From nobody Wed Mar 25 10:57:23 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgkPv2kzyz6W63F for ; Wed, 25 Mar 2026 10:57:23 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) Received: from mxrelay.nyi.freebsd.org (mxrelay.nyi.freebsd.org [IPv6:2610:1c1:1:606c::19:3]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "mxrelay.nyi.freebsd.org", Issuer "R12" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgkPv26Cdz3Qp5 for ; Wed, 25 Mar 2026 10:57:23 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774436243; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=dz3vr8euHpoTCGROnJIlWB5/hkqMpeNwXnSDl303zTQ=; b=boGttZs+PDsGblfRchfdcZ+4o6Z3iqHBhRJl+wPf9eVhVYsFIJqryXpzqPiKbCzDzwPS35 Q8oWIngkEg1eo0HTNFA6jGlsjwJBV90eJRKJJIqxS1wXoz1DiM52g9XTLXf1DCz+YDa3lR qcd3ITiPe1fzwbVqE0D1Jj72e7NmXMcTgnmQfu9kGJxtvmfvTWWr8UD/z3AjbT2l6kSXEs ZTsWuoEL89fCCM9sVAoZwdK46yqLlvuVCiKigOIZoLP/2OaBNUMoxnSmhN4h/NyFbDQPoB bu4fCgCUYE8/rWCh//zEfbFvuSSa36FJrubGZTAYX8pLfAnP5F38txVaflhOUg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774436243; a=rsa-sha256; cv=none; b=tzh7rNcSVYq8JxkvYauK9pPyJvHCMV3XNKW2bW2HurBoasEfCtXgddMskMtsVTcBXNs/FL eK0fiE6sdlcmh3E5owXnvtlV49h5yediscQm7lSJqeB13GuCnxUxBgkg9AIT31Obcn0VzH +8JYXsNzKl+mYsIOm+gO7xON3ZSwzYaslbox0FK2z/Zwww0O1Bq6gmMKU9G0GqiSjPSR7E XS3YKSFJxbfmYAwx9qqKEimj69CwW9CuofFPB0M6J56dedTgspZdAqU5l9Dw6ydedcJb1w buDx24freLrpTWdx4t1QXhWMKTq0L1laajgTtlO4QRY/8WcK2bWdiXv14afcAA== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774436243; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=dz3vr8euHpoTCGROnJIlWB5/hkqMpeNwXnSDl303zTQ=; b=mGDzmh4VDZC9b/+t+gDu8d6OrydjTUVKVLpDsHbtbuZsEE16k3BJ2hA9d1m0oHDE00154C S+ohtWZ7uIJ2HuHza/t8WL4bxjkzrPNDRZfGUPSduuDSRlVJMdAph2KpZc8i0nzA9Dxurc SnYVfe2inv7rFlxauXKH70D5OURdaTF6BvhuKHmXeDNZOcGBs/BQQXr27Tv667KUfBxhgz SH63nAipzLVd/o47DzL0H/u0Ir/9X2ApXiVJ1bfFDBSY4GKRWNadY8DRoUoOcZMlr1kNKy AhEMZRzZnPgkHNYPa2Hxy07hZh7xfOrna8QQ75JgRmgesAFPbT9ixnoGDOfCsA== Received: from kenobi.freebsd.org (kenobi.freebsd.org [IPv6:2610:1c1:1:606c::50:1d]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mxrelay.nyi.freebsd.org (Postfix) with ESMTPS id 4fgkPv1bDhz124K for ; Wed, 25 Mar 2026 10:57:23 +0000 (UTC) (envelope-from bugzilla-noreply@freebsd.org) Received: from kenobi.freebsd.org ([127.0.1.5]) by kenobi.freebsd.org (8.15.2/8.15.2) with ESMTP id 62PAvNY1019527 for ; Wed, 25 Mar 2026 10:57:23 GMT (envelope-from bugzilla-noreply@freebsd.org) Received: (from www@localhost) by kenobi.freebsd.org (8.15.2/8.15.2/Submit) id 62PAvN4H019526 for pkgbase@FreeBSD.org; Wed, 25 Mar 2026 10:57:23 GMT (envelope-from bugzilla-noreply@freebsd.org) X-Authentication-Warning: kenobi.freebsd.org: www set sender to bugzilla-noreply@freebsd.org using -f From: bugzilla-noreply@freebsd.org To: pkgbase@FreeBSD.org Subject: =?UTF-8?B?W0J1ZyAyOTIwNjldIEN1c3RvbSAvZXRjL2Nyb250YWIgaXMgb3Zl?= =?UTF-8?B?cndyaXR0ZW4g4oCTIG5vIGNyb250YWIucGtnc2F2ZSDigJMgd2l0aCBhIHBr?= =?UTF-8?B?Z2Jhc2UgbWFqb3IgdXBncmFkZQ==?= Date: Wed, 25 Mar 2026 10:57:23 +0000 X-Bugzilla-Reason: AssignedTo X-Bugzilla-Type: changed X-Bugzilla-Watch-Reason: None X-Bugzilla-Product: Base System X-Bugzilla-Component: conf X-Bugzilla-Version: 14.3-RELEASE X-Bugzilla-Keywords: pkgbase X-Bugzilla-Severity: Affects Some People X-Bugzilla-Who: ivy@FreeBSD.org X-Bugzilla-Status: Closed X-Bugzilla-Resolution: Not Accepted X-Bugzilla-Priority: --- X-Bugzilla-Assigned-To: pkgbase@FreeBSD.org X-Bugzilla-Flags: X-Bugzilla-Changed-Fields: bug_status resolution cc Message-ID: In-Reply-To: References: Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="UTF-8" X-Bugzilla-URL: https://bugs.freebsd.org/bugzilla/ Auto-Submitted: auto-generated List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 https://bugs.freebsd.org/bugzilla/show_bug.cgi?id=3D292069 Lexi Winter changed: What |Removed |Added ---------------------------------------------------------------------------- Status|Open |Closed Resolution|--- |Not Accepted CC| |ivy@FreeBSD.org --- Comment #1 from Lexi Winter --- pkgbase is not supported on FreeBSD 14, so i'm closing this. if the same problem is reproducible on FreeBSD 15 or later, please reopen it with more details. --=20 You are receiving this mail because: You are the assignee for the bug.