBk1YNnhrkBNbWQwBoJ1kszcxTwzo+/Nmm6FFGhuz5I=; b=ncEd18Jh1HuOpracwrVjhXEiLPMjw1zZ5z6iJz5+KeqzTrNnMsvrIeUvkr/NCUtNd3iZOw S47RajfCJFPJIfCK/qgshBdviHZeV1C70jiSSM7GGBx1X768uRFnQ0+RlN2mWjPLKyuvhw S2hgXnc1xuHpQos8EoifOnPzpopfi9IevU3OvxB6RnRx2QyXj8a6WX3DO02olZBK0nXYB3 6OvObLew2ZmkdO8Za/nHmQpAr5a7jXwYOP2HFQTUVNVekXAtnvRv35X57bXxy3QhsuPxce pD4fStF3EWYY4IBMu5d60JPznrTXkjzjwcTZAJ02EMP/TPtwXnCV9q+K8KWofg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1710809100; a=rsa-sha256; cv=none; b=ceuZgoTDygoqiPSQCaRq1n+rqeei8zwtx+/M/1/D5YvOJvJFZtUbQFYXDtXwoHug0hLWmk 3LfJ2sOfrdzEILSnmdLc4cnWkF3A+ntE7FlxTng1fpEwZR3J2bsa06aRmfU+ImygV9/1Oq zjVWIRgC3rcEG7F4v3SLNJSgTO9v+K53bpwNjju/pR+GMUAhxr8fWpJqtS4/EYgYJbQvZt /1w5RqSMjBz14UihFYp0BQNXJOG6/8+3861tlow7+ueOZcPyjoepndVvrhbgat2C1YcRZ2 JJSMd7ObPCbqCK8ciazhs2VS8w+/r9oxgieFAlxnERc8CBE//EfKqAnFDuk12A== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1710809100; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=UBk1YNnhrkBNbWQwBoJ1kszcxTwzo+/Nmm6FFGhuz5I=; b=Hzs1thR8343NHJ2j58mYhjc4yHo0p67CBf0aUd7l11q8GTIU0PZW3uBAdLbaTm/Czjan/t w6j2+fMrJlA54OnQemSntTjYxU+gs54alKLOSgJTQQR9Zy+uJQy0v1ylAlNnDlQjiScmBk +8noVURAf28vSA92QrJ0dEoQWef0ugYlD6Z2S1nV1ZzF/ciTFR/NP6hl4m1Sj+adkrwBe8 71F96l31OIiTps19/yhSeGudq53Y0cyfKKHdS4OT2Utreib9WY0Za77RKBjksTxJJ1zaWZ 4UKaRO8Cal5CEa82TeZChxJkL9FpN68QW4JJ4+LfpjcnRxiK5YGHBkUZm0JyTA== Received: from hydra.lemis.com (121-200-11-253.79c80b.mel.nbn.aussiebb.net [121.200.11.253]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: grog/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TzCfz4HvHzWJG; Tue, 19 Mar 2024 00:44:59 +0000 (UTC) (envelope-from grog@freebsd.org) Date: Tue, 19 Mar 2024 11:44:53 +1100 From: Greg 'groggy' Lehey To: Jim Pazarena Cc: freebsd-questions@freebsd.org Subject: Re: reboot forcing a fsck Message-ID: References: List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha1; protocol="application/pgp-signature"; boundary="Ibb/69U0wb+n2O7M" Content-Disposition: inline In-Reply-To: Organization: The FreeBSD Project Phone: +61-3-5309-0418 Mobile: +61-490-494-038. Use only as instructed. WWW-Home-Page: https://www.FreeBSD X-PGP-Fingerprint: 9A1B 8202 BCCE B846 F92F 09AC 22E6 F290 507A 4223 --Ibb/69U0wb+n2O7M Content-Type: text/plain; charset=us-ascii Content-Disposition: inline On Monday, 18 March 2024 at 14:08:08 -0700, Jim Pazarena wrote: > I have a server which seems to have a fs issue for my exim folder. > an "ls -l" hangs. anything going near the exim folder hangs - for > whatever reason. When you say "folder", do you mean a directory or a file? I'm assuming directory. > If I trigger a 'reboot', I assume the boot process will > automatically enter a fsck as per the documentation. If the file systems are marked "clean", the boot process doesn't perform an fsck. Current versions of reboot don't seem to provide the possibility of forcing fsck on reboot. The best you could do would be the -n option, about which the man page says "This option should probably not be used." > What is unclear is if the system will eventually g et to multi-user > mode, or hang at a CLI question from the fsck? Yes, this is unclear. If you do get into fsck, and it can't find a solution, it will prompt for an action. > I have no hands or eyes available to be there. This is a bare metal > chassis not a vm. That's a problem. A number of possibilities, none of them good: - Assuming that this is a directory, does ls without the -l option work? That only reads the directory, while -l also reads the inodes referenced in the directory. If so, you can potentially identify the damaged file and rename it to something harmless. Don't try to delete it; that could cause more problems. - Rename the folder and create a new one with the correct name. - umount the file system on the running system and try running fsck. If this is possible, it's probably the best choice. - run fsdb. That's arcane, and I don't know how to use it either. It could at least give you some insight into what's wrong. Ultimately, though, you're going to have to consider console access to the machine. > Would appreciate learning the procedure which fsck uses during a > boot. (beyond what the man fsck advises) which seems to exclude > this question. There's some information in the description of the -F and -B options. What else would you like to know? Greg -- When replying to this message, please copy the original recipients. If you don't, I may ignore the reply or reply to the original recipients. For more information, see http://www.lemis.com/questions.html Sent from my desktop computer. See complete headers for address and phone numbers. This message is digitally signed. If your Microsoft mail program reports problems, please read http://lemis.com/broken-MUA.php --Ibb/69U0wb+n2O7M Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iF0EARECAB0WIQSaG4ICvM64RvkvCawi5vKQUHpCIwUCZfjgAQAKCRAi5vKQUHpC I7HlAKCmTtsxVzYbzcijsSENUwmQExN1cQCfXW6hxT7I7JXn66TyzCjZxTZ3rdQ= =Gf2b -----END PGP SIGNATURE----- --Ibb/69U0wb+n2O7M-- From nobody Tue Mar 19 02:43:56 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TzGJH2Xqjz5FY6y for ; Tue, 19 Mar 2024 02:43:59 +0000 (UTC) (envelope-from des@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TzGJH1y42z53vD; Tue, 19 Mar 2024 02:43:59 +0000 (UTC) (envelope-from des@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1710816239; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=X/SPag5kIHFUkeEN/Ii6ENxMHDP0QgcZ1SVh+y9vKSE=; b=FoVzuU6Kw/aAWoRAvweXF97+PoVo4JaD0XdtG0J9+H1YKmVbJfLu3uLOPingL5f2wDjhID xpq3WZ0BevnJbD3EDlJAOfiPQy3OUVJq570MDFYbPUv7YB3wH3/e8X1FN+ms4U13qoGzpT K1O3OV71YZHhDTlQgDx8G9DNMXXeyy+L2sA5pw9cVcUPHdhiyIyCMqLE2xf7stvsY8Ootu PTJ+znBMUuUSMNV6Mg3wOvuYD7vDB6uEbPPHnWHp54rmv5c42zz/fDzTAHeFdOEsgpUKD2 3vk8ld3FEp+shXv/pU6syV4wf5sEh6ssGdpmXUl+udTZz8oqHYd0CxW5fNKSAQ== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1710816239; a=rsa-sha256; cv=none; b=Ea2bpd8XuQTjPwLIqsVjfxDACBtdsaCDCFZMk3Qd3HBasW9+wVhb+f2ZK+v07qWfsoq0i8 N2NtwD359PBV0ongEYRuK42bAhVSaIvuAtKe0oVhKQ+/fql7sHR532k8Ok+/bUNiOVhQ6s YcsjNrBI2oG6nF++ptuytA3oev+lAO7svw+aj23kKMgMYfzphhtsv9i/JfkTeTwriZEY7C Equxctx82CaSoS5lDt+FgPbPhKa0QZoUKXmCXRPbGPgmy7rN57wT8JGZj1TNjMD4S9eT83 bTq0mnTXxs/Txl81akg7R9RNQNUicpQ+Z5Fe8cd2jfFKs6kuMqttSJ7NCMEl4Q== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1710816239; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=X/SPag5kIHFUkeEN/Ii6ENxMHDP0QgcZ1SVh+y9vKSE=; b=LAQu+w6aS2zEkuofo9inRn/PJVF1U26VPJOt1mO4qNnjfXEaX+KOqADOl83XmaplGKrEHZ W7lITxmiskP8bbE9Sl++fi1Schs1jQkMUXXunfb4BlFcb9CwBb213V7KgQmPkMX3ELBJD8 MGV1GpTzkSDKGWl/kxQLc3CnPAj+leEvgq9RmFaWUOD5MRaE9Ovq2HgFC9MLNnEKYhvW6e VRrRx+iHcIRYQp3PP7kN/rYTF3H2zvXi819D6y06tpK+mMLnbwRRg2pfYVUIaYW1qP1k5T B4aKZI6PDDg19tCYSTDYP3B31si6wFRk8XRvLfMzNf1c46rGZuc1gAzv64ZNGg== Received: from ltc.des.dev (2a02-8428-0993-f001-922e-16ff-fef1-acef.rev.sfr.net [IPv6:2a02:8428:993:f001:922e:16ff:fef1:acef]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: des) by smtp.freebsd.org (Postfix) with ESMTPSA id 4TzGJH0pmzzYNF; Tue, 19 Mar 2024 02:43:59 +0000 (UTC) (envelope-from des@freebsd.org) Received: by ltc.des.dev (Postfix, from userid 1001) id 669FB78618; Tue, 19 Mar 2024 03:43:56 +0100 (CET) From: =?utf-8?Q?Dag-Erling_Sm=C3=B8rgrav?= To: Jim Pazarena Cc: freebsd-questions@freebsd.org Subject: Re: reboot forcing a fsck In-Reply-To: (Jim Pazarena's message of "Mon, 18 Mar 2024 14:08:08 -0700") References: User-Agent: Gnus/5.13 (Gnus v5.13) Date: Tue, 19 Mar 2024 03:43:56 +0100 Message-ID: <86il1jgcur.fsf@ltc.des.dev> List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Jim Pazarena writes: > I have a server which seems to have a fs issue for my exim folder. > an "ls -l" hangs. anything going near the exim folder hangs - for > whatever reason. You say that `ls -l ` hangs. In addition to reading the directory itself, `ls -l` reads the metadata of every directory entry and sorts them by name. This can take a long time if there is a large number of entries. To avoid this, and make sure you're only running ls itself and not an alias or an alternate implementation, use `/bin/ls -a ` to get a plain listing. If that works and no entries appear to be corrupted, try `ktrace -f /tmp/ktrace.out /bin/ls -al `. If that hangs, running `kdump -f /tmp/ktrace.out -tcn | tail` in another terminal will tell you where it's stuck. > If I trigger a 'reboot', I assume the boot process will automatically > enter a fsck as per the documentation. > > What is unclear is if the system will eventually g et to multi-user > mode, or hang at a CLI question from the fsck? Assuming UFS with soft updates (`sysctl -n kern.features.softupdates` should print 1), you can run `fsck_ffs -B ` to perform limited checks on a mounted filesystem without rebooting. You can also add the following to /etc/rc.conf to force a more thorough fsck on reboot: background_fsck_enable=3D"no" fsck_flags=3D"-fy" Beware that this can take a long time. You will want to revert these changes (especially fsck_flags) once the situation is resolved. DES --=20 Dag-Erling Sm=C3=B8rgrav - des@FreeBSD.org From nobody Tue Mar 19 06:18:23 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TzM422ZDBz5DcXt for ; Tue, 19 Mar 2024 06:18:42 +0000 (UTC) (envelope-from freebsd@edvax.de) Received: from mout.kundenserver.de (mout.kundenserver.de [217.72.192.73]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (P-256) server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "mout.kundenserver.de", Issuer "Telekom Security ServerID OV Class 2 CA" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TzM413xXQz45xL for ; Tue, 19 Mar 2024 06:18:41 +0000 (UTC) (envelope-from freebsd@edvax.de) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=edvax.de; s=s1-ionos; t=1710829115; x=1711433915; i=freebsd@edvax.de; bh=DRw2D/XdNC2N4lDFMknV7v5iYUe9M+AcfWoeQtYGjXo=; h=X-UI-Sender-Class:Date:From:To:Cc:Subject:In-Reply-To:References: Reply-To; b=qM8NgGt4A/CYLMJWhklCUYmHP7ktUgd0EkH0SsLRGPAOBI9OCrUO3MR7o6MOAino 1ksa/eIE72H//y1euISV58yrWpAEJ12EXoRMuT14GRwNecax6XNSUnhWQ022wEvx3 Dp9gfnBfyyZDu16zUjdORO5gG7n4GndyBFaLqOfrRNIWqq8vs/C8Pgwa6Qa8JnPKJ hlJ1ZsVYBxL/hdJhYMOgr4tLAev1pjDp5QnQ++t5qlfQ3ORHYBpM/rp8MZ6zAcWIN zh2qM2apfkgFiuom4etMnKaV1LkrsmtlL361436qfYizvUfEj4VBB29F/N9DDtjfc 044Dr6+W2HcJ+Ao9Ig== X-UI-Sender-Class: 55c96926-9e95-11ee-ae09-1f7a4046a0f6 Received: from terra.edvax.de ([178.5.235.62]) by mrelayeu.kundenserver.de (mreue107 [213.165.67.113]) with ESMTPSA (Nemesis) id 1M3UIe-1rn0ll1Cr4-000ae8; Tue, 19 Mar 2024 07:18:35 +0100 Received: from r56.edvax.de (r56 [10.200.1.11]) (authenticated bits=0) by terra.edvax.de (8.17.1/8.17.1) with ESMTPA id 42J6ISDI043843; Tue, 19 Mar 2024 07:18:29 +0100 (CET) (envelope-from freebsd@edvax.de) Date: Tue, 19 Mar 2024 07:18:23 +0100 From: Polytropon To: Jim Pazarena Cc: freebsd-questions@freebsd.org Subject: Re: reboot forcing a fsck Message-Id: <20240319071823.cfa99f36.freebsd@edvax.de> In-Reply-To: References: Reply-To: Polytropon Organization: EDVAX X-Mailer: Sylpheed 3.1.1 (GTK+ 2.24.5; i386-portbld-freebsd8.2) List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: quoted-printable X-Provags-ID: V03:K1:bWTQIkoe1nUfyGFJ0eTn4vsopzG/aABqggVAwGRr9H3ZIJxudUB CO27F0InPRphwWx9MPYrkkBb5H1rBj2hocDBCbaEsC5Ho8HUKDwscgWtpDGH459ChfG2Vj2 G7hlpPaA37rBAKoRToPQNPryWS58A+rdY9sQ6Dt+c1fwE5VpxCgFGhOmsfL0mKTXzeiUf4a sXFru5qf4SFtYznv2kwJg== X-Spam-Flag: NO UI-OutboundReport: notjunk:1;M01:P0:dfLW/yucW04=;ERNFG8k3WtNso/4EWTk2PvpygHO 0AXT2yYIse9P0cH1iP7rIEIZBGPaMoqsyU+aGztRtS94dF0R5B829ZePvwQwZM7JA1cyY2BXm SQxch6kn2g1r1UROHC74XjTyXD2keyebHBXaAPNPh01Eok70jF8OPHl6DfTPcafB7iq62LSlH pXnhyh3yZGBNGpa7P3cZ/U+sX+5yGkOT7W8nlVFskJFcVWLWMtDagOCLCmlH9NMZoraU7v4mw WpyngcWlpaFUnyxcWMa4e4c9sbm8o5Csv6OJjgWqqjMuQPsqXN+sykZk6qGri80qQ6v+aAI67 cQXQTRE5EUj2IpSXDG2nOVJ5VcOM+juZq/M9MIeeyJA6v1KvrvPxyTtbtjih8hUxQVSlXv1GE SdjDOMgwVc1jK4FjXau3Xt0K1SVtIfSCpei2yWVPtylSXbLkvdiXumFWEUwYht/2NfTO26y27 oZ/hD3QBzYTL4+AViFf621hVHMNeTvZfLw6oF/q2zbcZ1Lz1PBiQppp9DYlQg+acYeHyH2lEk M5zT16uS/YXo+2Ds8ttvMQQkxvPByrWWop7HGGppUvaccgwe89rkV9dTAc7ZHH+6c1cHcF3Kv WEJJjlarj13ItKlfE1XXE+59tyshjuHAjXL+2xaNeuoz1iGIApl6V2wUHMvX42wqRFELe1fs2 i8UOdEFYo1SAWmrEtawNoqw8S38hKDPKz+xqtwjN/Dbh7Qf7nJW1E/TPW+ERwg8jUjBrei4MS IHdRRhDj5QFXSC1u2q/tdKax/FotMPXtzLVPLBTZrdYYcSZhaLRCaY= X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:8560, ipnet:217.72.192.0/20, country:DE] X-Rspamd-Queue-Id: 4TzM413xXQz45xL On Mon, 18 Mar 2024 14:08:08 -0700, Jim Pazarena wrote: > I have a server which seems to have a fs issue for my exim folder. > an "ls -l" hangs. anything going near the exim folder hangs - for > whatever reason. You you find any strange messages in the "dmesg" output or in /var/log/messages? > If I trigger a 'reboot', I assume the boot process will automatically > enter a fsck as per the documentation. Depends on the setting in /etc/rc.conf. If you have enabled a background fscj, which probably is already the default, strange things can happen, up to booting in a somehow inconsistent FS environment. The setting background_fsck=3D"NO" is something I consider essential. Booting into an environment where some filesystem checks are performed on a live filesystem that is in use and assuming everything is okay is... not okay, in my opinion. > What is unclear is if the system will eventually g et to multi-user > mode, or hang at a CLI question from the fsck? The fsck process will start automatically at system startup for all file systems listed in /etc/fstab in case they are not marked CLEAN, which is how a normal system shutdown should have left them. If there is a minor problem, fsck will repair it without interaction. Severe problems that _might_ lead to data loss are brought to the administrator's attention and require interaction. It could even be possible that you need to perform a second fsck run, the system will inform you if that is needed. All this happens before the system starts its network services. > I have no hands or eyes available to be there. This is a bare metal > chassis not a vm. What kind of access do you have? Does it require a SSH session of the system in question to be accessible, or do you have a means to connect to a serial console of said system. > Would appreciate learning the procedure which fsck uses during a boot. > (beyond what the man fsck advises) which seems to exclude this question. Read "man fsck" carefully, especially on the implications of -f and -y. Also keep in mind that system functionality depends on how you've organized your partitions (so for example, if /home is damaged and on a separate partition or even disk, but the rest is okay, things could be easier to check and solve). Examine the _actual_ problem, then reach for the appropriate tools. Those might require work at a low level, but in many cases, will save you from a full re-install or scary forensic data retrieval sessions. ;-) =2D- Polytropon Magdeburg, Germany Happy FreeBSD user since 4.0 Andra moi ennepe, Mousa, ... From nobody Tue Mar 19 14:44:48 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TzZJ20wnCz5FZ8X for ; Tue, 19 Mar 2024 14:44:50 +0000 (UTC) (envelope-from lists@jail0199.vps.exonetric.net) Received: from jail0199.vps.exonetric.net (jail0199.vps.exonetric.net [IPv6:2a02:1658:1::199:1]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "jail0199.vps.exonetric.net", Issuer "jail0199.vps.exonetric.net" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TzZJ12bpWz4GBS for ; Tue, 19 Mar 2024 14:44:49 +0000 (UTC) (envelope-from lists@jail0199.vps.exonetric.net) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=fail reason="No valid SPF, No valid DKIM" header.from=cmplx.uk (policy=none); spf=none (mx1.freebsd.org: domain of lists@jail0199.vps.exonetric.net has no SPF policy when checking 2a02:1658:1::199:1) smtp.mailfrom=lists@jail0199.vps.exonetric.net Received: from jail0199.vps.exonetric.net (jail0199.vps.exonetric.net [178.250.76.108]) by jail0199.vps.exonetric.net (8.17.1/8.17.1) with ESMTPS id 42JEimHu007106 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NO) for ; Tue, 19 Mar 2024 14:44:48 GMT (envelope-from lists@jail0199.vps.exonetric.net) Received: (from lists@localhost) by jail0199.vps.exonetric.net (8.17.1/8.17.1/Submit) id 42JEimkY007105 for freebsd-questions@freebsd.org; Tue, 19 Mar 2024 14:44:48 GMT (envelope-from lists) Date: Tue, 19 Mar 2024 14:44:48 +0000 From: lists To: freebsd-questions@freebsd.org Subject: sendmail status Message-ID: Mail-Followup-To: freebsd-questions@freebsd.org List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.51 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.81)[-0.806]; FORGED_SENDER(0.30)[lists@cmplx.uk,lists@jail0199.vps.exonetric.net]; DMARC_POLICY_SOFTFAIL(0.10)[cmplx.uk : No valid SPF, No valid DKIM,none]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:12290, ipnet:2a02:1658::/32, country:GB]; MIME_TRACE(0.00)[0:+]; MISSING_XM_UA(0.00)[]; TO_DN_NONE(0.00)[]; R_DKIM_NA(0.00)[]; ARC_NA(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; MLMMJ_DEST(0.00)[freebsd-questions@freebsd.org]; RCVD_TLS_LAST(0.00)[]; FROM_NEQ_ENVFROM(0.00)[lists@cmplx.uk,lists@jail0199.vps.exonetric.net]; RCVD_COUNT_TWO(0.00)[2]; R_SPF_NA(0.00)[no SPF record] X-Rspamd-Queue-Id: 4TzZJ12bpWz4GBS Wanted to clarify the status of sendmail. https://docs.freebsd.org/en/books/handbook/mail/#dragonFly-mail-agent says: *quote* dma(8) is not intended as a replacement for real, big MTAs like sendmail(8) *end quote* Does this mean that sendmail in the base OS is *not* deprecated or similar? I'm not against adapting and trying dma, but I'm confused by the the handbook examples of using dma to route outgoing mail through 3rd party servers. Does it mean that dma only works with external smtp? i.e. does dma not have its own smtp? However, if sendmail is not deprecated/obsolescent, I'd prefer to keep using that. Thank you Anton From nobody Tue Mar 19 16:53:05 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4Tzd883shBz5DrW9 for ; Tue, 19 Mar 2024 16:53:12 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4Tzd88315Gz4WyW for ; Tue, 19 Mar 2024 16:53:12 +0000 (UTC) (envelope-from matthew@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1710867192; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=FDTqqYyRNOafPBjK2X7Pc65YNSUjovixGmZ0+r/zAis=; b=PIC16Q1Shohvx2apWmtibpCdUtEsftRQs+97p6W2lyoBvm3uEE4SIPKgS9ONIKvl7Gz0d/ SNgdOzV5kO4AwtKXuwGBbpu9A3jh/D3/4dfOkEx3LaGK0mbyIDUBAIyM4ENyal6U0t6qPL kuQA6LvLJr7stATIVpMhFzH1DkUrvfa0NwXA/+Ay//YGLOO+5tn6KqHjvBRypJCMzGHkpl ngFmi0tm+JhY60UiHc/szktErdiVEu2pwr/grjuLqkc6tY9d/FooqYN0yFUQjZVPdZA9l4 aZzWxN0lfwXs9LdGVkW+Z6gH5k97a3JgKB6KMW2Yv9V8RpGr/4+CKkrgMCxgkQ== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1710867192; a=rsa-sha256; cv=none; b=Lx8ZDJ2nZuX3s24KvYw4hDqQXXZk/RP4mm9zREFwb3Jzk9bnre3ZXQ0VfGQZsjqLDiB6SO bgU55TlktGsya78aVIm3JJYeQvLsVvgohXAltOJ/A9LMxza9AF5Yt7X9SrJsd71xL28XXO 5aiJi/wQTn0cLjqMvxMUKFVMTEXr0dAfeDy11ZoFa0MvzpUVp0q5tvMWugkrh0T/n8So6s FzKjfbhRsjTU9eZyBExDwA1XKTbQYJjVkJD5vCDi4y4BGQoyNVeQ4kMukje0qldVvWbcmK sHsB1jf0/09KuCV3Q2wSX/r3WdaD6o9QhVknOxGCviTPLBHFj1FCxEtDkjRSjQ== ARC-Authentication-Results: i=1; smtp.infracaninophile.co.uk; dmarc=fail (p=none dis=none) header.from=FreeBSD.org ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1710867192; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=FDTqqYyRNOafPBjK2X7Pc65YNSUjovixGmZ0+r/zAis=; b=kBRhxTsoHNk2FohVRrdcfW6PUziEOVDy76U/AHOqBZefjSH5LNOObnSbRG+MqPCjNfCQ56 ftHSb7umn66zhu6POaD0i5t7HhhuwCmXRmvBG0UqOFWgKka71Z4HifUXq9rDFxAZ+r4OzI 9T39xh8D3gVM0Op5QFwFOswFRTpQBzql1B+yl2ToJB8o7EDD5vJ2wDO8XwCTvJ7NJK155O m9rZraoLRZ4wVq1SHbUEs5EGH1t5Wue/1qI2SS4RgXP8Yc1z0v9Fw9bxzYFdRkEzvFQqWf 0k+3phYUCvI8Vy9Xw4BgpCH7tetu9M904TCje32KN3ZbHfdLMg1+RaVeBiHQdA== Received: from smtp.infracaninophile.co.uk (smtp.infracaninophile.co.uk [81.2.117.100]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: matthew/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4Tzd881nxTz14pF for ; Tue, 19 Mar 2024 16:53:12 +0000 (UTC) (envelope-from matthew@FreeBSD.org) Received: from [10.8.0.14] (cantor-hypercube.oucs.ox.ac.uk [163.1.67.131]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature ECDSA (prime256v1) server-digest SHA256) (No client certificate requested) (Authenticated sender: m.seaman@infracaninophile.co.uk) by smtp.infracaninophile.co.uk (Postfix) with ESMTPSA id DD36B11439 for ; Tue, 19 Mar 2024 16:53:07 +0000 (GMT) Authentication-Results: smtp.infracaninophile.co.uk; dmarc=fail (p=none dis=none) header.from=FreeBSD.org Message-ID: <5a49e937-7782-48dd-9f1e-006b7db1a3a1@FreeBSD.org> Date: Tue, 19 Mar 2024 16:53:05 +0000 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: sendmail status To: questions@freebsd.org References: Content-Language: en-GB From: Matthew Seaman In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit On 19/03/2024 14:44, lists wrote: > Wanted to clarify the status of sendmail. > > https://docs.freebsd.org/en/books/handbook/mail/#dragonFly-mail-agent > > says: > > *quote* > dma(8) is not intended as a replacement for real, big MTAs like sendmail(8) > *end quote* > > Does this mean that sendmail in the base OS > is *not* deprecated or similar? > > I'm not against adapting and trying dma, > but I'm confused by the the handbook examples > of using dma to route outgoing mail > through 3rd party servers. > > Does it mean that dma only works with external smtp? > i.e. does dma not have its own smtp? > > However, if sendmail is not deprecated/obsolescent, > I'd prefer to keep using that. DMA is a much smaller and simpler mail server which offers a deliberately limited subset of the full functionality of MTAs like sendmail, exim or postfix. It's suitable for FreeBSD servers that aren't specifically for handling e-mail but do need to send some messages occasionally. It doesn't handle incoming e-mail at all: it's ideal role is to hand-off e-mails originating on your server to a central mail host for forwarding or delivery. So, if you need a fully fledged mail server, need to receive messages from remote senders or simply prefer the added functionality and complexity then DMA is not for you. AFAIK, sendmail is still going to be supplied with the base system for the forseeable future, but honestly even if it does get removed from base, it certainly isn't disappearing from ports. Cheers, Matthew From nobody Tue Mar 19 17:09:36 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4TzdWG0rXBz5DtVL for ; Tue, 19 Mar 2024 17:09:46 +0000 (UTC) (envelope-from tml@seiruote.it) Received: from smtpcmd11117.aruba.it (smtpcmd11117.aruba.it [62.149.156.117]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client CN "smtpdh11.ad.aruba.it", Issuer "Actalis Organization Validated Server CA G3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4TzdWC5Hl9z4Z3k for ; Tue, 19 Mar 2024 17:09:43 +0000 (UTC) (envelope-from tml@seiruote.it) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=seiruote.it header.s=a1 header.b=lJWPwefb; dmarc=pass (policy=none) header.from=seiruote.it; spf=pass (mx1.freebsd.org: domain of tml@seiruote.it designates 62.149.156.117 as permitted sender) smtp.mailfrom=tml@seiruote.it Received: from [192.168.20.100] ([185.171.39.48]) by Aruba Outgoing Smtp with ESMTPSA id mcy4r9K52pffomcy4rgBUv; Tue, 19 Mar 2024 18:09:40 +0100 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=seiruote.it; s=a1; t=1710868180; bh=qdKfbRG/KftLHv1sJBwHwdnI6EGf5W0U1yd+Cg/UOIs=; h=Date:MIME-Version:Subject:To:From:Content-Type; b=lJWPwefb04Dl7y1JcrgN/WvAawJF+017Rwfex2CPsO33G9D7wAH7uh6ZneucyEwV5 nChQ1EYudm94OdKB+IejBjoHVUfNzSRemF0GK4wY52zNNgbRpST9i7y8kwdrQmt/J/ Z5ncFD3CzLra9zDTKr7fpIXfCMHzetLM7TNdDqZfe2TdU+VKpJaUY/EupFtPhN881D xm9Q9zxL0RluQLL9VgJsyIBjXzZVP0HoYzJBO6cpbNFFw26Flv9Zw9nBWNru07LILC KfbWbX+zPLzVocxZpCu7y+cYoStcsZkpvau1tTwHToz6YcCDJE9ptK/63zDO6ifSeJ HvYNeqag36+iA== Message-ID: <5aef7b18-86c3-49d6-a4b1-5baec52b0bc0@seiruote.it> Date: Tue, 19 Mar 2024 18:09:36 +0100 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: sendmail status To: questions@freebsd.org References: Content-Language: it From: tetrosalame