= From nobody Wed Mar 25 12:54:59 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgn1q27Cmz6WDW7; Wed, 25 Mar 2026 12:55:11 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgn1q1HjLz3c0S; Wed, 25 Mar 2026 12:55:11 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774443311; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type; bh=HLf/yLpASMUIG5fUcYk048AX7VO0Rl/6eKxeMbRWiwU=; b=a8BGoSX6CBwgXLtXeSj0lxFQUCqh/KH3Uu0aVj7xHIb2W3VCSYJd1u7qXQ0IGFYnBteojR Q+xlMcGg8qmV/2wHz6RbGzO1Mvk4vSV4KOVyFy/HBdvMby0buuuzMTTQEC/7WvoN+gbuaT a+anj7kOkqWxmq/sJhrZP7+BAR49PAl62Alv5J6726XkAgnWkYa/E/6flJl+861XdNNVgJ bBLA/TSjG/9j3/zo9rmUy83yf9YzpY26H5Zm7m2toBxN7mpx1whjhYFU0zepQl0T9PXLer UxJc1Txd9zB9EByMQn5RwSxRAsNFYBwm82IoKNz/Ung1W/veqKsdAyR09IAFfA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774443311; a=rsa-sha256; cv=none; b=wPs9mw/WYdIq9Y/tq9FNy4r4bFfQVqa1A7OMbPpOCaVDfnRXDcyrw7+SiQJThZIeuDV0PC RuPP+pQcnF/MINXd8GVMhr0eR8C7mt5Xiuao9yJkxsyojsqokiTb33M9P2xxCBFUmD3jTo e5ngegd6tEZE5+fji7M6SRnKuMTfrhixdqiFgV/dErQqxriw9l9WlKbHHCVp6H8RTXdFn+ wds6ELaGv/Vj6TAR4yYxjcbKgjghPAvAEqz9P/N8jCwJRuw+nR4g2WOpv6aSr+XK1Qmsf3 Jv9X4MY4mO6EESov8EcXILifwgFv8l4m7+NoeHtP5CPSq98Op5HtPA6RjAVSnw== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774443311; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type; bh=HLf/yLpASMUIG5fUcYk048AX7VO0Rl/6eKxeMbRWiwU=; b=ninBoZ+yatyQ8uEHe0lspLfaTk+Ibis/eJPAhdtYfQAJZ6AJ441sBkJtxJUxj35Es0EzRv SuMpdGH7zGZQkQwb/bIrWX+3QOUhMasZRzqDJioi1Y19F6NzUE56HlS2IRnbZ2RK613Uk9 BQxo1fmRMTOhXgnZ0WLb0S8gN6m7Xlsutd/wECtelTYKNk3jsDExijK6w6KDOW0sihp4W3 29gtVIQFPmPLtdguyueWXJHd5I5aNuyc06r9vi9r6/3dakJK0o5zU5knDKQLJHzAVkF4aU 2NhRWrSnYQaaInIcV9QUUzHsJBk2OMjNNltNqcpPPxFSdlc82KQaJ2UgzumB7g== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fgn1p4ywBzq7n; Wed, 25 Mar 2026 12:55:10 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 12:54:59 +0000 From: Lexi Winter To: hackers@freebsd.org, pkgbase@freebsd.org Subject: more pkgbase reviewers required Message-ID: Mail-Followup-To: hackers@freebsd.org, pkgbase@freebsd.org List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="EdmoonszE+BEm+w7" Content-Disposition: inline --EdmoonszE+BEm+w7 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline hello, at this point, it's extremely difficult to get any pkgbase-related changes reviewed in Phabricator, which is an issue since we're now pushing pkgbase as the default method for installing the system. if you have some spare time to help with this, please consider adding yourself to the #pkgbase project on Phabricator and helping with some outstanding reviews. some examples of typical pkgbase reviews (some of which are now reviewed since i complained about this elsewhere): https://reviews.freebsd.org/D55645 https://reviews.freebsd.org/D55630 https://reviews.freebsd.org/D54542 https://reviews.freebsd.org/D54540 https://reviews.freebsd.org/D54282 i appreciate that this sort of install/upgrade stuff is boring and not sexy, but it is important to users, and it's difficult to find any motivation to contribute to the project when no one else seems to care. --EdmoonszE+BEm+w7 Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacPbHwAKCRD1nT63mIK/ YF58AQD3FxJTWFxbf10PnWyC9glQrXiub5HWiX09fG30/BB2mwD/Txg2thlpWThP ux/H6bbqOKqcB5COOvhkh0VuDykitQk= =ydkb -----END PGP SIGNATURE----- --EdmoonszE+BEm+w7-- From nobody Wed Mar 25 14:42:35 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgqQ11Hl2z6WM9Q; Wed, 25 Mar 2026 14:42:49 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from mail.nomadlogic.org (mail.nomadlogic.org [46.21.153.22]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgqPz2nygz3tCt; Wed, 25 Mar 2026 14:42:47 +0000 (UTC) (envelope-from pete@nomadlogic.org) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=nomadlogic.org header.s=04242021 header.b=LzAgmRn5; dmarc=pass (policy=quarantine) header.from=nomadlogic.org; spf=pass (mx1.freebsd.org: domain of pete@nomadlogic.org designates 46.21.153.22 as permitted sender) smtp.mailfrom=pete@nomadlogic.org DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=nomadlogic.org; s=04242021; t=1774449753; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=PdWqLdbGaHyLU1gmsG+f1+qb/6Im/LAiBjQuI5ey02c=; b=LzAgmRn5MwntjpmuDetQ/hXjtWlQV9umT7bzd9n3JLCoOQ/zU0yc6HfZZVjLecwrIZUUuI gNuFsmn/5hIP2cz6Nt/5JABv2KBC4AKkHfnJ63n0HfUm3ldzTBESp2MMuZgoAcnVW1Gh73 +WJ9AwYtRtbOFq7XP6Gurxqu86SQ8tQ= Received: from [192.168.1.182] (47-154-29-181.fdr01.snmn.ca.ip.frontiernet.net [47.154.29.181]) by mail.nomadlogic.org (OpenSMTPD) with ESMTPSA id 65f293fa (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 25 Mar 2026 14:42:33 +0000 (UTC) Message-ID: <3536ba2d-ada0-4ebe-8e20-da94c9bc6fea@nomadlogic.org> Date: Wed, 25 Mar 2026 07:42:35 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: more pkgbase reviewers required To: hackers@freebsd.org, pkgbase@freebsd.org References: Content-Language: en-US From: Pete Wright In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-4.00 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-1.000]; DMARC_POLICY_ALLOW(-0.50)[nomadlogic.org,quarantine]; R_DKIM_ALLOW(-0.20)[nomadlogic.org:s=04242021]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; ASN(0.00)[asn:29802, ipnet:46.21.153.0/24, country:US]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_ALL(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; MLMMJ_DEST(0.00)[hackers@freebsd.org,pkgbase@freebsd.org]; FROM_HAS_DN(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; TO_DN_NONE(0.00)[]; DKIM_TRACE(0.00)[nomadlogic.org:+] X-Rspamd-Queue-Id: 