In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-CMAE-Envelope: MS4xfEuZfMXWKV789VUYEUTOVyRLY1unJUqoZgge03RVUvAXZJN6g7SNSVk/F57tbpKVpqhQPBoNgNe0TJKzHUp1Tu2300vSYQCabxSQb2lFedS+3Dy+bzbw iXi+QOuhQfDJXHfTLE2784Un4mtDt/CbsS7sJv6wagEpAXddWRG7GLFPGJLd+VCu3UWLPJdcH0Qnmg== X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.89 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[seiruote.it,none]; R_SPF_ALLOW(-0.20)[+ip4:62.149.156.0/24]; R_DKIM_ALLOW(-0.20)[seiruote.it:s=a1]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; XM_UA_NO_VERSION(0.01)[]; ARC_NA(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:31034, ipnet:62.149.128.0/19, country:IT]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[62.149.156.117:from]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; RWL_MAILSPIKE_POSSIBLE(0.00)[62.149.156.117:from]; TO_DN_NONE(0.00)[]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MLMMJ_DEST(0.00)[questions@freebsd.org]; DKIM_TRACE(0.00)[seiruote.it:+] X-Rspamd-Queue-Id: 4TzdWC5Hl9z4Z3k Il 19/03/2024 15:44, lists ha scritto: > > *quote* > dma(8) is not intended as a replacement for real, big MTAs like sendmail(8) > *end quote* > > Does this mean that sendmail in the base OS > is *not* deprecated or similar? As far as I can tell, there's no deprecation notice upon sendmail. Gregory Shapiro has imported latest sendmail (v8.18.1) in -CURRENT and STABLE/13-14 last february. > Does it mean that dma only works with external smtp? > i.e. does dma not have its own smtp? dma just forwards mail from localhost to local destinations, or to remote destinations relaying through a smart host via smtp. It's not meant to route e-mail messages like a full blown MTA would. > However, if sendmail is not deprecated/obsolescent, > I'd prefer to keep using that. I, for one, still run sendmail to forward local mail to a central hub out of old habits: that's the task dma is born to fullfill. BTW sendmail is still in base: even if one day FreeBSD developers will decide to remove it, there's always the ports collection. Even today, if you use sendmail for something more complex than forwarding local mail somewhere, you'd better rely on mail/sendmail port. f. From nobody Thu Mar 21 07:15:58 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V0cFl58nPz5FN0l for ; Thu, 21 Mar 2024 07:16:27 +0000 (UTC) (envelope-from freebsd@gushi.org) Received: from prime.gushi.org (prime.gushi.org [IPv6:2620:137:6000:10::142]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "prime.gushi.org", Issuer "RapidSSL TLS RSA CA G1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4V0cFk2cTLz4gNx for ; Thu, 21 Mar 2024 07:16:26 +0000 (UTC) (envelope-from freebsd@gushi.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gushi.org header.s=prime2014 header.b=nCwP6Q6n; dmarc=pass (policy=none) header.from=gushi.org; spf=pass (mx1.freebsd.org: domain of freebsd@gushi.org designates 2620:137:6000:10::142 as permitted sender) smtp.mailfrom=freebsd@gushi.org Received: from smtpclient.apple (vpn-aw.f.root-servers.org [149.20.11.9]) (authenticated bits=0) by prime.gushi.org (8.17.2/8.17.2) with ESMTPSA id 42L7GEmD084479 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Thu, 21 Mar 2024 07:16:19 GMT (envelope-from freebsd@gushi.org) DKIM-Filter: OpenDKIM Filter v2.10.3 prime.gushi.org 42L7GEmD084479 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gushi.org; s=prime2014; t=1711005380; bh=l8UHwXnN1ac0MaMGIOtMlxT3TsRy8PTF9djPFtPVVoY=; h=From:Subject:Date:To; z=From:=20"Dan=20Mahoney=20(Ports)"=20|Subject:= 20Dell=20perc=20card=20corrupted=20by=20FreeBSD=20driver?|Date:=20 Thu,=2021=20Mar=202024=2000:15:58=20-0700|To:=20questions=20; b=nCwP6Q6nKZj/jMnXbm/fvP4iw9YvliwVIaYUY8VI7hZXQi7TAULH4melSz22KMgst pv5vygBkZWPtCf3aNQViF5hQYwQcPhF/BpEU/XT8Fck3HrxEID3QnHzoQOLnp4oAvy ukZrUVZTj7mVAH4/izjLk33079k9HSd8Zk4DEqHsTRgna0MBPDq/x+4J+2pKhvroPy Ipyivp2L8lqtKU9RGTSk5igHsYlmFCktyMcv+JtLLT0Z8sn1+riyvTtKdk2Fh8JZmh 3CQlSZcRULHE1+CxyYoZ5X6eOJpreEu5iW0G9SI7LmAhqw+xBeMG/y5IcvL+5ApTlX f4DUsLSZ0c8pw== X-Authentication-Warning: prime.gushi.org: Host vpn-aw.f.root-servers.org [149.20.11.9] claimed to be smtpclient.apple From: "Dan Mahoney (Ports)" Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.400.31\)) Subject: Dell perc card corrupted by FreeBSD driver? Message-Id: <360F0169-B132-4F5B-B261-E50661911CDC@gushi.org> Date: Thu, 21 Mar 2024 00:15:58 -0700 To: questions X-Mailer: Apple Mail (2.3774.400.31) X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.59 / 15.00]; DWL_DNSWL_MED(-2.00)[gushi.org:dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_SHORT(-0.99)[-0.993]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; DMARC_POLICY_ALLOW(-0.50)[gushi.org,none]; R_SPF_ALLOW(-0.20)[+mx]; R_DKIM_ALLOW(-0.20)[gushi.org:s=prime2014]; RCVD_IN_DNSWL_MED(-0.20)[2620:137:6000:10::142:from]; MIME_GOOD(-0.10)[text/plain]; ONCE_RECEIVED(0.10)[]; MIME_TRACE(0.00)[0:+]; TO_DN_ALL(0.00)[]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_ALL(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:393507, ipnet:2620:137:6000::/44, country:US]; PREVIOUSLY_DELIVERED(0.00)[questions@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; DKIM_TRACE(0.00)[gushi.org:+]; MLMMJ_DEST(0.00)[questions@freebsd.org]; APPLE_MAILER_COMMON(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_XAW(0.00)[] X-Rspamd-Queue-Id: 4V0cFk2cTLz4gNx All, We have a Dell Perc h330 mini that we=E2=80=99ve been using with the = older =E2=80=9Cmfi=E2=80=9D driver, not the newer mrsas. Recently, it = started giving us an error on boot claiming that it was "Disabling = writes to flash as the flash part has gone bad" In the Dell Forums, a dell staffer very suspiciously saw this error and = said =E2=80=9Care you running FreeBSD?=E2=80=9D = (https://www.dell.com/community/en/conversations/rack-servers/disabling-wr= ites-to-flash-as-the-flash-part-has-gone-bad/647f9010f4ccf8a8de13d06e) Is there something about the driver we use that=E2=80=99s known to cause = breakage? Is there a known firmware that fixes this? Is there a better = place to ask this than the general =E2=80=9Cquestions=E2=80=9D list? This system is out of warranty, but as we have a lot of Dell machines = out in the field doing Important DNS Things, I may open a generic case = with a system that *is* under warranty to ask more about this. In the = meantime, if anyone who maintains the driver knows something, I=E2=80=99d = love to hear from you. -Dan From nobody Thu Mar 21 07:59:44 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V0dD62lNBz5FSsv for ; Thu, 21 Mar 2024 08:00:06 +0000 (UTC) (envelope-from freebsd@gushi.org) Received: from prime.gushi.org (prime.gushi.org [IPv6:2620:137:6000:10::142]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "prime.gushi.org", Issuer "RapidSSL TLS RSA CA G1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4V0dD55Z3Wz4nRG for ; Thu, 21 Mar 2024 08:00:05 +0000 (UTC) (envelope-from freebsd@gushi.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gushi.org header.s=prime2014 header.b="uS/9wbup"; dmarc=pass (policy=none) header.from=gushi.org; spf=pass (mx1.freebsd.org: domain of freebsd@gushi.org designates 2620:137:6000:10::142 as permitted sender) smtp.mailfrom=freebsd@gushi.org Received: from smtpclient.apple (vpn-aw.f.root-servers.org [149.20.11.9]) (authenticated bits=0) by prime.gushi.org (8.17.2/8.17.2) with ESMTPSA id 42L801eC089081 (version=TLSv1.2 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NOT) for ; Thu, 21 Mar 2024 08:00:04 GMT (envelope-from freebsd@gushi.org) DKIM-Filter: OpenDKIM Filter v2.10.3 prime.gushi.org 42L801eC089081 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gushi.org; s=prime2014; t=1711008004; bh=F7HaIswCQM/oszamtGdXgtxjT/6xITz/PhfQftcKUSc=; h=From:Subject:Date:To; z=From:=20"Dan=20Mahoney=20(Ports)"=20|Subject:= 20ksu=20has=20no=20man=20page?|Date:=20Thu,=2021=20Mar=202024=2000 :59:44=20-0700|To:=20questions=20; b=uS/9wbupN33HnEjj4FfWhSYEjTblJ76EwLSNU1+x1vkH0psJcD8RYiDF9Fn5GK4ap osjV+f373O95if4F5QFko02Yvcl/6hUpnU7BqqhTlG1ECD8QvhC96au15VoEL45Zs+ 5ToWqWGMz9qnmXLMymO/DjFcfn6EwLtA4NUxTE9O/HLEPXO775u6H19ilazrWTIwjZ YOZ3uuHuQHiO09zEh0gFXFOooGWsxPSpG5AoJVOXPygzpzw2nUl4h8VauOKBlJ7SXr cXF5gbg9LAZ3tkNSLTbnnHUDJpT3wQqbZMltj5v58ufUuGPvocAJ+DuF4VyB+eSOau 1PLFHIERDCS6A== X-Authentication-Warning: prime.gushi.org: Host vpn-aw.f.root-servers.org [149.20.11.9] claimed to be smtpclient.apple From: "Dan Mahoney (Ports)" Content-Type: multipart/alternative; boundary="Apple-Mail=_5D860E45-8DEA-4D32-B7BD-45A9CE8B069F" List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org Mime-Version: 1.0 (Mac OS X Mail 16.0 \(3774.400.31\)) Subject: ksu has no man page? Message-Id: Date: Thu, 21 Mar 2024 00:59:44 -0700 To: questions X-Mailer: Apple Mail (2.3774.400.31) X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.60 / 15.00]; DWL_DNSWL_MED(-2.00)[gushi.org:dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_SHORT(-1.00)[-1.000]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; DMARC_POLICY_ALLOW(-0.50)[gushi.org,none]; R_SPF_ALLOW(-0.20)[+mx]; R_DKIM_ALLOW(-0.20)[gushi.org:s=prime2014]; RCVD_IN_DNSWL_MED(-0.20)[2620:137:6000:10::142:from]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; ONCE_RECEIVED(0.10)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; TO_DN_ALL(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; ARC_NA(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_ALL(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:393507, ipnet:2620:137:6000::/44, country:US]; PREVIOUSLY_DELIVERED(0.00)[questions@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; DKIM_TRACE(0.00)[gushi.org:+]; MLMMJ_DEST(0.00)[questions@freebsd.org]; APPLE_MAILER_COMMON(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_XAW(0.00)[] X-Rspamd-Queue-Id: 4V0dD55Z3Wz4nRG --Apple-Mail=_5D860E45-8DEA-4D32-B7BD-45A9CE8B069F Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=us-ascii So this is weird. Dayjob is a FreeBSD and kerberos shop, and we use the = built in heimdal kerberos in base. I had an expired root password, and ksu decided to try to force a = password change on me. (It then failed, because ipfw didn't have the = privs to contact the kdc on the kpasswd port -- we only allow that from = our shell servers, where people should be changing passwords). Anyway...the man page *does* exist in = /usr/src/crypto/heimdal/appl/su/su.1, but that weird behavior is not = mentioned. And apparently su has been removed from current kerberos cuts https://github.com/heimdal/heimdal/blob/master/appl/Makefile.am lists = "remove appl/su" in their changelog six years ago. So, um.... Why is FreeBSD not shipping the existing manpage as /man1/ksu.1? That = would at least be something. (Yes, I know from conversations with cy@ that apparently there's some = coming change to using MIT, which makes this a moot point. I'm just = trying to read the tea leaves here). -Dan= --Apple-Mail=_5D860E45-8DEA-4D32-B7BD-45A9CE8B069F Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=us-ascii So this is = weird.  Dayjob is a FreeBSD and kerberos shop, and we use the =  built in heimdal kerberos in base.

I had an expired root password, and ksu decided to = try to force a password change on me.  (It then failed, = because ipfw didn't have the privs to contact the = kdc on the kpasswd port -- we only allow that from our = shell servers, where people should be changing = passwords).

Anyway...the man page *does* exist in /usr/src/crypto/heimdal/appl/su/su.1, but that weird behavior is = not mentioned.

And = apparently su has been removed from current kerberos cuts

h= ttps://github.com/heimdal/heimdal/blob/master/appl/Makefile.am lists "remove appl/su" in their changelog six years = ago.

So, = um....

Why is FreeBSD = not shipping the existing manpage as /man1/ksu.1? =  That would at least be something.

(Yes, I know = from conversations with cy@ that apparently there's some coming change = to using MIT, which makes this a moot point.  I'm just trying = to read the tea leaves here).