4fgqPz2nygz3tCt X-Spamd-Bar: --- On 3/25/26 05:54, Lexi Winter wrote: > hello, > > at this point, it's extremely difficult to get any pkgbase-related > changes reviewed in Phabricator, which is an issue since we're now > pushing pkgbase as the default method for installing the system. > > if you have some spare time to help with this, please consider adding > yourself to the #pkgbase project on Phabricator and helping with some > outstanding reviews. > > some examples of typical pkgbase reviews (some of which are now reviewed > since i complained about this elsewhere): > > https://reviews.freebsd.org/D55645 > https://reviews.freebsd.org/D55630 > https://reviews.freebsd.org/D54542 > https://reviews.freebsd.org/D54540 > https://reviews.freebsd.org/D54282 > > i appreciate that this sort of install/upgrade stuff is boring and > not sexy, but it is important to users, and it's difficult to find > any motivation to contribute to the project when no one else seems > to care. do you need to have a commit bit to be a useful reviewer. willing to test but was never sure how useful my input was on phabricator since i'm just a user/admin. -pete -- Pete Wright pete@nomadlogic.org From nobody Wed Mar 25 14:51:44 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgqcd33Qzz6WNMZ; Wed, 25 Mar 2026 14:52:01 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgqcd16Tfz43VQ; Wed, 25 Mar 2026 14:52:01 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774450321; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=9zl8eOeQD7geDKYFKxnttBwPO1aXumPLUOPWO8AQHbg=; b=X9pxQmdnz4mmxb22k7mXzmDL6refMdX3RV1HdTRyhin+iPxQX5Spi39jFiQ7Yq5BSNqDVU 5oi4IBm3x51CwNkX09Op68v6/kNIzWbe4b/nfDZDbMJG4VxfMItni0S6Bc10Wf5T7iwz8d NIQ76Etn/L+fQWFLVim7/hWWjrpyDbWaVuXkCYpU6oNyOwYkofoUzcnhP7+H2QhWiZoR0h ZJ/MPZMzFN2d2mpmt6UNq9izdsY67EzxEK9drMqhjNtHE+5sknW4V37m5pYECE8r1qDDUo 4mAgqJsmtDNBM1Jrsa6H0WVCfgEHjj01nfdOMghtotz87gI81gngAVX/2kJ+ww== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774450321; a=rsa-sha256; cv=none; b=EYg2bbmQJ+ic7p9zN2Rll7g7fAJwUo6FAdr9dNxTmBzFAipnfwG73FrTT3skoVrkMt9yGj Bv5oE6HVkIyXnAvFQr9m73+HfwdC3uY4tWlaHEc/GofMxEVMJEFYDFn5cikwzlZJ+g1xQj Fr0uUVlVqElQW+SzYlbWgruYlbUc1snPJIRB/t+YB3f/AHbg5qKTIJaznyVn+oWc53Yrg9 C9Mrct2w8R19S+mLyK1DGFStOsm0nPJO1Ycuag9aqhn9/djV+iOw3JMmqPOeYMhtbzbWMc fmTt9CzAhZYz3NLBz6iioHvZQoO/mJCPvcK5AV3VVhI8UIhBsK5SWGAmSu5R5g== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774450321; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=9zl8eOeQD7geDKYFKxnttBwPO1aXumPLUOPWO8AQHbg=; b=PMm9HWqJU553xFDubCaoRMNgsKbroz8TjMqBVbbUAtSgMBFmHRoT/p/GrD+0PhBEMFnYlR Y1pH2o1ysZv/xnrJJKKLBRv9NGOPqvBacFHJ8VD4iFidCLp9eVg13tNG/8qXvlNJ+FXL/Y fI0czNI+VTpXB0zzP51B9EXyu/obQmSSXS7f93Q3MR11hx4Sv0qYpeNzgcPx2lY//gGUvI zKoOy4MmTUY7KBTHV+pb4w87ip9MREV+RD1yaiJ0iyRwccsJCCmH4+Yz2yis8NrK9FISTN 8sO+pyXdIeIfp5u38DS81o26R+jnL4ljV86dzalbsXMa9OsN+dCD8PyRu02f+w== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fgqcc5Cjrzt2T; Wed, 25 Mar 2026 14:52:00 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 14:51:44 +0000 From: Lexi Winter To: hackers@freebsd.org, pkgbase@freebsd.org Subject: Re: more pkgbase reviewers required Message-ID: Mail-Followup-To: hackers@freebsd.org, pkgbase@freebsd.org References: <3536ba2d-ada0-4ebe-8e20-da94c9bc6fea@nomadlogic.org> List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="qjJx/Cv96oU2VK7Z" Content-Disposition: inline In-Reply-To: <3536ba2d-ada0-4ebe-8e20-da94c9bc6fea@nomadlogic.org> --qjJx/Cv96oU2VK7Z Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Pete Wright wrote in <3536ba2d-ada0-4ebe-8e20-da94c9bc6fea@nomadlogic.org>: > On 3/25/26 05:54, Lexi Winter wrote: > > at this point, it's extremely difficult to get any pkgbase-related > > changes reviewed in Phabricator, which is an issue since we're now > > pushing pkgbase as the default method for installing the system. > > [...] > > do you need to have a commit bit to be a useful reviewer. no. although... i will say i tend to give more attention to reviews =66rom other committers. but it's not a requirement to be a committer to review a change, and it's very helpful to get feedback from testing (e.g., "this change broke my system!"), or to know that a particular change might break existing deployments, for example. but when considering whether to land a change, i only look at reviews =66rom committers. i.e., i might *not* land a change if non-committers have objections, but i will not land a change if the only reviews are =66rom non-committers. does that make sense? basically what i'm saying is, yes, it's useful to get feedback on changes from people who aren't committers, but we still need committers to actually land changes. --qjJx/Cv96oU2VK7Z Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacP2fAAKCRD1nT63mIK/ YOSeAPwJUIeL7VSOqt93vqyChnPhik8Cmitz8Lzz6HxICiNLpgEA/on8Pit4w+TW 2pGYhIHGXZcTjf9M9u0eTzuT1mnZDwE= =C+dO -----END PGP SIGNATURE----- --qjJx/Cv96oU2VK7Z-- From nobody Wed Mar 25 15:13:54 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgr6C6lZKz6WPBV; Wed, 25 Mar 2026 15:14:11 +0000 (UTC) (envelope-from pete@nomadlogic.org) Received: from mail.nomadlogic.org (mail.nomadlogic.org [46.21.153.22]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgr6C42Prz3CWj; Wed, 25 Mar 2026 15:14:11 +0000 (UTC) (envelope-from pete@nomadlogic.org) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=nomadlogic.org; s=04242021; t=1774451644; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=rAUfbsItok6L2UG/rAPaqi30mdHmY2sl9g7m6pur86o=; b=fo/VngLPpVB+Mf3RRL6yjOi/AlI6vgl5XAfbrjA8/vg8cIWQMNhiiZSLlbbZjjO0W6M5Rc +fSPiubFSSrniGsjwBEPCGhhkIfC+KiR3wXA/Xlu/Wf0Mr98VQGW+ZgzkYCiI2ciQ+jdYZ BiN9CdE2w2mTcBqq/S8DLx+3JjNswEc= Received: from smtpclient.apple (47-154-29-181.fdr01.snmn.ca.ip.frontiernet.net [47.154.29.181]) by mail.nomadlogic.org (OpenSMTPD) with ESMTPSA id 2fac6a6b (TLSv1.3:TLS_AES_256_GCM_SHA384:256:NO); Wed, 25 Mar 2026 15:14:03 +0000 (UTC) Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable From: Pete Wright List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org Mime-Version: 1.0 (1.0) Subject: Re: more pkgbase reviewers required Date: Wed, 25 Mar 2026 08:13:54 -0700 Message-Id: <7B32EC96-7D56-41B1-940F-DE3C84DE08E9@nomadlogic.org> References: Cc: hackers@freebsd.org, pkgbase@freebsd.org In-Reply-To: To: Lexi Winter X-Mailer: iPhone Mail (23E246) X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:29802, ipnet:46.21.153.0/24, country:US] X-Rspamd-Queue-Id: 4fgr6C42Prz3CWj X-Spamd-Bar: ---- Sent from my iPhone > On Mar 25, 2026, at 7:52=E2=80=AFAM, Lexi Winter wrote: >=20 > =EF=BB=BFPete Wright wrote in <3536ba2d-ada0-4ebe-8e20-da94c9bc6fea@nomadl= ogic.org>: >>> On 3/25/26 05:54, Lexi Winter wrote: >>> at this point, it's extremely difficult to get any pkgbase-related >>> changes reviewed in Phabricator, which is an issue since we're now >>> pushing pkgbase as the default method for installing the system. >>> [...] >>=20 >> do you need to have a commit bit to be a useful reviewer. >=20 > no. although... i will say i tend to give more attention to reviews > from other committers. but it's not a requirement to be a committer > to review a change, and it's very helpful to get feedback from testing > (e.g., "this change broke my system!"), or to know that a particular > change might break existing deployments, for example. >=20 > but when considering whether to land a change, i only look at reviews > from committers. i.e., i might *not* land a change if non-committers > have objections, but i will not land a change if the only reviews are > from non-committers. >=20 > does that make sense? basically what i'm saying is, yes, it's useful > to get feedback on changes from people who aren't committers, but we > still need committers to actually land changes. > Understood - I=E2=80=99ll let yall with commit bits do your thing and get ou= t of the way since it sounds like it=E2=80=99ll just be noise. -Pete= From nobody Wed Mar 25 16:27:03 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgskR4Q5mz6WTf2; Wed, 25 Mar 2026 16:27:11 +0000 (UTC) (envelope-from ziaee@FreeBSD.org) Received: from mailtransmit04.runbox.com (mailtransmit04.runbox.com [IPv6:2a0c:5a00:149::25]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange ECDHE (prime256v1) server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgskR2DXkz3Mcw; Wed, 25 Mar 2026 16:27:11 +0000 (UTC) (envelope-from ziaee@FreeBSD.org) Authentication-Results: mx1.freebsd.org; none Received: from mailtransmit02.runbox ([10.9.9.162] helo=aibo.runbox.com) by mailtransmit04.runbox.