-Dan= --Apple-Mail=_5D860E45-8DEA-4D32-B7BD-45A9CE8B069F-- From nobody Thu Mar 21 14:22:15 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V0nj50WQzz5DkgX for ; Thu, 21 Mar 2024 14:22:17 +0000 (UTC) (envelope-from dvoich@optonline.net) Received: from altprdrgo04.altice.prod.cloud.openwave.ai (altprdrgo04.altice.prod.msg.synchronoss.net [65.20.63.110]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V0nj41sM2z4Zhl for ; Thu, 21 Mar 2024 14:22:16 +0000 (UTC) (envelope-from dvoich@optonline.net) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=optonline.net header.s=dkim-002 header.b=lIYh9m44; dmarc=pass (policy=none) header.from=optonline.net; spf=pass (mx1.freebsd.org: domain of dvoich@optonline.net designates 65.20.63.110 as permitted sender) smtp.mailfrom=dvoich@optonline.net DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=optonline.net; s=dkim-002; t=1711030936; bh=G/9/OuHkYANGPtfL5G+IXuNrzg5yEyKMsTRwJmYNPmM=; h=To:Message-ID:Subject:MIME-Version:Content-Type:X-Originating-IP:From:Date; b=lIYh9m44Cv98pD450h8v4hh1zIgWijl8+CFbGEj3nhFsb4uj0qQPeMu3KsAtCj5CUXL5W7xNmOZqKAvbtXybSu1yalsIkjmpQrktJtBuIB7IoWHUolmTremmg26YC1BLjk+sCxMyELFmDI23dk8vP+1QqNs8aIC2y5He3/eDy7Fm76LMa5l40b5lHO3TtVKBsb81lIJeYqNcnVYFUtydl5n8U1RrkTzj2jnBUrw8P8uBPi4Dt4rUPaRHhmpIhuuJyPldvOauV5AxP3Iv8JIDs4cGxc0xeYoq83ALnmWH4zqTNL3WMFuQbGE36Eh/XbDWAKpOSqpxOAAM2rpWxyYi0A== X-RG-VS-CS: clean X-RG-VS-SC: 0 X-RG-VS: Clean X-RG-Env-Sender: dvoich@optonline.net X-RG-Rigid: 65F11F1A016F165F X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedvledrleejgddtudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucetnffvkfevgfgfufdpggftfghnshhusghstghrihgsvgdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefvkffugggtfghihfffsegrtdersgdtreejnecuhfhrohhmpeguvhhoihgthhesohhpthhonhhlihhnvgdrnhgvthenucggtffrrghtthgvrhhnpeeffedvvefgffduudekueeiueethfekleelleelgfeggedvfeeugefgkeelleekkeenucfkphepuddtrddvgeekrdegrdejgedpvdegrddukeehrdduhedtrdduvdefnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheprghlthhprhgufigvsgdugedrrghlthhitggvrdhprhhougdrmhhsghdrshhntghrtghlohhuugdrnhgvthdpihhnvghtpedutddrvdegkedrgedrjeegpdhmrghilhhfrhhomhepughvohhitghhsehophhtohhnlhhinhgvrdhnvghtpdhnsggprhgtphhtthhopedupdhrtghpthhtohepqhhuvghsthhiohhnshesfhhrvggvsghsugdrohhrghdpoffvtefjohhstheprghlthhprhgurhhgohdtge X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean Received: from altprdweb14.altice.prod.msg.sncrcloud.net (10.248.4.74) by altprdrgo04.altice.prod.cloud.openwave.ai (5.8.812) id 65F11F1A016F165F for questions@freebsd.org; Thu, 21 Mar 2024 10:22:15 -0400 Received: from [24.185.150.123] by myemail.optimum.net with HTTP; Thu, 21 Mar 2024 10:22:15 -0400 To: questions@freebsd.org Message-ID: <3dacd541.70f0.18e61641e0f.Webtop.74@optimum.net> Subject: Compiled i915kms.ko errors with incorrect file type does not match kernel List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_148893_1835583850.1711030935050" User-Agent: OWM Mail 3 X-SID: 74 X-Originating-IP: [24.185.150.123] From: dvoich@optonline.net Date: Thu, 21 Mar 2024 10:22:15 -0400 (EDT) X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.47 / 15.00]; NEURAL_HAM_LONG(-1.00)[-0.997]; NEURAL_HAM_SHORT(-0.75)[-0.749]; DMARC_POLICY_ALLOW(-0.50)[optonline.net,none]; NEURAL_SPAM_MEDIUM(0.27)[0.271]; R_SPF_ALLOW(-0.20)[+ip4:65.20.63.0/24]; R_DKIM_ALLOW(-0.20)[optonline.net:s=dkim-002]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCPT_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:31898, ipnet:65.20.63.0/24, country:US]; MIME_TRACE(0.00)[0:+,1:+,2:~]; FROM_NO_DN(0.00)[]; FREEMAIL_ENVFROM(0.00)[optonline.net]; FREEMAIL_FROM(0.00)[optonline.net]; ARC_NA(0.00)[]; MLMMJ_DEST(0.00)[questions@freebsd.org]; RCVD_TLS_LAST(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; HAS_XOIP(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[optonline.net:+] X-Rspamd-Queue-Id: 4V0nj41sM2z4Zhl ------=_Part_148893_1835583850.1711030935050 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: quoted-printable I used portmaster to update my ports. When I booted up the next day X11=20 failed to start. I saw that i915kms.ko failed to load. I thought all I=20 had to do was recompile and install drm-kmod. I compiled and installed=20 both from the ports. Not the one marked "ignore". They both=20 failed to load. I am running 14.0 p5.=C2=A0 I must have missed some step but I have no clue what it could be. ------=_Part_148893_1835583850.1711030935050 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 7bit

I used portmaster to update my ports. When I booted up the next day X11 failed to start. I saw that i915kms.ko failed to load. I thought all I had to do was recompile and install drm-kmod. I compiled and installed both from the ports. Not the one marked "ignore". They both failed to load.

I am running 14.0 p5. 

I must have missed some step but I have no clue what it could be.

------=_Part_148893_1835583850.1711030935050-- From nobody Thu Mar 21 15:09:00 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V0plP173Vz5DqHD for ; Thu, 21 Mar 2024 15:09:21 +0000 (UTC) (envelope-from tomek@cedro.info) Received: from mail-yw1-x112c.google.com (mail-yw1-x112c.google.com [IPv6:2607:f8b0:4864:20::112c]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "GTS CA 1D4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4V0plN2tFYz4gdN for ; Thu, 21 Mar 2024 15:09:20 +0000 (UTC) (envelope-from tomek@cedro.info) Authentication-Results: mx1.freebsd.org; none Received: by mail-yw1-x112c.google.com with SMTP id 00721157ae682-609f060cbafso14138507b3.0 for ; Thu, 21 Mar 2024 08:09:20 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cedro.info; s=google; t=1711033754; x=1711638554; darn=freebsd.org; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:from:to:cc:subject:date :message-id:reply-to; bh=1etBKcP8XmzZ9yFtlNn4bxzSCKN6UPWmQo+dRJwO2uw=; b=jYm7sln+tkDynelmvoAAidXEoIgpWCTWpuQjwQCQbg7yADZ3K3iHKfk4c7xxJr2dYB jZSmRCcBu8ZtAfyWsuQ6TMHtnpGq2iwWP4/ASOjR5TSROpnngWGuvaFAwocvZyF58N/b sgrXdF64Y/TL7weO2iJy+GW0chyBRtWmE3YWUGp62v7Zyzuyq3u3aUzZg2NYunXGH2Zi Z8WgtWBh7ZvPp2VYOy06QIGcjrr0ZG0bNxAEi/7wQF8RGZ2oZ34vXKDSo9hEr7N8l5Ng i9KiJ0QRY+nSAFaaRL0/7weYJixnORXecfbwzPR4DCB5aY08Il9hjnj5FhxwlDp5H+8j WQew== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1711033754; x=1711638554; h=content-transfer-encoding:cc:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=1etBKcP8XmzZ9yFtlNn4bxzSCKN6UPWmQo+dRJwO2uw=; b=iR/KIXFFw5/71eoGST4NbPL8dYI3F3o+pex36KHahTSxIySEGTtwcXOAGlGMd57bSO BWOn/JWgZA9hOXamjrWr1YkZwc0MG/YPNMty14HGR+fqb+5QTJDgaPvJ6Wh7AN56DaTE J133aA0/aqEvQmSt2d3bgtpqjCJotVIbCLE9ibayRe0j24AmqtE4PhGzAJNPrYS2ECau rrXQY9zVIs8SGQQRy5/wH8/oTFFGUQ+JWRT4TqH/nAGPEB8er2RfPFGxTQZ+lhGlSf2z z3ZIS3zIqsu6fmbth87WkRTPN/6mjRk6p/PBGFEhfyVdvBW2gUhy9rNUqOC4Td4Aym0k tRmg== X-Gm-Message-State: AOJu0YyT4idxJ/hBKSJObW9utpD/nj5xN86chyZYdXzKZZ9kt8btV7nK g91jaGqzMSZjrrq/q/2XSyIg1+M9GfbMSt7eeVbUmRTG6KLzZkxYz3p/g8i7KtueCeEVVmIfFOE = X-Google-Smtp-Source: AGHT+IHlE/PfsPyDxkE7tZINBY0yY7mJ8HFopGkHoc1jRl1gkrxy/m31Tbv7X5z5hElZwYvUnlthqA== X-Received: by 2002:a81:6d54:0:b0:608:de16:ecb5 with SMTP id i81-20020a816d54000000b00608de16ecb5mr9972876ywc.1.1711033753359; Thu, 21 Mar 2024 08:09:13 -0700 (PDT) Received: from mail-yb1-f177.google.com (mail-yb1-f177.google.com. [209.85.219.177]) by smtp.gmail.com with ESMTPSA id l82-20020a0de255000000b0061101642b68sm537014ywe.123.2024.03.21.08.09.12 for (version=TLS1_3 cipher=TLS_AES_128_GCM_SHA256 bits=128/128); Thu, 21 Mar 2024 08:09:12 -0700 (PDT) Received: by mail-yb1-f177.google.com with SMTP id 3f1490d57ef6-dccb1421bdeso966649276.1 for ; Thu, 21 Mar 2024 08:09:12 -0700 (PDT) X-Received: by 2002:a5b:b52:0:b0:dd0:702:577a with SMTP id b18-20020a5b0b52000000b00dd00702577amr8493272ybr.35.1711033752488; Thu, 21 Mar 2024 08:09:12 -0700 (PDT) List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 References: <360F0169-B132-4F5B-B261-E50661911CDC@gushi.org> In-Reply-To: <360F0169-B132-4F5B-B261-E50661911CDC@gushi.org> From: Tomek CEDRO Date: Thu, 21 Mar 2024 16:09:00 +0100 X-Gmail-Original-Message-ID: Message-ID: Subject: Re: Dell perc card corrupted by FreeBSD driver? To: "Dan Mahoney (Ports)" Cc: questions Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:15169, ipnet:2607:f8b0::/32, country:US] X-Rspamd-Queue-Id: 4V0plN2tFYz4gdN On Thu, Mar 21, 2024 at 8:16=E2=80=AFAM Dan Mahoney (Ports) wrote: > We have a Dell Perc h330 mini that we=E2=80=99ve been using with the olde= r =E2=80=9Cmfi=E2=80=9D driver, not the newer mrsas. Recently, it started = giving us an error on boot claiming that it was "Disabling writes to flash = as the flash part has gone bad" Hey Dan, I have no such hardware but something may wear-out-flash memory as each flash has limited thousands of write cycles.. or they got faulty Flash chips batch. It would be good to know what flash type is used NOR or NAND? For sure they had such situation in mind creating bios that will print that message on boot after failed write so we can assume Flash memory is written at least once per boot ;-) Assuming that problem is caused by flash-wear-out and really is BSD related it may be kernel driver or startup application (mfiutil?). But it also may be faulty controller firmware or bios storing something too frequently in that flash. If you can pull out the controller, there might be some sort of small 8-pin serial (NOR) Flash memory chip onboard, that it is easy and cheap to replace. You can also use memory programmer to dump it contents and verify if really write fails. If the memory is a bigger chip (NAND Flash) then it may have badblocks by design and the question is what filesystem is used to store data on that particular flash memory type and if this is flash friendly fs and how firmware/bios handles errors :-) -- CeDeROM, SQ7MHZ, http://www.tomek.cedro.info From nobody Thu Mar 21 17:08:18 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V0sNq5Ymlz5F4g3 for ; Thu, 21 Mar 2024 17:08:27 +0000 (UTC) (envelope-from danm@prime.gushi.org) Received: from prime.gushi.org (prime.gushi.org [IPv6:2620:137:6000:10::142]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "prime.gushi.org", Issuer "RapidSSL TLS RSA CA G1" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4V0sNp0TnDz4tcH for ; Thu, 21 Mar 2024 17:08:25 +0000 (UTC) (envelope-from danm@prime.gushi.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=gushi.org header.s=prime2014 header.b=BvP5SJt0; dmarc=pass (policy=none) header.from=gushi.org; spf=pass (mx1.freebsd.org: domain of danm@prime.gushi.org designates 2620:137:6000:10::142 as permitted sender) smtp.mailfrom=danm@prime.gushi.org Received: from prime.gushi.org (localhost [127.0.0.1]) by prime.gushi.org (8.17.2/8.17.2) with ESMTPS id 42LH8IY2053597 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=NOT) for ; Thu, 21 Mar 2024 17:08:20 GMT (envelope-from danm@prime.gushi.org) DKIM-Filter: OpenDKIM Filter v2.10.3 prime.gushi.org 42LH8IY2053597 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gushi.org; s=prime2014; t=1711040900; bh=opCpQfVAtc3OV+wS29Asp3sf3uCn6PHKwOVUi5zu6Rg=; h=Date:From:To:Subject:In-Reply-To:References; z=Date:=20Thu,=2021=20Mar=202024=2017:08:18=20+0000=20(UTC)|From:=2 0"Dan=20Mahoney=20(Ports)"=20|To:=20questions=2 0|Subject:=20Re:=20Dell=20perc=20card=20cor rupted=20by=20FreeBSD=20driver?