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256 (Exim 4.93) (envelope-from ) id 1w5R4R-005J9b-RU; Wed, 25 Mar 2026 17:27:03 +0100 Received: from [10.9.9.127] (helo=rmmprod05.runbox) by mailtransmit02.runbox with esmtp (Exim 4.86_2) (envelope-from ) id 1w5R4R-0000hD-BE; Wed, 25 Mar 2026 17:27:03 +0100 Received: from mail by rmmprod05.runbox with local (Exim 4.86_2) (envelope-from ) id 1w5R4R-0001pm-9C; Wed, 25 Mar 2026 17:27:03 +0100 Content-Type: text/plain; charset="utf-8" Content-Disposition: inline Content-Transfer-Encoding: quoted-printable List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Received: from [Authenticated alias (960477)] by runbox.com with http (RMM6); Wed, 25 Mar 2026 16:27:03 GMT From: "Alexander Ziaee" To: "Pete Wright" , "Lexi Winter" CC: "hackers" , "pkgbase" Subject: Re: more pkgbase reviewers required Date: Wed, 25 Mar 2026 16:27:03 +0000 (UTC) X-RMM-Aliasid: 960477 X-Mailer: RMM6 In-Reply-To: <7B32EC96-7D56-41B1-940F-DE3C84DE08E9@nomadlogic.org> Message-Id: X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:50304, ipnet:2a0c:5a00::/29, country:NO] X-Rspamd-Queue-Id: 4fgskR2DXkz3Mcw X-Spamd-Bar: ---- On 2026-03-25 11:13 -04:00 EDT, "Pete Wright" wrote: >=20 >> On Mar 25, 2026, at 7:52=E2=80=AFAM, Lexi Winter wrote: >>=20 >> =EF=BB=BFPete Wright wrote in <3536ba2d-ada0-4ebe-8e20-da94c9bc6fea@noma= dlogic.org>: >>>> On 3/25/26 05:54, Lexi Winter wrote: >>>> at this point, it's extremely difficult to get any pkgbase-related >>>> changes reviewed in Phabricator, which is an issue since we're now >>>> pushing pkgbase as the default method for installing the system. >>>> [...] >>>=20 >>> do you need to have a commit bit to be a useful reviewer. >>=20 >> no. although... i will say i tend to give more attention to reviews >> from other committers. but it's not a requirement to be a committer >> to review a change, and it's very helpful to get feedback from testing >> (e.g., "this change broke my system!"), or to know that a particular >> change might break existing deployments, for example. >>=20 >> but when considering whether to land a change, i only look at reviews >> from committers. i.e., i might *not* land a change if non-committers >> have objections, but i will not land a change if the only reviews are >> from non-committers. >>=20 >> does that make sense? basically what i'm saying is, yes, it's useful >> to get feedback on changes from people who aren't committers, but we >> still need committers to actually land changes. >=20 > Understood - I=E2=80=99ll let yall with commit bits do your thing and get= out of the way since it sounds like it=E2=80=99ll just be noise. No, it's not noise. Community reviews are extremely helpful. What I believe= ivy is saying is that her specific ask in this thread is that more committ= ers review to satisfy the goal that we have a consensus about changes. We need all the testing and constructive feedback we can get. Best, Alex= From nobody Wed Mar 25 16:46:03 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgt8S0GXRz6WVkv; Wed, 25 Mar 2026 16:46:16 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgt8R6stFz3PVp; Wed, 25 Mar 2026 16:46:15 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774457176; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=C32o+w3bncCsYAp5Cd+5entwNKbDUGmDYasV+grngKw=; b=Y6bLfMcb4BZeoumWftsxMSP2NgoRel/DHQUFE6EhNdb5LRynnoV56v8yUKpVn1Pqk7pqxe H9oJSiRhCkcVrH3ZBCc7ck+TpqP6owMsaQCy3dAuV5p0Ji0lOxO/yxBneq5fQXzcGw2vu9 4az6V9pYNz6Pedsrda0ytiB3qH2+094QsIVeI4PUBV2OySyiU2o0dJVKjlfZZWmA8vjox8 y+rJhstm1pC1BtlhanQX0GD6FXizBIpFbjDrH3nNJ3bOMRDxkEIwwVRZKmPxbAklDo/MMb V/dPTZRMyxOHX5755WvhOxYhWYeXJ5M0MdwVHR0FASPtlsQ5C1tCRIS91aXUtg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774457176; a=rsa-sha256; cv=none; b=eVZb3wm4yoJhlpy+bnpND9Jt+fuPL0clUMNrRbmkhZ3QNujQc/gD8lzluH+tQI1jlEJpXa VLgss06dUEltuKM3hlMoC0x5mTmZ3F6+8Mz4FztmNd9cH6Y0KVPZTtjAtQd2r/+sAab2oI +uBJ2+u8nqNGUTRaMYHP+pPMtiEzsABKCTcjRepIPQpiRthDzqDs0pw3G07J19o/Jptgpg 2cm4KUszygEZTh5CazdkbrN0gW+3txAQNIsCH2Ybtz/yJlHCKV3v5MJWA7sKDuLWoyTg0O 5yj3IVjkJtX1KzNwZDxhwhwXEtKMmK4D9lz+oLUVNeUCQIQ+m4Ebrj8Bo8DSTQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774457176; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=C32o+w3bncCsYAp5Cd+5entwNKbDUGmDYasV+grngKw=; b=eOohF4SbLR3jXvjbyvA1UwHDZK1HoXuAKya+yLiiOmwmWk0IbsUOhBx3jYlAQdi1g56y5v TDCYhK9thDTWuuiKFuP9/6BWRbIal9Qu0IJdZrWV9Q0bDb6/bUfgkSOTUySm0u2DXzHCBO Hve87Pd0bM/mXkUjrftPOiNU+42+s4tZIGT7TPUN03hwsbt6YXpfGRpoAYNMFir9WlAYz5 OQ3BdnLDerClZe0jvfLBijIcAbvI+OA2sYumfpm8+dkaIWExxg0HBNT0Wjrgna4LxHhqZX OiXpOZTOlcZHqwBfrU6xv/YKoKQC+Kvqu2V5IEMABGl9ItGdvhLM+HZgMenNDQ== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fgt8R3QrgzwCZ; Wed, 25 Mar 2026 16:46:15 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 16:46:03 +0000 From: Lexi Winter To: hackers , pkgbase Subject: Re: more pkgbase reviewers required Message-ID: Mail-Followup-To: hackers , pkgbase References: <7B32EC96-7D56-41B1-940F-DE3C84DE08E9@nomadlogic.org> List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="zT8EB37IfpNvJGhG" Content-Disposition: inline In-Reply-To: --zT8EB37IfpNvJGhG Content-Type: text/plain; charset=utf-8 Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Alexander Ziaee wrote in : > On 2026-03-25 11:13 -04:00 EDT, "Pete Wright" wrote: > > Understood - I=E2=80=99ll let yall with commit bits do your thing and g= et > > out of the way since it sounds like it=E2=80=99ll just be noise. >=20 > No, it's not noise. Community reviews are extremely helpful. What I > believe ivy is saying is that her specific ask in this thread is that > more committers review to satisfy the goal that we have a consensus > about changes. right. the current situation is that no one has objected to any outstanding pkgbase changes, but also no one has approved them, so we can't land them. feedback from non-committers is always appreciate because, of course, we don't want to land changes that cause issues for users, so it's good if users will review changes before they land. notwithstanding that, my specific purpose in this thread is to get more reviews from committers, because that is what we need to land changes, and i've had changes pending since January that i can't land due to not having a review. so iow, i'm not saying we don't want reviews from non-committers, because we do, and if any non-committers are reading this i would encourage you to review pkgbase changes. but the specific problem i'm having here is that we do need reviews from committers in order to progress with development. that said, since i posted this, several people have commented on the outstanding reviews i mentioned, so thank you for that. --zT8EB37IfpNvJGhG Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacQRRwAKCRD1nT63mIK/ YMNBAQDNoAFhRgYUy2nW3WHXwqiqXqzwaL4sCghBFQeP8wsH/QEA3l/adrDzRRuQ 3hT7x34M40prdaVIz5kGEjs6krWiOwg= =UOd5 -----END PGP SIGNATURE----- --zT8EB37IfpNvJGhG-- From nobody Wed Mar 25 19:43:20 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgy4x1z3gz6Whd8 for ; Wed, 25 Mar 2026 19:43:29 +0000 (UTC) (envelope-from Wismos@proton.me) Received: from mail-106101.protonmail.ch (mail-106101.protonmail.ch [79.135.106.101]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "protonmail.com", Issuer "R12" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgy4w0Xbnz3kVC for ; Wed, 25 Mar 2026 19:43:27 +0000 (UTC) (envelope-from Wismos@proton.me) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=proton.me header.s=protonmail header.b="lZ14f/ax"; dmarc=pass (policy=quarantine) header.from=proton.me; spf=pass (mx1.freebsd.org: domain of Wismos@proton.me designates 79.135.106.101 as permitted sender) smtp.mailfrom=Wismos@proton.me DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=proton.me; s=protonmail; t=1774467805; x=1774727005; bh=/O1/IxCx4ABG9zmAtP1au6uvtk/qgujrYrxG7h09E9U=; h=Date:To:From:Subject:Message-ID:Feedback-ID:From:To:Cc:Date: Subject:Reply-To:Feedback-ID:Message-ID:BIMI-Selector; b=lZ14f/axTL3gXrph860ojTQqpFwSTNsizzYhFZjB/Va1HvM5F3WmTw7uGnNlHBwr+ 6jEHjTBJwjwVjlbksaS2CZVTelR0WkwFaINKj+tUVIVqIbC8zuAyMQEzXFjyThyZsW VfVNAcggOHxOn3uIL23/U9EQ3XQy9yI73H2M9B6dR00kWxtEBKH5lx0Sqax8fbsPfI QvSk+0xUCQS/DClcZNLL0xh5BNpmORrp8S2YbUG3ow83rz6xyuOGiRqCIpxh5IJOWE Aa/d1Sdc24kpf2ZvhtwJSITKzF4DJHL95791d2041AfWbhUJKFi31DaBXL4EiYDq5a Hnshtg/QdGgJg== Date: Wed, 25 Mar 2026 19:43:20 +0000 To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org From: Wismos@proton.me Subject: installing world from src on a pkgbase system Message-ID: Feedback-ID: 51325846:user:proton X-Pm-Message-ID: 71e6179a0a20c5a96d898df3a00e34143cc923e7 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="b1=_JqhJuOCb429hj3Hj6NGTVpMkdhutObLDKPldhUqAts" X-Spamd-Result: default: False [-3.20 / 15.00]; MIME_BASE64_TEXT_BOGUS(1.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-1.00)[-0.999]; DMARC_POLICY_ALLOW(-0.50)[proton.me,quarantine]; RWL_MAILSPIKE_VERYGOOD(-0.20)[79.135.106.101:from]; R_DKIM_ALLOW(-0.20)[proton.me:s=protonmail]; R_SPF_ALLOW(-0.20)[+ip4:79.135.106.0/24]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[79.135.106.101:from]; MIME_BASE64_TEXT(0.10)[]; DKIM_TRACE(0.00)[proton.me:+]; FROM_EQ_ENVFROM(0.00)[]; RCPT_COUNT_TWO(0.00)[2]; MISSING_XM_UA(0.00)[]; ASN(0.00)[asn:62371, ipnet:79.135.106.0/24, country:CH]; ARC_NA(0.00)[]; TO_MATCH_ENVRCPT_SOME(0.00)[]; TO_DN_NONE(0.00)[]; FROM_NO_DN(0.00)[]; MLMMJ_DEST(0.00)[freebsd-pkgbase@freebsd.org]; RCVD_COUNT_ZERO(0.00)[0]; MID_RHS_MATCH_FROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~] X-Rspamd-Queue-Id: 4fgy4w0Xbnz3kVC X-Spamd-Bar: --- --b1=_JqhJuOCb429hj3Hj6NGTVpMkdhutObLDKPldhUqAts Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: base64 SGkgdGhlcmUsIGkgaGF2ZSBiZWVuIHRyeWluZyBwa2diYXNlIGZvciBhIHdoaWxlIGJ1dCB0aGVy ZSBpcyBvbmUgc3BlY2lmaWMgdG9waWMgdGhhdCdzIHN0aWxsIG5vdCB2ZXJ5IGNsZWFyIHRvIG1l IGlzIGhvdyBkbyBpIGdvIGFyb3VuZCBvbmx5IGluYXRhbGxpbmcgd29ybGQgZnJvbSBzcmMgb24g YSBwa2diYXNlIHN5c3RlbQoKbWFrZSBwYWNrYWdlcyByZXF1aXJlcyB5b3UgdG8gZG8gYm90aCBi dWlsZHdvcmxkIGFuZCBidWlsZGtlcm5lbCxpdCBhbHNvIHJlcXVpcmVzIHlvdSB0byBzZXR1cCBh IGxvY2FsIHJlcG8gdXNpbmcgbmdpbngoYXMgZmFyIGFzIGkgY2FuIHJlYWQgZnJvbSB0aGUgaGFu ZGJvb2spIGkgdHJpZWQgdG8gZG8ganVzdCBwa2cgYWRkICogZnJvbSB0aGUgL3Vzci9vYmovdXNy