|In-Reply-To:=20<360F0169-B132-4F5B -B261-E50661911CDC@gushi.org>|References:=20<360F0169-B132-4F5B-B2 61-E50661911CDC@gushi.org>; b=BvP5SJt0yxa+tYAiI+Df+89Uaz4LcF3uraPYAGeEbX982yw9dCwO4K5fmhexYFH2y GkiylvxLQq0o30TM/anxvKCPrcuQG6hO/i8SzsTX/GqWXZJZDi96ThXeLjbW8Okbui X2OH0FJ7dWWhqavsxEWHD1Wp2NvO4lyc/zYXR2gqozzfWjMB77SYkrbJBMtptY0m46 EIwMUSDbIag6kcDS6BhWQYmjCXEcOd1/UKp1M4aKHiKgk7K6H9VMpF6ynVnWRc7Kvm y8zi5gl5FIa+og2eR1MkpnnrGOUOtKJqH1ACeN4BdArZNHm2k8Vws4xh9iu/e7BVwM Qg7J5uFSTvKxA== Received: (from danm@localhost) by prime.gushi.org (8.17.2/8.17.2/Submit) id 42LH8Iqg053596; Thu, 21 Mar 2024 17:08:18 GMT (envelope-from danm) Date: Thu, 21 Mar 2024 17:08:18 +0000 (UTC) From: "Dan Mahoney (Ports)" To: questions Subject: Re: Dell perc card corrupted by FreeBSD driver? In-Reply-To: <360F0169-B132-4F5B-B261-E50661911CDC@gushi.org> Message-ID: <544cd874-2a76-07f2-e532-43532319b848@gushi.org> References: <360F0169-B132-4F5B-B261-E50661911CDC@gushi.org> X-OpenPGP-Key-ID: 0x624BB249 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="33658924-470708021-1711040898=:96768" X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (prime.gushi.org [0.0.0.0]); Thu, 21 Mar 2024 17:08:20 +0000 (UTC) X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.40 / 15.00]; DWL_DNSWL_MED(-2.00)[gushi.org:dkim]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; CTYPE_MIXED_BOGUS(1.00)[]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[gushi.org,none]; RCVD_DKIM_ARC_DNSWL_MED(-0.50)[]; FORGED_SENDER(0.30)[freebsd@gushi.org,danm@prime.gushi.org]; R_DKIM_ALLOW(-0.20)[gushi.org:s=prime2014]; R_SPF_ALLOW(-0.20)[+a]; RCVD_IN_DNSWL_MED(-0.20)[2620:137:6000:10::142:from]; MIME_GOOD(-0.10)[multipart/mixed,text/plain]; ARC_NA(0.00)[]; FROM_NEQ_ENVFROM(0.00)[freebsd@gushi.org,danm@prime.gushi.org]; MID_RHS_MATCH_FROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+]; RCPT_COUNT_ONE(0.00)[1]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; MLMMJ_DEST(0.00)[questions@freebsd.org]; MISSING_XM_UA(0.00)[]; ASN(0.00)[asn:393507, ipnet:2620:137:6000::/44, country:US]; TO_DN_ALL(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[questions@freebsd.org]; RCVD_COUNT_TWO(0.00)[2]; DKIM_TRACE(0.00)[gushi.org:+]; FROM_HAS_DN(0.00)[] X-Rspamd-Queue-Id: 4V0sNp0TnDz4tcH This message is in MIME format. The first part should be readable text, while the remaining parts are likely unreadable without MIME-aware tools. --33658924-470708021-1711040898=:96768 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: QUOTED-PRINTABLE On Thu, 21 Mar 2024, Dan Mahoney (Ports) wrote: > All, > > We have a Dell Perc h330 mini that we=E2=80=99ve been using with the olde= r =E2=80=9Cmfi=E2=80=9D driver, not the newer mrsas. Recently, it started = giving us an error on boot claiming that it was "Disabling writes to flash = as the flash part has gone bad" > > In the Dell Forums, a dell staffer very suspiciously saw this error and s= aid =E2=80=9Care you running FreeBSD?=E2=80=9D (https://www.dell.com/commun= ity/en/conversations/rack-servers/disabling-writes-to-flash-as-the-flash-pa= rt-has-gone-bad/647f9010f4ccf8a8de13d06e) > > Is there something about the driver we use that=E2=80=99s known to cause = breakage? Is there a known firmware that fixes this? Is there a better pl= ace to ask this than the general =E2=80=9Cquestions=E2=80=9D list? > > This system is out of warranty, but as we have a lot of Dell machines out= in the field doing Important DNS Things, I may open a generic case with a = system that *is* under warranty to ask more about this. In the meantime, i= f anyone who maintains the driver knows something, I=E2=80=99d love to hear= from you. Replying to myself, I've heard back from Dell and am posting their=20 response here. (The TLDR? If you're not using mrsas, you've got a=20 ticking time bomb). They reported a bug in 2020 and nobody's been willing to look at it. :( Perhaps the correct answer here would be to make mrsas the default. This= =20 almost feels like something that is worthy of an errata notification. =3D=3D=3D Greetings from Dell EMC Server Support team! This is with reference to the= =20 recent issue reported : "disabling writes to flash as the flash part has=20 gone bad". The root cause is inbox MFI driver. The Raid map sync method in MFI driver= =20 is causing a sync loop with PERC firmware resulting upto 128 writes per=20 second into PERC internal flash storage space, thereby wearing it out.=20 PERC would need to be replaced when such errors are encountered. Dell and Broadcom have reported this issue to FreeBSD in Bugzilla. FreeBSD= =20 have provided a patch that removes Raid map sync functionality from mfi=20 driver. Since you have already engaged FreeBSD support, please check on below=20 link. =C2=A0https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D248352 FreeBSD is an unsupported Operating System. Dell has no engineering or=20 sustaining relationship with FreeBSD. MRSAS driver does not have this issue. =3D=3D=3D I'm going to go poke that bug. -Dan --=20 "No mowore webooting!!!" -Paul, 10-16-99, 10 PM --------Dan Mahoney-------- Techie, Sysadmin, WebGeek Gushi on efnet/undernet IRC FB: fb.com/DanielMahoneyIV LI: linkedin.com/in/gushi Site: http://www.gushi.org --------------------------- --33658924-470708021-1711040898=:96768-- From nobody Thu Mar 21 17:33:53 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V0syH53MSz5F7P7 for ; Thu, 21 Mar 2024 17:33:59 +0000 (UTC) (envelope-from 4250.82.1d52a00001560b3.f10e3ba1a81f55cd40e0bc07c9fe435e@email-od.com) Received: from s1-b0c6.socketlabs.email-od.com (s1-b0c6.socketlabs.email-od.com [142.0.176.198]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V0syG6PCPz43P4 for ; Thu, 21 Mar 2024 17:33:58 +0000 (UTC) (envelope-from 4250.82.1d52a00001560b3.f10e3ba1a81f55cd40e0bc07c9fe435e@email-od.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=email-od.com header.s=dkim header.b=dARjmfC+; dmarc=none; spf=pass (mx1.freebsd.org: domain of 4250.82.1d52a00001560b3.f10e3ba1a81f55cd40e0bc07c9fe435e@email-od.com designates 142.0.176.198 as permitted sender) smtp.mailfrom=4250.82.1d52a00001560b3.f10e3ba1a81f55cd40e0bc07c9fe435e@email-od.com DKIM-Signature: v=1; a=rsa-sha256; d=email-od.com;i=@email-od.com;s=dkim; c=relaxed/relaxed; q=dns/txt; t=1711042439; x=1713634439; h=content-transfer-encoding:content-type:mime-version:references:in-reply-to:message-id:subject:to:from:date:x-thread-info:subject:to:from:cc:reply-to; bh=sDKFZCCV+q5dOgbP6SJwjsZYrPfx0gFQv40NVGwYP2w=; b=dARjmfC+gh1FRpC2YPT87lqVXdJwt0dgcprCv8oYm0cy59bDDD40HKbzbAJo0yXi2z5aj7WBYrzUqGOHaTqlgCxlHTO77+7shjt+xeqPIPqaOyfrKXGezJ7I9fT2QFRgPOs0dlOeo3u9AkOYIqG1CywH/dl3jTqCjEPLUY5a2XE= X-Thread-Info: NDI1MC4xMi4xZDUyYTAwMDAxNTYwYjMucXVlc3Rpb25zPWZyZWVic2Qub3Jn Received: from r2.us-east-1.aws.in.socketlabs.com (r2.us-east-1.aws.in.socketlabs.com [142.0.191.2]) by mxsg2.email-od.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 21 Mar 2024 13:33:55 -0400 Received: from smtp.lan.sohara.org (EMTPY [185.202.17.215]) by r2.us-east-1.aws.in.socketlabs.com with ESMTP(version=Tls12 cipher=Aes256 bits=256); Thu, 21 Mar 2024 13:33:55 -0400 Received: from [192.168.63.1] (helo=steve.lan.sohara.org) by smtp.lan.sohara.org with smtp (Exim 4.95 (FreeBSD)) (envelope-from ) id 1rnMIc-000DGf-6h for questions@freebsd.org; Thu, 21 Mar 2024 17:33:54 +0000 Date: Thu, 21 Mar 2024 17:33:53 +0000 From: Steve O'Hara-Smith To: questions@freebsd.org Subject: Re: Dell perc card corrupted by FreeBSD driver? Message-Id: <20240321173353.956c888586df5bda6bde4935@sohara.org> In-Reply-To: <544cd874-2a76-07f2-e532-43532319b848@gushi.org> References: <360F0169-B132-4F5B-B261-E50661911CDC@gushi.org> <544cd874-2a76-07f2-e532-43532319b848@gushi.org> X-Mailer: Sylpheed 3.7.0 (GTK+ 2.24.33; amd64-portbld-freebsd13.1) X-Clacks-Overhead: "GNU Terry Pratchett" List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org Mime-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spamd-Bar: - X-Spamd-Result: default: False [-1.70 / 15.00]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; MV_CASE(0.50)[]; FORGED_SENDER(0.30)[steve@sohara.org,4250.82.1d52a00001560b3.f10e3ba1a81f55cd40e0bc07c9fe435e@email-od.com]; R_SPF_ALLOW(-0.20)[+ip4:142.0.176.0/20]; R_DKIM_ALLOW(-0.20)[email-od.com:s=dkim]; MIME_GOOD(-0.10)[text/plain]; ARC_NA(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:7381, ipnet:142.0.176.0/22, country:US]; DMARC_NA(0.00)[sohara.org]; MLMMJ_DEST(0.00)[questions@freebsd.org]; DWL_DNSWL_NONE(0.00)[email-od.com:dkim]; FROM_HAS_DN(0.00)[]; FROM_NEQ_ENVFROM(0.00)[steve@sohara.org,4250.82.1d52a00001560b3.f10e3ba1a81f55cd40e0bc07c9fe435e@email-od.com]; MID_RHS_MATCH_FROM(0.00)[]; TO_DN_NONE(0.00)[]; RCVD_TLS_LAST(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[email-od.com:+] X-Rspamd-Queue-Id: 4V0syG6PCPz43P4 On Thu, 21 Mar 2024 17:08:18 +0000 (UTC) "Dan Mahoney (Ports)" wrote: > FreeBSD is an unsupported Operating System. Dell has no engineering or > sustaining relationship with FreeBSD. Hmm Isilon OneFS, now called Dell PowerScale, is a FreeBSD based scale-out filesystem. I know for sure that Isilon has contributed code to FreeBSD - I was there. -- Steve O'Hara-Smith From nobody Fri Mar 22 03:42:25 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V17SQ5Kskz5FYZL for ; Fri, 22 Mar 2024 03:42:30 +0000 (UTC) (envelope-from robert@rrbrussell.com) Received: from fhigh4-smtp.messagingengine.com (fhigh4-smtp.messagingengine.com [103.168.172.155]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V17SP6Pwpz3y34 for ; Fri, 22 Mar 2024 03:42:29 +0000 (UTC) (envelope-from robert@rrbrussell.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rrbrussell.com header.s=fm1 header.b=DKbKrwdG; dkim=pass header.d=messagingengine.com header.s=fm2 header.b="s +7Qg87"; dmarc=pass (policy=quarantine) header.from=rrbrussell.com; spf=pass (mx1.freebsd.org: domain of robert@rrbrussell.com designates 103.168.172.155 as permitted sender) smtp.mailfrom=robert@rrbrussell.com Received: from compute7.internal (compute7.nyi.internal [10.202.2.48]) by mailfhigh.nyi.internal (Postfix) with ESMTP id 914C011400E2 for ; Thu, 21 Mar 2024 23:42:29 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute7.internal (MEProxy); Thu, 21 Mar 2024 23:42:29 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rrbrussell.com; h=cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm1; t=1711078949; x=1711165349; bh=xjP4N/zl+k/QgnVr9KT7LlHI0cvneXquX05cvO0uMaI=; b= DKbKrwdGXs9LVNDEPTnhaiwNMrjrptTh6JFwHhy7WdhfJU/rqyZ3ongshrB6g9kH amfTtgk71HDzg+z6+597LvrPFonj4vX1YU7eV+9/2H3fnQqIu9x9GJbXuTK9Fqmk tD73/aIeCIYamT49VyacAG+VoicAvuqmkwHAFG3NDsZOFg7hXyxQ3SpZnUMLqDFp x7kR1inQfO5Dmor25vmEft6Z/IQPO7ZkFtV3adG8XHYtn35/1bYo8z1jvcE2KXLB 4T05kUNE9tPpT3Nk00PxzJLjWDlWSBew6eS8yl9uFH84Ws/p1DmKHEqbunr1KdXs 7AMZgEMNyfW/XVXLie445A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-transfer-encoding:content-type :content-type:date:date:feedback-id:feedback-id:from:from :in-reply-to:in-reply-to:message-id:mime-version:references :reply-to:subject:subject:to:to:x-me-proxy:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t=1711078949; x= 1711165349; bh=xjP4N/zl+k/QgnVr9KT7LlHI0cvneXquX05cvO0uMaI=; b=s +7Qg87xYOczw0wzbjnsU+J3AizLWUG0c/Gz0lM7LEj44vJ50zZoKYZfEpRyzwbwr 7aDG9x49hEsZVyxjE45CB++YIVMfNKe4uPbrF5sYqFsxdoUqXyO5BxuKdvc0dlG2 l7KeHWYybEqlqlHkq8YXMKvoQtagj3eAwC/Vc1nS1f7QwZo+T6YP95DsTA/KslTl 68f8Rq39irluw1PQxp6LHPx9EJhShVxppHsr1ujlbGXinuOqhbNKhrV0bMNFwpb2 twWUyOUfB7zw5Rqjb13UcrHf+bNQ2Iouq3+484xm2umEQI6nS+XIFboHz/G6CVXj HPmt5mS8t6qppCOgIFj/w== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvledrleelgdeftdcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecunecujfgurhepfffhvffukfgjfhfogggtgfesthhqre dtredtjeenucfhrhhomhepfdftohgsvghrthcutfdrucftuhhsshgvlhhlfdcuoehrohgs vghrthesrhhrsghruhhsshgvlhhlrdgtohhmqeenucggtffrrghtthgvrhhnpefhheefff eiiefhuddtuefgffejieffueehtdfgjeefueeggeehkefgvdevtdffkeenucevlhhushht vghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehrohgsvghrthesrhhrsg hruhhsshgvlhhlrdgtohhm X-ME-Proxy: Feedback-ID: ie421460a:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA for ; Thu, 21 Mar 2024 23:42:28 -0400 (EDT) Date: Thu, 21 Mar 2024 22:42:25 -0500 From: "Robert R. Russell" To: questions@freebsd.org Subject: Re: Compiled i915kms.ko errors with incorrect file type does not match kernel Message-ID: <20240321224225.6afccf44@astraea.private.rrbrussell.com> In-Reply-To: <3dacd541.70f0.18e61641e0f.Webtop.74@optimum.net> References: <3dacd541.70f0.18e61641e0f.Webtop.74@optimum.net> X-Mailer: Claws Mail 3.19.1 (GTK+ 2.24.33; amd64-portbld-freebsd14.0) List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Spamd-Bar: ---- X-Spamd-Result: default: False [-4.99 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[messagingengine.com:dkim]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.89)[-0.890]; DMARC_POLICY_ALLOW(-0.50)[rrbrussell.com,quarantine]; R_DKIM_ALLOW(-0.20)[rrbrussell.com:s=fm1,messagingengine.com:s=fm2]; R_SPF_ALLOW(-0.20)[+ip4:103.168.172.128/27]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[103.168.172.155:from]; ARC_NA(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FREEFALL_USER(0.00)[robert]; ASN(0.00)[asn:209242, ipnet:103.168.172.0/24, country:US]; MID_RHS_MATCH_FROMTLD(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; MLMMJ_DEST(0.00)[questions@freebsd.org]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[questions@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_LAST(0.00)[]; DKIM_TRACE(0.00)[rrbrussell.com:+,messagingengine.com:+] X-Rspamd-Queue-Id: 4V17SP6Pwpz3y34 On Thu, 21 Mar 2024 10:22:15 -0400 (EDT) dvoich@optonline.net wrote: > I used portmaster to update my ports. When I booted up the next day > X11 failed to start. I saw that i915kms.ko failed to load. I thought > all I had to do was recompile and install drm-kmod. I compiled and > installed both from the ports. Not the one marked "ignore". > They both failed to load. > I am running 14.0 p5.