L3NyYy9yZXBvL0ZyZWVCU0Q6JHtBQkl9Lnh4eHgveHh4eCBhbmQgdGhhdCBvYnZpb3VzbHkgbWVz c2VkIHVwIG15IHN5c3RlbSBwcmV0dHkgYmFkCgpzbyBpIHdhcyB3b25kZXJpbmcgaWYgdGhlcmUg d2FzIGEgd2F5IHRvIGJ1aWxkIHBhY2thZ2VzIG9mIG9ubHkgYmFzZSB3aXRob3V0IGhhdmluZyBi dWlsZGtlcm5lbCBhcyB3ZWxsIGFuZCBpZiB0aGVyZSB3YXMgYSB3YXkgdG8gaW5zdGFsbCB0aG9z ZSBwYWNrYWdlcyB3aXRob3V0IGhhdmluZyB0byBnbyB0aHJvdWdoIHNldHRpbmcgdXAgYSBzZXJ2 ZXIgd2l0aCBuZ2lueCBhbmQgYXMgZmFyIGFzIGkgYW0gYXdhcmUgcGFja2FnZXdvcmxkIHRhcmdl dCBpcyBvbmx5IGZvciByZWxlYXNlIHRhcmdldHMgYW5kIG5vdCBmb3IgbWU= --b1=_JqhJuOCb429hj3Hj6NGTVpMkdhutObLDKPldhUqAts Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: base64 PGh0bWw+PGhlYWQ+PC9oZWFkPjxib2R5PkhpIHRoZXJlLCBpIGhhdmUgYmVlbiB0cnlpbmcgcGtn YmFzZSBmb3IgYSB3aGlsZSBidXQgdGhlcmUgaXMgb25lIHNwZWNpZmljIHRvcGljIHRoYXQncyBz dGlsbCBub3QgdmVyeSBjbGVhciB0byBtZSBpcyBob3cgZG8gaSBnbyBhcm91bmQgb25seSBpbmF0 YWxsaW5nIHdvcmxkIGZyb20gc3JjIG9uIGEgcGtnYmFzZSBzeXN0ZW08ZGl2Pjxicj48L2Rpdj48 ZGl2Pm1ha2UgcGFja2FnZXMgcmVxdWlyZXMgeW91IHRvIGRvIGJvdGggYnVpbGR3b3JsZCBhbmQg YnVpbGRrZXJuZWwsaXQgYWxzbyByZXF1aXJlcyB5b3UgdG8gc2V0dXAgYSBsb2NhbCByZXBvIHVz aW5nIG5naW54KGFzIGZhciBhcyBpIGNhbiByZWFkIGZyb20gdGhlIGhhbmRib29rKSBpIHRyaWVk IHRvIGRvIGp1c3QgcGtnIGFkZCAqIGZyb20gdGhlIC91c3Ivb2JqL3Vzci9zcmMvcmVwby9GcmVl QlNEOiR7QUJJfS54eHh4L3h4eHggYW5kIHRoYXQgb2J2aW91c2x5IG1lc3NlZCB1cCBteSBzeXN0 ZW0gcHJldHR5IGJhZDwvZGl2PjxkaXY+PGJyPjwvZGl2PjxkaXY+c28gaSB3YXMgd29uZGVyaW5n IGlmIHRoZXJlIHdhcyBhIHdheSB0byBidWlsZCBwYWNrYWdlcyBvZiBvbmx5IGJhc2Ugd2l0aG91 dCBoYXZpbmcgYnVpbGRrZXJuZWwgYXMgd2VsbCBhbmQgaWYgdGhlcmUgd2FzIGEgd2F5IHRvIGlu c3RhbGwgdGhvc2UgcGFja2FnZXMgd2l0aG91dCBoYXZpbmcgdG8gZ28gdGhyb3VnaCBzZXR0aW5n IHVwIGEgc2VydmVyIHdpdGggbmdpbnggYW5kIGFzIGZhciBhcyBpIGFtIGF3YXJlIHBhY2thZ2V3 b3JsZCB0YXJnZXQgaXMgb25seSBmb3IgcmVsZWFzZSB0YXJnZXRzIGFuZCBub3QgZm9yIG1lPC9k aXY+DQogICAgICAgICAgICAgICAgICAgIDwvYm9keT48L2h0bWw+ --b1=_JqhJuOCb429hj3Hj6NGTVpMkdhutObLDKPldhUqAts-- From nobody Wed Mar 25 20:38:52 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgzK30kjBz6WlNt; Wed, 25 Mar 2026 20:39:03 +0000 (UTC) (envelope-from vermaden@interia.pl) Received: from smtpo75.interia.pl (smtpo75.interia.pl [217.74.67.75]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgzK25RrYz3qmw; Wed, 25 Mar 2026 20:39:02 +0000 (UTC) (envelope-from vermaden@interia.pl) Authentication-Results: mx1.freebsd.org; none Date: Wed, 25 Mar 2026 21:38:52 +0100 From: vermaden Subject: Re: installing world from src on a pkgbase system To: "Wismos@proton.me" , "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" X-Mailer: interia.pl/pf09 In-Reply-To: References: X-Originating-IP: 45.148.42.24 Message-Id: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=dk; t=1774471134; bh=4oQ2iaAxlxUbmKhE7RFOmFNZEFZOChi7DYYhhiFBAR8=; h=Date:From:Subject:To:Message-Id:MIME-Version:Content-Type; b=L0s9X1kAidl44kRhtx2SrUOcSSXNxH5E7j/9mcDZLjZjh2XyM7UX2sboqD+5omo0L a8X+6qIFGFwZWUvbTKP/5yPPgvkAF1QIiEcH2QLtkP9Cz8M0q0Da20azyXISq1IUnI H7D+G0Pl2VH98guzUXSATqbkMHgWNUts0y1v4xTg= X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16138, ipnet:217.74.64.0/22, country:PL] X-Rspamd-Queue-Id: 4fgzK25RrYz3qmw X-Spamd-Bar: ---- Something like that: # cd /usr/src # make -j $( nproc ) buildworld buildkernel # make packages This gives You PKGBASE packages here: /usr/obj/usr/src/repo/FreeBSD:15:amd64/latest You then create pkg(8) repo there: # pkg repo /usr/obj/usr/src/repo/FreeBSD:15:amd64/latest Creating repository in .: 100% Packing files for repository: 100% Create pkg(8) repo file. # cat /etc/pkg/FreeBSD-base.conf FreeBSD-base: { url: "file:///usr/obj/usr/src/repo/FreeBSD:15:amd64/latest", enabled: yes } Then create new dir (or mount disks there): # mkdir -p /NEW /NEW ... and populate that PKGBASE installation using bsdinstall(8) as follows. # export BSDINSTALL_CHROOT=/NEW # export BSDINSTALL_PKG_REPOS_DIR=/usr/obj/usr/src/repo/FreeBSD:15:amd64/latest # env TERM=xterm bsdinstall pkgbase After its finished - you have FreeBSD installed using PKGBASE inside /NEW dir. The 'env TERM=xterm' part is optional - makes sure you start bsdinstall(8) in colors. Regards, vermaden > Hi there, i have been trying pkgbase for a while but > there is one specific topic that's still not very clear to > me is how do i go around only installing world from > src on a pkgbase system > > make packages requires you to do both buildworld and > buildkernel, it also requires you to setup a local repo > using nginx (as far as i can read from the handbook) > >i tried to do just pkg add * from the > /usr/obj/usr/src/repo/FreeBSD:${ABI}.xxxx/xxxx and > that obviously messed up my system pretty bad > > so i was wondering if there was a way to build > packages of only base without having buildkernel as > well and if there was a way to install those packages > without