=C2=A0 > I must have missed some step but I have no clue what it could be. The graphics/drm-kmod port is a meta port that pulls in the correct graphics/drm--kmod port and all of the graphics/gpu-firmware--kmod@ ports. Just rebuilding it will not rebuild the dependencies. For FreeBSD-14 you need graphics/drm-515-kmod and one of the flavors of graphics/gpu-firmware-intel-kmod to provide the firmware files. Once graphics/drm-515-kmod is rebuilt load the i915kms kernel module and then check dmesg for the name of which firmware file it couldn't load. Most of the files are named something like alk where the a stands for alder and the lk stand for lake. ```make -V FLAVORS``` in graphics/gpu-firmware-intel-kmod will give you all of the FLAVORS you can build. Once you know which flavor you need I would put the portmaster incantation to rebuild graphics/drm-515-kmod and graphics/gpu-firmware-intel-kmod@ in a shell script that you can run after every kernel installation. From nobody Fri Mar 22 07:10:53 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V1D545vrvz5Fwvn for ; Fri, 22 Mar 2024 07:11:04 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Received: from echo.brtsvcs.net (echo.brtsvcs.net [IPv6:2607:f740:c::4ae]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V1D540tMkz4HW8 for ; Fri, 22 Mar 2024 07:11:04 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of list_freebsd@bluerosetech.com designates 2607:f740:c::4ae as permitted sender) smtp.mailfrom=list_freebsd@bluerosetech.com Received: from chombo.houseloki.net (65-100-43-2.dia.static.qwest.net [65.100.43.2]) by echo.brtsvcs.net (Postfix) with ESMTPS id D552438D72 for ; Fri, 22 Mar 2024 07:10:55 +0000 (UTC) Received: from [10.26.25.100] (ivy.pas.ds.pilgrimaccounting.com [10.26.25.100]) by chombo.houseloki.net (Postfix) with ESMTPSA id 83D35267DD for ; Fri, 22 Mar 2024 00:10:54 -0700 (PDT) Message-ID: <0b06e637-6b26-4d01-21f5-9d9419c3c64e@bluerosetech.com> Date: Fri, 22 Mar 2024 00:10:53 -0700 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.15.1 Content-Language: en-US To: freebsd-questions@freebsd.org From: list_freebsd@bluerosetech.com Subject: How do I get just the pkg version in pkg-search results? Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Bar: - X-Spamd-Result: default: False [-1.75 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.45)[-0.448]; R_SPF_ALLOW(-0.20)[+mx:relay3.brtsvcs.net]; MIME_GOOD(-0.10)[text/plain]; RCVD_TLS_ALL(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; FROM_NO_DN(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:36236, ipnet:2607:f740:c::/48, country:US]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-questions@freebsd.org]; DMARC_NA(0.00)[bluerosetech.com]; FROM_EQ_ENVFROM(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; R_DKIM_NA(0.00)[]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; ARC_NA(0.00)[] X-Rspamd-Queue-Id: 4V1D540tMkz4HW8 I can do a search like this: # pkg search -qe -S name sqlite3 sqlite3-3.45.1,1 But all I need is the version string. If the version field was exposed like other fields, I could do this: # pkg search -qe -S name -L version sqlite3 3.45.1,1 But that's not (currently) an option. Is it guaranteed that a version string never contains '-'? That is, is the last '-' in the pkg-name string always going to be the delimiter between the name-flavor substring, and the version substring? From nobody Fri Mar 22 09:46:05 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V1HXS1Kr6z5GCZ6 for ; Fri, 22 Mar 2024 09:46:32 +0000 (UTC) (envelope-from lain@fair.moe) Received: from mail.076.ne.jp (mail.076.ne.jp [45.76.218.69]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V1HXQ38Krz4cRY for ; Fri, 22 Mar 2024 09:46:30 +0000 (UTC) (envelope-from lain@fair.moe) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=076.ne.jp header.s=dkim header.b=Bz5OzRzT; dmarc=none; spf=none (mx1.freebsd.org: domain of lain@fair.moe has no SPF policy when checking 45.76.218.69) smtp.mailfrom=lain@fair.moe Received: from mail.076.ne.jp (localhost [127.0.0.1]) by mail.076.ne.jp (Postfix) with ESMTP id 4V1HXF4RDnzW0s0 for ; Fri, 22 Mar 2024 18:46:21 +0900 (JST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=076.ne.jp; h= user-agent:in-reply-to:content-disposition:content-type :mime-version:references:message-id:subject:to:from:date; s= dkim; t=1711100780; x=1713692781; bh=Y3rlyE/n2WgjpkAcjU9VMP257wk dFzrmU8Up7oAWEGA=; b=Bz5OzRzTvJkCvA97vPKHLuq/mwVPhBW/ff9KSKqaky5 TwIn6bkCBwUfRILowUT3hs5uNTkoOabdGmYoc98q9lx95t3CCUIi1vHTrfT77G1y QaCu/eutHKect59zMYRofxYqLmyLv3tDYPGFTmDSaA6XzICkmGjtDXEAqn4Ws17L +NQ9THVYJZNDSm0FGFOG1++YJTiUbeGEoFfFwHOkuH6L9ZIrNWgYewuaQ37rRYqj Fbw8knjqfd3jgDl6XZgjGOR8RYtaO0Da6VQjameY3s//LKdsrsbZ3E/L9lspW6Cc uUBu/7BDKL9ZUWs2IhdrcSp8dkYSV0QrSeg/1UVtO+A== X-Virus-Scanned: Debian amavisd-new at guest.guest Received: from mail.076.ne.jp ([127.0.0.1]) by mail.076.ne.jp (mail.076.ne.jp [127.0.0.1]) (amavisd-new, port 10026) with ESMTP id EFac5UQQqmfR for ; Fri, 22 Mar 2024 18:46:20 +0900 (JST) Received: from mail.fair.moe (ip1.193.076.moe [219.117.254.193]) by mail.076.ne.jp (Postfix) with ESMTPSA id 4V1HXD55R4zW0rJ for ; Fri, 22 Mar 2024 18:46:20 +0900 (JST) Date: Fri, 22 Mar 2024 18:46:05 +0900 From: "lain." To: questions@freebsd.org Subject: Re: How do I get just the pkg version in pkg-search results? Message-ID: <6rdrwvmemstntzg2an5na3n7dxz6bob2lql6sxilebfchsd7vo@45dibnnsidnz> X-Location: =?utf-8?B?IkVhcnRoL+WcsOeQgyI=?= X-Operating-System: "GNU/Linux" References: <0b06e637-6b26-4d01-21f5-9d9419c3c64e@bluerosetech.com> List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="kq4n2u7ckwu5abgr" Content-Disposition: inline In-Reply-To: <0b06e637-6b26-4d01-21f5-9d9419c3c64e@bluerosetech.com> User-Agent: NeoMutt/20231221 X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.90 / 15.00]; SIGNED_PGP(-2.00)[]; SUBJECT_ENDS_QUESTION(1.00)[]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.997]; MID_RHS_NOT_FQDN(0.50)[]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; R_DKIM_ALLOW(-0.20)[076.ne.jp:s=dkim]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; DMARC_NA(0.00)[fair.moe]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ASN(0.00)[asn:20473, ipnet:45.76.192.0/19, country:US]; R_SPF_NA(0.00)[no SPF record]; MLMMJ_DEST(0.00)[questions@freebsd.org]; ARC_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; TO_DN_NONE(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[questions@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_LAST(0.00)[]; DKIM_TRACE(0.00)[076.ne.jp:+] X-Rspamd-Queue-Id: 4V1HXQ38Krz4cRY --kq4n2u7ckwu5abgr Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On 2024=E5=B9=B403=E6=9C=8822=E6=97=A5 00:10, the silly list_freebsd@bluero= setech.com claimed to have said: > But all I need is the version string. Simply do: pkg rquery '%v' sqlite3 # pkg rquery '%v' sqlite3 3.44.0_1,1 pkg rquery '%v' emacs =20 29.1_2,3 The reason why I picked these 2 packages is because the one is already installed, and the other isn't, so it's to show you it works in both cases. --=20 lain. Did you know that? 90% of all emails sent on a daily basis are being sent in plain text, and i= t's super easy to intercept emails as they flow over the internet? Never send passwords, tokens, personal information, or other volunerable in= formation without proper PGP encryption! If you're writing your emails unencrypted, please consider sending PGP encr= ypted emails for security reasons. You can find my PGP public key at: https://fair.moe/lain.asc Every good email client is able to send encrypted emails. If yours can't, then you should consider switching to a secure email client= , because yours just sucks. My recommendations are Claws Mail or NeoMutt. For instructions on how to encrypt your emails: https://unixsheikh.com/tutorials/gnupg-tutorial.html --kq4n2u7ckwu5abgr Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQGzBAABCAAdFiEEozVhUpXECiNYIKIXtWNzC1Y29b0FAmX9U1oACgkQtWNzC1Y2 9b2JSwv/VH2zTZTZa3p0LeoX5jMmB3yDqBt2RIyzv2EeEd51YSnb6EZgucfSE9iU f9AbY4vqKNMBPtzJWujThBRY0tPxDi+UwRqGxwotv/EtRncUIgslImRPisX/3IYb R5pacuPQLKnWQjAIvlaLKrU50N0ymTTcTnlzIAMMhNjmYcBH2OSbOZNUnBq/p+aM WxHEq/rzZEaYMIs7UDrQ0eBCnWiREKMJ2qI43zWRVM4AEdqO1SJEQhPto+Wvta6b 5B+SmGgpfUZV0b5JU3dP0zdh7KPcIdrr77FJsi4LiP/awtkx6FARsb5wyw9Ius85 xAcv6dhB57nPieuMYbixryiajevm4lq+CcNtzhtatdXcd+8tZeP6s+GMW7c57Ix/ xndILQCNvdg4lDrg1RlBJdXsPKIBwNV3uuNRSSDRNPhCBJawU/mLi2WWNzyxPIiU TtWERP1OMdrrcjx8//1B6bMKxmTcGbVTnGrugu1wc9Unx4mocB62FBHVnFnkFw0R 2rTKGA50 =zQBb -----END PGP SIGNATURE----- --kq4n2u7ckwu5abgr-- From nobody Fri Mar 22 16:27:33 2024 X-Original-To: questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V1SRl1BQrz5FHT2 for ; Fri, 22 Mar 2024 16:28:03 +0000 (UTC) (envelope-from robert@rrbrussell.com) Received: from fhigh4-smtp.messagingengine.com (fhigh4-smtp.messagingengine.com [103.168.172.155]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V1SRk1kPhz4XJS for ; Fri, 22 Mar 2024 16:28:02 +0000 (UTC) (envelope-from robert@rrbrussell.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=rrbrussell.com header.s=fm1 header.b="mT/mnMjB"; dkim=pass header.d=messagingengine.com header.s=fm2 header.b=TBsDvnmY; dmarc=pass (policy=quarantine) header.from=rrbrussell.com; spf=pass (mx1.freebsd.org: domain of robert@rrbrussell.com designates 103.168.172.155 as permitted sender) smtp.mailfrom=robert@rrbrussell.com Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by mailfhigh.nyi.internal (Postfix) with ESMTP id A067311400FA; Fri, 22 Mar 2024 12:28:01 -0400 (EDT) Received: from imap52 ([10.202.2.102]) by compute1.internal (MEProxy); Fri, 22 Mar 2024 12:28:01 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rrbrussell.com; h=cc:content-type:content-type:date:date:from:from:in-reply-to :in-reply-to:message-id:mime-version:references:reply-to:subject :subject:to:to; s=fm1; t=1711124881; x=1711211281; bh=GgOe9E6mFI O98YdZ+7bE1inG9SIsIfXJ7ExKFjMDJLo=; b=mT/mnMjB1K6NaVixpiqhxn/M57 r8gYon8mMNI9DDy6COE1gV3anjeZhcnJ4UFSAuT8gP4gzypE7Jj1D0DKH2yTFOpR Bz5UIwCYItssJPlzsEfzOmd8UXhVqo1LFdmd+DxPIVIpWHGU+Vdsu7mErFXPZyQ7 FP63Kd7JuKgA5E7h6YnIGlN9CPxY9XwPwUk4CbgAgCeYHh0idHZpSr06jk5UEqK6 bN2saGUbpBmyHEI5qcsUeqaPG/uq+Go1aESnpHjIS2z2S9A8dkQC+5BDPVyAAr+Q xjTJ7dr6sLHJb35X/ncPzgRtCLN61plhsQxEuM4ex/FOJMwIy+bN/sDjfj1g== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:content-type:date:date :feedback-id:feedback-id:from:from:in-reply-to:in-reply-to :message-id:mime-version:references:reply-to:subject:subject:to :to:x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm2; t=1711124881; x=1711211281; bh=GgOe9E6mFIO98YdZ+7bE1inG9SIs IfXJ7ExKFjMDJLo=; b=TBsDvnmYS5xCC3QNLBOo374C2Ok1SpR/xkxAX2f1R39j u7FcQuXwwMcYntsJl26ctpkjG/7TPtH/ithlnP8IwWxhoUfe3eqeo4v/tcdiD/9y /GjiUD9/WqdPDTC54hodeqjbWQNcYu5k3M9JWVuFxy6piBbwSzrut6/nu18rk/D6 lXSiCCvqS5EHn70K2CROJWU//juByQyBupC2dswyrGDyZKOx7Dm6YYVwR14cYzD5 iO94svGqR4FzGJX/nQUCZhyY94dpIveyZnZTj4eMqV4PxZV/gxxwvbzG/1iJbkJ9 J9A8NJGubSbFOYYBVRuDlOtHyyUiG/DUCwsVJdIszg== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvledruddtvddgvdegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpefofgggkfgjfhffhffvufgtsehttd ertderredtnecuhfhrohhmpehrohgsvghrthesrhhrsghruhhsshgvlhhlrdgtohhmnecu ggftrfgrthhtvghrnhepkefhffevveeugfetteegueegledviedvffevvddtieehvdekke elvefhhfevgedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhf rhhomheprhhosggvrhhtsehrrhgsrhhushhsvghllhdrtghomh X-ME-Proxy: Feedback-ID: ie421460a:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id 564CBC60097; Fri, 22 Mar 2024 12:28:01 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.11.0-alpha0-332-gdeb4194079-fm-20240319.002-gdeb41940 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Message-Id: <0518cc26-b8a8-408e-8c26-239522cdec7b@app.fastmail.com> In-Reply-To: <9c94a1f8-9bda-4804-99e7-c9ad8f2c4d09@edison> References: <3dacd541.70f0.18e61641e0f.Webtop.74@optimum.net> <20240321224225.6afccf44@astraea.private.rrbrussell.com> <9c94a1f8-9bda-4804-99e7-c9ad8f2c4d09@edison> Date: Fri, 22 Mar 2024 11:27:33 -0500 From: robert@rrbrussell.com To: dvoich , questions Subject: Re: Compiled i915kms.ko errors with incorrect file type does not match kernel Content-Type: text/plain X-Spamd-Bar: ----- X-Spamd-Result: default: False [-5.07 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; DWL_DNSWL_LOW(-1.00)[messagingengine.com:dkim]; NEURAL_HAM_SHORT(-0.98)[-0.981]; DMARC_POLICY_ALLOW(-0.50)[rrbrussell.com,quarantine]; R_SPF_ALLOW(-0.20)[+ip4:103.168.172.128/27]; R_DKIM_ALLOW(-0.20)[rrbrussell.com:s=fm1,messagingengine.com:s=fm2]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[103.168.172.155:from]; XM_UA_NO_VERSION(0.01)[]; RCPT_COUNT_TWO(0.00)[2]; MIME_TRACE(0.00)[0:+]; FREEFALL_USER(0.00)[robert]; FROM_NO_DN(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; MLMMJ_DEST(0.00)[questions@freebsd.org]; ASN(0.00)[asn:209242, ipnet:103.168.172.0/24, country:US]; FROM_EQ_ENVFROM(0.00)[]; TO_MATCH_ENVRCPT_SOME(0.00)[]; ARC_NA(0.00)[]; RCVD_TLS_LAST(0.00)[]; TO_DN_ALL(0.00)[]; DKIM_TRACE(0.00)[rrbrussell.com:+,messagingengine.com:+] X-Rspamd-Queue-Id: 4V1SRk1kPhz4XJS On Fri, Mar 22, 2024, at 10:32, dvoich wrote: >> On Mar 21, 2024 at 11:42 PM, Robert R. Russell wrote: >> >> On Thu, 21 Mar 2024 10:22:15 -0400 (EDT) >> dvoich@optonline.net wrote: >> >> > I used portmaster to update my ports. When I booted up the next day >> > X11 failed to start. I saw that i915kms.ko failed to load. I thought >> > all I had to do was recompile and install drm-kmod. I compiled and >> > installed both from the ports. Not the one marked "ignore". >> > They both failed to load. >> > I am running 14.0 p5. >> > I must have missed some step but I have no clue what it could be. >> >> The graphics/drm-kmod port is a meta port that pulls in the correct >> graphics/drm--kmod port and all of the >> graphics/gpu-firmware--kmod@ ports. Just >> rebuilding it will not rebuild the dependencies. >> >> For FreeBSD-14 you need graphics/drm-515-kmod and one of the >> flavors of graphics/gpu-firmware-intel-kmod to provide the firmware >> files. Once graphics/drm-515-kmod is rebuilt load the i915kms kernel >> module and then check dmesg for the name of which firmware file it >> couldn't load. Most of the files are named something like alk where the >> a stands for alder and the lk stand for lake. ```make -V FLAVORS``` >> in graphics/gpu-firmware-intel-kmod will give you all of the FLAVORS >> you can build. >> >> Once you know which flavor you need I would put the portmaster >> incantation to rebuild graphics/drm-515-kmod and >> graphics/gpu-firmware-intel-kmod@ in a shell script that you >> can run after every kernel installation. >> I failed at the beginning. After loading i915kms.ko I see nothing in dmesg about failing to load anything. I tried kload -v also. >> The CPU is a P8700 which is in the Penryn family. I have not been able to map that to any of the flavors. Your processor is old enough to not require firmware for the video chip. Loading extra firmware became required around the 4000 series Core processors. From nobody Fri Mar 22 16:42:07 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V1Sm81GkKz5FK7c for ; Fri, 22 Mar 2024 16:42:16 +0000 (UTC) (envelope-from mike@sentex.net) Received: from smarthost1.sentex.ca (smarthost1.sentex.ca [IPv6:2607:f3e0:0:1::12]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smarthost1.sentex.ca", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4V1Sm73NqDz4bhp; Fri, 22 Mar 2024 16:42:15 +0000 (UTC) (envelope-from mike@sentex.net) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:1::12 as permitted sender) smtp.mailfrom=mike@sentex.net Received: from pyroxene2a.sentex.ca (pyroxene19.sentex.ca [199.212.134.19]) by smarthost1.sentex.ca (8.17.1/8.16.1) with ESMTPS id 42MGg8aB089367 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=FAIL); Fri, 22 Mar 2024 12:42:08 -0400 (EDT) (envelope-from mike@sentex.net) Received: from [IPV6:2607:f3e0:0:4:3145:ad52:254b:d09a] ([IPv6:2607:f3e0:0:4:3145:ad52:254b:d09a]) by pyroxene2a.sentex.ca (8.17.1/8.15.2) with ESMTPS id 42MGg7aw012512 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO); Fri, 22 Mar 2024 12:42:07 -0400 (EDT) (envelope-from mike@sentex.net) Message-ID: Date: Fri, 22 Mar 2024 12:42:07 -0400 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Content-Language: en-US To: FreeBSD Questions From: mike tancsa Subject: Alder Lake and hwpstate_intel (RELENG_14) Autocrypt: addr=mike@sentex.net; keydata= xsBNBFywzOMBCACoNFpwi5MeyEREiCeHtbm6pZJI/HnO+wXdCAWtZkS49weOoVyUj5BEXRZP xflV2ib2hflX4nXqhenaNiia4iaZ9ft3I1ebd7GEbGnsWCvAnob5MvDZyStDAuRxPJK1ya/s +6rOvr+eQiXYNVvfBhrCfrtR/esSkitBGxhUkBjOti8QwzD71JVF5YaOjBAs7jZUKyLGj0kW yDg4jUndudWU7G2yc9GwpHJ9aRSUN8e/mWdIogK0v+QBHfv/dsI6zVB7YuxCC9Fx8WPwfhDH VZC4kdYCQWKXrm7yb4TiVdBh5kgvlO9q3js1yYdfR1x8mjK2bH2RSv4bV3zkNmsDCIxjABEB AAHNHW1pa2UgdGFuY3NhIDxtaWtlQHNlbnRleC5uZXQ+wsCOBBMBCAA4FiEEmuvCXT0aY6hs 4SbWeVOEFl5WrMgFAl+pQfkCGwMFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AACgkQeVOEFl5W rMiN6ggAk3H5vk8QnbvGbb4sinxZt/wDetgk0AOR9NRmtTnPaW+sIJEfGBOz47Xih+f7uWJS j+uvc9Ewn2Z7n8z3ZHJlLAByLVLtcNXGoRIGJ27tevfOaNqgJHBPbFOcXCBBFTx4MYMM4iAZ cDT5vsBTSaM36JZFtHZBKkuFEItbA/N8ZQSHKdTYMIA7A3OCLGbJBqloQ8SlW4MkTzKX4u7R yefAYQ0h20x9IqC5Ju8IsYRFacVZconT16KS81IBceO42vXTN0VexbVF2rZIx3v/NT75r6Vw 0FlXVB1lXOHKydRA2NeleS4NEG2vWqy/9Boj0itMfNDlOhkrA/0DcCurMpnpbM7ATQRcsMzk AQgA1Dpo/xWS66MaOJLwA28sKNMwkEk1Yjs+okOXDOu1F+0qvgE8sVmrOOPvvWr4axtKRSG1 t2QUiZ/ZkW/x/+t0nrM39EANV1VncuQZ1ceIiwTJFqGZQ8kb0+BNkwuNVFHRgXm1qzAJweEt RdsCMohB+H7BL5LGCVG5JaU0lqFU9pFP40HxEbyzxjsZgSE8LwkI6wcu0BLv6K6cLm0EiHPO l5G8kgRi38PS7/6s3R8QDsEtbGsYy6O82k3zSLIjuDBwA9GRaeigGppTxzAHVjf5o9KKu4O7 gC2KKVHPegbXS+GK7DU0fjzX57H5bZ6komE5eY4p3oWT/CwVPSGfPs8jOwARAQABwsB2BBgB CAAgFiEEmuvCXT0aY6hs4SbWeVOEFl5WrMgFAl+pQfkCGwwACgkQeVOEFl5WrMiVqwf9GwU8 c6cylknZX8QwlsVudTC8xr/L17JA84wf03k3d4wxP7bqy5AYy7jboZMbgWXngAE/HPQU95NM aukysSnknzoIpC96XZJ0okLBXVS6Y0ylZQ+HrbIhMpuQPoDweoF5F9wKrsHRoDaUK1VR706X rwm4HUzh7Jk+auuMYfuCh0FVlFBEuiJWMLhg/5WCmcRfiuB6F59ZcUQrwLEZeNhF2XJV4KwB Tlg7HCWO/sy1foE5noaMyACjAtAQE9p5kGYaj+DuRhPdWUTsHNuqrhikzIZd2rrcMid+ktb0 NvtvswzMO059z1YGMtGSqQ4srCArju+XHIdTFdiIYbd7+jeehg== Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Scanned-By: MIMEDefang 2.86 on 64.7.153.18 X-Spamd-Bar: -- X-Spamd-Result: default: False [-2.21 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-0.999]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; NEURAL_SPAM_SHORT(0.18)[0.177]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[199.212.134.19:received]; XM_UA_NO_VERSION(0.01)[]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; FREEFALL_USER(0.00)[mike]; MIME_TRACE(0.00)[0:+]; RCPT_COUNT_ONE(0.00)[1]; MID_RHS_MATCH_FROM(0.00)[]; R_DKIM_NA(0.00)[]; RCVD_TLS_ALL(0.00)[]; DMARC_NA(0.00)[sentex.net]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; MLMMJ_DEST(0.00)[freebsd-questions@freebsd.org]; RCVD_COUNT_TWO(0.00)[2]; TO_DN_ALL(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; ARC_NA(0.00)[] X-Rspamd-Queue-Id: 4V1Sm73NqDz4bhp I have a N100 based industrial PC that is showing some odd cpu frequency behaviour on FreeBSD. Linux doesnt seem to show it. When I boot up the PC, it seems to idle at full speed for a short time but then scales *down* to 400 after I add load and stays down at 402. Its almost like its backwards ? I tried setting dev.hwpstate_intel.[x].epp to zero, and it doesnt seem to make a difference. Temp is nice and low as I put a fan on it as well.  # sysctl -a dev.cpu | grep tempera dev.cpu.3.temperature: 26.0C dev.cpu.2.temperature: 26.0C dev.cpu.1.temperature: 26.0C dev.cpu.0.temperature: 26.0C #  sysctl -a dev.cpu | grep freq dev.cpu.3.freq_levels: 806/-1 dev.cpu.3.freq: 402 dev.cpu.2.freq_levels: 806/-1 dev.cpu.2.freq: 402 dev.cpu.1.freq_levels: 806/-1 dev.cpu.1.freq: 402 dev.cpu.0.freq_levels: 806/-1 dev.cpu.0.freq: 402 dmesg shows I think the ecore vs pcore ? VT(vga): resolution 640x480 CPU microcode: updated from 0xe to 0x15 CPU: Intel(R) N100 (806.40-MHz K8-class CPU)   Origin="GenuineIntel"  Id=0xb06e0  Family=0x6  Model=0xbe Stepping=0 Features=0xbfebfbff Features2=0x7ffafbbf   AMD Features=0x2c100800   AMD Features2=0x121   Structured Extended Features=0x239ca7eb   Structured Extended Features2=0x98c007bc   Structured Extended Features3=0xfc184410   XSAVE Features=0xf IA32_ARCH_CAPS=0x1580fd6b   VT-x: PAT,HLT,MTF,PAUSE,EPT,UG,VPID,VID,PostIntr   TSC: P-state invariant, performance statistics real memory  = 8589934592 (8192 MB) avail memory = 7994687488 (7624 MB) sett  sysctl -w debug.cpufreq.verbose=1 shows cpufreq: get returning immediate freq 402 cpufreq: get returning immediate freq 402 cpufreq: skipping info-only driver cpufreq2 cpufreq: No absolute levels returned by driver cpufreq: adding abs setting 806 at head cpufreq: skipping info-only driver cpufreq2 cpufreq: No absolute levels returned by driver cpufreq: adding abs setting 806 at head cpufreq: get returning immediate freq 402 cpufreq: get returning immediate freq 402 cpufreq: skipping info-only driver cpufreq1 cpufreq: No absolute levels returned by driver cpufreq: adding abs setting 806 at head cpufreq: skipping info-only driver cpufreq1 cpufreq: No absolute levels returned by driver cpufreq: adding abs setting 806 at head cpufreq: get returning immediate freq 402 cpufreq: get returning immediate freq 402 cpufreq: skipping info-only driver cpufreq0 cpufreq: No absolute levels returned by driver cpufreq: adding abs setting 806 at head cpufreq: skipping info-only driver cpufreq0 cpufreq: No absolute levels returned by driver cpufreq: adding abs setting 806 at head cpufreq: get returning immediate freq 402 cpufreq: get returning immediate freq 402 On linux, the CPU looks as follows  cat /proc/cpuinfo processor       : 0 vendor_id       : GenuineIntel cpu family      : 6 model           : 190 model name      : Intel(R) N100 stepping        : 0 microcode       : 0x15 cpu MHz         : 700.000 cache size      : 6144 KB physical id     : 0 siblings        : 4 core id         : 0 cpu cores       : 4 apicid          : 0 initial apicid  : 0 fpu             : yes fpu_exception   : yes cpuid level     : 32 wp              : yes flags           : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx pdpe1gb rdtscp lm constant_tsc art arch_perfmon pebs bts rep_good nopl xtopology nonstop_tsc cpuid aperfmperf tsc_known_freq pni pclmulqdq dtes64 monitor ds_cpl vmx est tm2 ssse3 sdbg fma cx16 xtpr pdcm sse4_1 sse4_2 x2apic movbe popcnt tsc_deadline_timer aes xsave avx f16c rdrand lahf_lm abm 3dnowprefetch cpuid_fault epb cat_l2 cdp_l2 ssbd ibrs ibpb stibp ibrs_enhanced tpr_shadow flexpriority ept vpid ept_ad fsgsbase tsc_adjust bmi1 avx2 smep bmi2 erms invpcid rdt_a rdseed adx smap clflushopt clwb intel_pt sha_ni xsaveopt xsavec xgetbv1 xsaves split_lock_detect user_shstk avx_vnni dtherm ida arat pln pts hwp hwp_notify hwp_act_window hwp_epp hwp_pkg_req vnmi umip pku ospke waitpkg gfni vaes vpclmulqdq rdpid movdiri movdir64b fsrm md_clear serialize arch_lbr ibt flush_l1d arch_capabilities vmx flags       : vnmi preemption_timer posted_intr invvpid ept_x_only ept_ad ept_1gb flexpriority apicv tsc_offset vtpr mtf vapic ept vpid unrestricted_guest vapic_reg vid ple shadow_vmcs ept_mode_based_exec tsc_scaling usr_wait_pause bugs            : spectre_v1 spectre_v2 spec_store_bypass swapgs bogomips        : 1612.80 clflush size    : 64 cache_alignment : 64 address sizes   : 39 bits physical, 48 bits virtual power management: processor       : 1 vendor_id       : GenuineIntel cpu family      : 6 model           : 190 model name      : Intel(R) N100 stepping        : 0 microcode       : 0x15 cpu MHz         : 700.000 cache size      : 6144 KB physical id     : 0 siblings        : 4 core id         : 1 cpu cores       : 4 apicid          : 2 initial apicid  : 2 fpu             : yes fpu_exception   : yes cpuid level     : 32 wp              : yes flags           : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx pdpe1gb rdtscp lm constant_tsc art arch_perfmon pebs bts rep_good nopl xtopology nonstop_tsc cpuid aperfmperf tsc_known_freq pni pclmulqdq dtes64 monitor ds_cpl vmx est tm2 ssse3 sdbg fma cx16 xtpr pdcm sse4_1 sse4_2 x2apic movbe popcnt tsc_deadline_timer aes xsave avx f16c rdrand lahf_lm abm 3dnowprefetch cpuid_fault epb cat_l2 cdp_l2 ssbd ibrs ibpb stibp ibrs_enhanced tpr_shadow flexpriority ept vpid ept_ad fsgsbase tsc_adjust bmi1 avx2 smep bmi2 erms invpcid rdt_a rdseed adx smap clflushopt clwb intel_pt sha_ni xsaveopt xsavec xgetbv1 xsaves split_lock_detect user_shstk avx_vnni dtherm ida arat pln pts hwp hwp_notify hwp_act_window hwp_epp hwp_pkg_req vnmi umip pku ospke waitpkg gfni vaes vpclmulqdq rdpid movdiri movdir64b fsrm md_clear serialize arch_lbr ibt flush_l1d arch_capabilities vmx flags       : vnmi preemption_timer posted_intr invvpid ept_x_only ept_ad ept_1gb flexpriority apicv tsc_offset vtpr mtf vapic ept vpid unrestricted_guest vapic_reg vid ple shadow_vmcs ept_mode_based_exec tsc_scaling usr_wait_pause bugs            : spectre_v1 spectre_v2 spec_store_bypass swapgs bogomips        : 1612.80 clflush size    : 64 cache_alignment : 64 address sizes   : 39 bits physical, 48 bits virtual power management: processor       : 2 vendor_id       : GenuineIntel cpu family      : 6 model           : 190 model name      : Intel(R) N100 stepping        : 0 microcode       : 0x15 cpu MHz         : 2600.008 cache size      : 6144 KB physical id     : 0 siblings        : 4 core id         : 2 cpu cores       : 4 apicid          : 4 initial apicid  : 4 fpu             : yes fpu_exception   : yes cpuid level     : 32 wp              : yes flags           : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx pdpe1gb rdtscp lm constant_tsc art arch_perfmon pebs bts rep_good nopl xtopology nonstop_tsc cpuid aperfmperf tsc_known_freq pni pclmulqdq dtes64 monitor ds_cpl vmx est tm2 ssse3 sdbg fma cx16 xtpr pdcm sse4_1 sse4_2 x2apic movbe popcnt tsc_deadline_timer aes xsave avx f16c rdrand lahf_lm abm 3dnowprefetch cpuid_fault epb cat_l2 cdp_l2 ssbd ibrs ibpb stibp ibrs_enhanced tpr_shadow flexpriority ept vpid ept_ad fsgsbase tsc_adjust bmi1 avx2 smep bmi2 erms invpcid rdt_a rdseed adx smap clflushopt clwb intel_pt sha_ni xsaveopt xsavec xgetbv1 xsaves split_lock_detect user_shstk avx_vnni dtherm ida arat pln pts hwp hwp_notify hwp_act_window hwp_epp hwp_pkg_req vnmi umip pku ospke waitpkg gfni vaes vpclmulqdq rdpid movdiri movdir64b fsrm md_clear serialize arch_lbr ibt flush_l1d arch_capabilities vmx flags       : vnmi preemption_timer posted_intr invvpid ept_x_only ept_ad ept_1gb flexpriority apicv tsc_offset vtpr mtf vapic ept vpid unrestricted_guest vapic_reg vid ple shadow_vmcs ept_mode_based_exec tsc_scaling usr_wait_pause bugs            : spectre_v1 spectre_v2 spec_store_bypass swapgs bogomips        : 1612.80 clflush size    : 64 cache_alignment : 64 address sizes   : 39 bits physical, 48 bits virtual power management: processor       : 3 vendor_id       : GenuineIntel cpu family      : 6 model           : 190 model name      : Intel(R) N100 stepping        : 0 microcode       : 0x15 cpu MHz         : 2597.960 cache size      : 6144 KB physical id     : 0 siblings        : 4 core id         : 3 cpu cores       : 4 apicid          : 6 initial apicid  : 6 fpu             : yes fpu_exception   : yes cpuid level     : 32 wp              : yes flags           : fpu vme de pse tsc msr pae mce cx8 apic sep mtrr pge mca cmov pat pse36 clflush dts acpi mmx fxsr sse sse2 ss ht tm pbe syscall nx pdpe1gb rdtscp lm constant_tsc art arch_perfmon pebs bts rep_good nopl xtopology nonstop_tsc cpuid aperfmperf tsc_known_freq pni pclmulqdq dtes64 monitor ds_cpl vmx est tm2 ssse3 sdbg fma cx16 xtpr pdcm sse4_1 sse4_2 x2apic movbe popcnt tsc_deadline_timer aes xsave avx f16c rdrand lahf_lm abm 3dnowprefetch cpuid_fault epb cat_l2 cdp_l2 ssbd ibrs ibpb stibp ibrs_enhanced tpr_shadow flexpriority ept vpid ept_ad fsgsbase tsc_adjust bmi1 avx2 smep bmi2 erms invpcid rdt_a rdseed adx smap clflushopt clwb intel_pt sha_ni xsaveopt xsavec xgetbv1 xsaves split_lock_detect user_shstk avx_vnni dtherm ida arat pln pts hwp hwp_notify hwp_act_window hwp_epp hwp_pkg_req vnmi umip pku ospke waitpkg gfni vaes vpclmulqdq rdpid movdiri movdir64b fsrm md_clear serialize arch_lbr ibt flush_l1d arch_capabilities vmx flags       : vnmi preemption_timer posted_intr invvpid ept_x_only ept_ad ept_1gb flexpriority apicv tsc_offset vtpr mtf vapic ept vpid unrestricted_guest vapic_reg vid ple shadow_vmcs ept_mode_based_exec tsc_scaling usr_wait_pause bugs            : spectre_v1 spectre_v2 spec_store_bypass swapgs bogomips        : 1612.80 clflush size    : 64 cache_alignment : 64 address sizes   : 39 bits physical, 48 bits virtual power management: coretemp0: on cpu0 hwpstate_intel0: on cpu0 hwpstate_intel1: on cpu1 hwpstate_intel2: on cpu2 hwpstate_intel3: on cpu3 Timecounter "TSC" frequency 806398651 Hz quality 1000 From nobody Fri Mar 22 18:23:28 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V1W0x55rSz5F2NX for ; Fri, 22 Mar 2024 18:23:29 +0000 (UTC) (envelope-from mike@sentex.net) Received: from smarthost1.sentex.ca (smarthost1.sentex.ca [IPv6:2607:f3e0:0:1::12]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smarthost1.sentex.ca", Issuer "R3" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4V1W0x0D1Sz4pTC for ; Fri, 22 Mar 2024 18:23:29 +0000 (UTC) (envelope-from mike@sentex.net) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of mike@sentex.net designates 2607:f3e0:0:1::12 as permitted sender) smtp.mailfrom=mike@sentex.net Received: from pyroxene2a.sentex.ca (pyroxene19.sentex.ca [199.212.134.19]) by smarthost1.sentex.ca (8.17.1/8.16.1) with ESMTPS id 42MINTtL004072 (version=TLSv1.3 cipher=TLS_AES_256_GCM_SHA384 bits=256 verify=FAIL) for ; Fri, 22 Mar 2024 14:23:29 -0400 (EDT) (envelope-from mike@sentex.net) Received: from [IPV6:2607:f3e0:0:4:3145:ad52:254b:d09a] ([IPv6:2607:f3e0:0:4:3145:ad52:254b:d09a]) by pyroxene2a.sentex.ca (8.17.1/8.15.2) with ESMTPS id 42MINSXh021886 (version=TLSv1.3 cipher=TLS_AES_128_GCM_SHA256 bits=128 verify=NO) for ; Fri, 22 Mar 2024 14:23:28 -0400 (EDT) (envelope-from mike@sentex.net) Message-ID: <0c6c3f8c-e98d-4091-b674-3d7fafbbbd59@sentex.net> Date: Fri, 22 Mar 2024 14:23:28 -0400 List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: Alder Lake and hwpstate_intel (RELENG_14) Content-Language: en-US From: mike tancsa To: FreeBSD Questions References: Autocrypt: addr=mike@sentex.net; keydata= xsBNBFywzOMBCACoNFpwi5MeyEREiCeHtbm6pZJI/HnO+wXdCAWtZkS49weOoVyUj5BEXRZP xflV2ib2hflX4nXqhenaNiia4iaZ9ft3I1ebd7GEbGnsWCvAnob5MvDZyStDAuRxPJK1ya/s +6rOvr+eQiXYNVvfBhrCfrtR/esSkitBGxhUkBjOti8QwzD71JVF5YaOjBAs7jZUKyLGj0kW yDg4jUndudWU7G2yc9GwpHJ9aRSUN8e/mWdIogK0v+QBHfv/dsI6zVB7YuxCC9Fx8WPwfhDH VZC4kdYCQWKXrm7yb4TiVdBh5kgvlO9q3js1yYdfR1x8mjK2bH2RSv4bV3zkNmsDCIxjABEB AAHNHW1pa2UgdGFuY3NhIDxtaWtlQHNlbnRleC5uZXQ+wsCOBBMBCAA4FiEEmuvCXT0aY6hs 4SbWeVOEFl5WrMgFAl+pQfkCGwMFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AACgkQeVOEFl5W rMiN6ggAk3H5vk8QnbvGbb4sinxZt/wDetgk0AOR9NRmtTnPaW+sIJEfGBOz47Xih+f7uWJS j+uvc9Ewn2Z7n8z3ZHJlLAByLVLtcNXGoRIGJ27tevfOaNqgJHBPbFOcXCBBFTx4MYMM4iAZ cDT5vsBTSaM36JZFtHZBKkuFEItbA/N8ZQSHKdTYMIA7A3OCLGbJBqloQ8SlW4MkTzKX4u7R yefAYQ0h20x9IqC5Ju8IsYRFacVZconT16KS81IBceO42vXTN0VexbVF2rZIx3v/NT75r6Vw 0FlXVB1lXOHKydRA2NeleS4NEG2vWqy/9Boj0itMfNDlOhkrA/0DcCurMpnpbM7ATQRcsMzk AQgA1Dpo/xWS66MaOJLwA28sKNMwkEk1Yjs+okOXDOu1F+0qvgE8sVmrOOPvvWr4axtKRSG1 t2QUiZ/ZkW/x/+t0nrM39EANV1VncuQZ1ceIiwTJFqGZQ8kb0+BNkwuNVFHRgXm1qzAJweEt RdsCMohB+H7BL5LGCVG5JaU0lqFU9pFP40HxEbyzxjsZgSE8LwkI6wcu0BLv6K6cLm0EiHPO l5G8kgRi38PS7/6s3R8QDsEtbGsYy6O82k3zSLIjuDBwA9GRaeigGppTxzAHVjf5o9KKu4O7 gC2KKVHPegbXS+GK7DU0fjzX57H5bZ6komE5eY4p3oWT/CwVPSGfPs8jOwARAQABwsB2BBgB CAAgFiEEmuvCXT0aY6hs4SbWeVOEFl5WrMgFAl+pQfkCGwwACgkQeVOEFl5WrMiVqwf9GwU8 c6cylknZX8QwlsVudTC8xr/L17JA84wf03k3d4wxP7bqy5AYy7jboZMbgWXngAE/HPQU95NM aukysSnknzoIpC96XZJ0okLBXVS6Y0ylZQ+HrbIhMpuQPoDweoF5F9wKrsHRoDaUK1VR706X rwm4HUzh7Jk+auuMYfuCh0FVlFBEuiJWMLhg/5WCmcRfiuB6F59ZcUQrwLEZeNhF2XJV4KwB Tlg7HCWO/sy1foE5noaMyACjAtAQE9p5kGYaj+DuRhPdWUTsHNuqrhikzIZd2rrcMid+ktb0 NvtvswzMO059z1YGMtGSqQ4srCArju+XHIdTFdiIYbd7+jeehg== In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Scanned-By: MIMEDefang 2.86 on 64.7.153.18 X-Spamd-Bar: --- X-Spamd-Result: default: False [-3.27 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.88)[-0.885]; R_SPF_ALLOW(-0.20)[+ip6:2607:f3e0::/32]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[199.212.134.19:received]; XM_UA_NO_VERSION(0.01)[]; TO_DN_ALL(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; FREEFALL_USER(0.00)[mike]; ASN(0.00)[asn:11647, ipnet:2607:f3e0::/32, country:CA]; MIME_TRACE(0.00)[0:+]; MID_RHS_MATCH_FROM(0.00)[]; R_DKIM_NA(0.00)[]; MLMMJ_DEST(0.00)[freebsd-questions@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; FROM_HAS_DN(0.00)[]; ARC_NA(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; DMARC_NA(0.00)[sentex.net]; RCVD_TLS_ALL(0.00)[] X-Rspamd-Queue-Id: 4V1W0x0D1Sz4pTC On 3/22/2024 12:42 PM, mike tancsa wrote: > I have a N100 based industrial PC that is showing some odd cpu > frequency behaviour on FreeBSD. Linux doesnt seem to show it. > > When I boot up the PC, it seems to idle at full speed for a short time > but then scales *down* to 400 after I add load and stays down at 402. > Its almost like its backwards ? > Looks like an open PR about it https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=271548     ---Mike From nobody Fri Mar 22 19:28:58 2024 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4V1XSc5nMNz5F9J3 for ; Fri, 22 Mar 2024 19:29:04 +0000 (UTC) (envelope-from sysadmin.lists@mailfence.com) Received: from wilbur.contactoffice.com (wilbur.contactoffice.com [212.3.242.68]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4V1XSc3Vgkz41nY for ; Fri, 22 Mar 2024 19:29:04 +0000 (UTC) (envelope-from sysadmin.lists@mailfence.com) Authentication-Results: mx1.freebsd.org; none Received: from fidget.co-bxl (fidget.co-bxl [10.2.0.33]) by wilbur.contactoffice.com (Postfix) with ESMTP id B4B291364; Fri, 22 Mar 2024 20:29:01 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; t=1711135741; s=20210208-e7xh; d=mailfence.com; i=sysadmin.lists@mailfence.com; h=Date:From:To:Message-ID:In-Reply-To:References:Subject:MIME-Version:Content-Type:Content-Transfer-Encoding; l=1589; bh=oS1X1qoMyD9U8ULEwIBdoWiiCIMJHW0QWe09KbGFDgA=; b=elG54QM5Hu1awlzBchWJZxrtaisVnLi/ZvjXR+TnMgjaxJrdMptoMVJs5stf3w/i Trg1fJtCrBaFYIQNS2oBMW6eJNwoTHkFc+xKQMFsEJL0CER2eOycx5jMw/YcvtCPMpr e7WVu6Upp7a7t3r3Mv6KKP9m/BDtNlNqpZhnhZcA/hkwz8SnHWLbss5qsB69QHbmhB9 v5jun8BnBdWH/XjnihzXQJA5TvrNejcVQfYdHd1DElGYC1b0AO58PAs4Sjid5tJ3K1m BUvBK5VqVxKTnspK9JeDIUOsJXdbboh0E7+GH/LGY/E5H+4s/xIbbw7tPDmxOuXTc/c jL1v7KRMvw== Date: Fri, 22 Mar 2024 20:28:58 +0100 (CET) From: Sysadmin Lists To: list_freebsd@bluerosetech.com, freebsd-questions@freebsd.org Message-ID: <1522700875.2589890.1711135738859@fidget.co-bxl> In-Reply-To: <0b06e637-6b26-4d01-21f5-9d9419c3c64e@bluerosetech.com> References: <0b06e637-6b26-4d01-21f5-9d9419c3c64e@bluerosetech.com> Subject: Re: How do I get just the pkg version in pkg-search results? List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Mailer: ContactOffice Mail X-ContactOffice-Account: com:312482426 X-Spamd-Bar: ---- X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:203, ipnet:212.3.242.64/26, country:US] X-Rspamd-Queue-Id: 4V1XSc3Vgkz41nY > ---------------------------------------- > From: > Date: Mar 22, 2024, 12:10:53 AM > To: > Subject: How do I get just the pkg version in pkg-search results? > > > I can do a search like this: > > # pkg search -qe -S name sqlite3 > sqlite3-3.45.1,1 > > But all I need is the version string. If the version field was exposed > like other fields, I could do this: > > # pkg search -qe -S name -L version sqlite3 > 3.45.1,1 > > But that's not (currently) an option. > > Is it guaranteed that a version string never contains '-'? That is, is > the last '-' in the pkg-name string always going to be the delimiter > between the name-flavor substring, and the version substring? > lain already answered your question with the best way to get the version string, but to add some recent history: A few months back the FreeBSD team switched packages from using .txz extensions to .pkg, and used tildes (~) instead of dashes (-), which broke `pkg clean' or `pkg autoclean', I forget which. During that time I wrote an awk script to clear my various pkg repos using the following pattern matches: { sub(/\/.+\//, "") } # strip pathname from filename /[-~][[:alnum:]]{10}.(txz|pkg)$/ { # binaries end in 10-alnum chars ext = substr($0, match($0, /.(pkg|txz)$/)) # bin file extension ver = substr($0, 0, match($0, /[-~][^-~]+$/) -1) # package version name pkg = substr(ver, 0, match(ver, /-[^-]+$/) -1) # package base name -- Sent with https://mailfence.com Secure and private email