having to go through setting up a server with > nginx and as far as i am aware package world target > is only for release targets and not for me From nobody Wed Mar 25 20:50:58 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgzb51btpz6Wm5Q for ; Wed, 25 Mar 2026 20:51:13 +0000 (UTC) (envelope-from Wismos@proton.me) Received: from mail-24431.protonmail.ch (mail-24431.protonmail.ch [109.224.244.31]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "protonmail.com", Issuer "R12" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgzb263jQz3r3m for ; Wed, 25 Mar 2026 20:51:05 +0000 (UTC) (envelope-from Wismos@proton.me) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=proton.me; s=3u2q72vj6baapnkjhzelp4h2cq.protonmail; t=1774471862; x=1774731062; bh=dWFZ9bSwJk5h1syeCPFyUlVcQ10w0J3hsACcC9MMkv0=; h=Date:To:From:Cc:Subject:Message-ID:In-Reply-To:References: Feedback-ID:From:To:Cc:Date:Subject:Reply-To:Feedback-ID: Message-ID:BIMI-Selector; b=BWdHJWUWcg87sPmdzewmQEUpNeRXozIys8O8JlKnhTsRWkAnlIdZmTQyjItG90UI5 xMNW9SOPt+WEkkjLNJTPb2g5PXwmf+z34dKjB4D9m2C6ccdDEJcPNQCqbqEdtIr4T0 46tRq56DBFhNy0jpoxZpknuYzbGkzNFYP4vntXN9gwcDyV6qYugLdijRVgPFQM1FGI DzY/nOO9tJOixeGEm9dC8NALu/e1NL8xcGqhGHFOPl2g81UJ0asKEHRHnhcptSySEK uRuLBxvmoZNbGrPDllPuXj9m5EA48wGu6OHoPCVZ/8tDzQKaQlVA6H4Ih5Spgq6mVO +HS8aWs6bMHDA== Date: Wed, 25 Mar 2026 20:50:58 +0000 To: vermaden From: Wismos@proton.me Cc: "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" Subject: Re: installing world from src on a pkgbase system Message-ID: In-Reply-To: References: Feedback-ID: 51325846:user:proton X-Pm-Message-ID: 769bfdd83f461870903ef8443059f8e4e4a2c94e List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:62371, ipnet:109.224.244.0/24, country:CH] X-Rspamd-Queue-Id: 4fgzb263jQz3r3m X-Spamd-Bar: ---- hi, i asked for a method that allows me to install pkgbase world packages w= ithout having to buildkernel and make buildkernel and make packages means b= uilding kernel, i am not looking for some sort of hack as well Thank you -------- Original Message -------- On Thursday, 03/26/26 at 02:09 vermaden wrote: Something like that: # cd /usr/src # make -j $( nproc ) buildworld buildkernel # make packages This gives You PKGBASE packages here: /usr/obj/usr/src/repo/FreeBSD:15:amd64/latest You then create pkg(8) repo there: # pkg repo /usr/obj/usr/src/repo/FreeBSD:15:amd64/latest Creating repository in .: 100% Packing files for repository: 100% Create pkg(8) repo file. # cat /etc/pkg/FreeBSD-base.conf FreeBSD-base: { url: "file:///usr/obj/usr/src/repo/FreeBSD:15:amd64/latest", enabled: yes } Then create new dir (or mount disks there): # mkdir -p /NEW /NEW ... and populate that PKGBASE installation using bsdinstall(8) as follows. # export BSDINSTALL_CHROOT=3D/NEW # export BSDINSTALL_PKG_REPOS_DIR=3D/usr/obj/usr/src/repo/FreeBSD:15:amd6= 4/latest # env TERM=3Dxterm bsdinstall pkgbase After its finished - you have FreeBSD installed using PKGBASE inside /NEW d= ir. The 'env TERM=3Dxterm' part is optional - makes sure you start bsdinstall(8= ) in colors. Regards, vermaden > Hi there, i have been trying pkgbase for a while but > there is one specific topic that's still not very clear to > me is how do i go around only installing world from > src on a pkgbase system > > make packages requires you to do both buildworld and > buildkernel, it also requires you to setup a local repo > using nginx (as far as i can read from the handbook) > >i tried to do just pkg add * from the > /usr/obj/usr/src/repo/FreeBSD:${ABI}.xxxx/xxxx and > that obviously messed up my system pretty bad > > so i was wondering if there was a way to build > packages of only base without having buildkernel as > well and if there was a way to install those packages > without having to go through setting up a server with > nginx and as far as i am aware package world target > is only for release targets and not for me From nobody Wed Mar 25 20:55:53 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fgzhg5P7Vz6WmMg; Wed, 25 Mar 2026 20:56:03 +0000 (UTC) (envelope-from vermaden@interia.pl) Received: from smtpo49.interia.pl (smtpo49.interia.pl [217.74.67.49]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fgzhg2bbtz3sZk; Wed, 25 Mar 2026 20:56:03 +0000 (UTC) (envelope-from vermaden@interia.pl) Authentication-Results: mx1.freebsd.org; none Date: Wed, 25 Mar 2026 21:55:53 +0100 From: vermaden Subject: Re: installing world from src on a pkgbase system To: "Wismos@proton.me" Cc: "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" X-Mailer: interia.pl/pf09 In-Reply-To: References: X-Originating-IP: 45.148.42.24 Message-Id: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=dk; t=1774472156; bh=sgFhHP6AkpqSVH41l48j8nNbiaHCqD9EGTA+HmB2X+Y=; h=Date:From:Subject:To:Message-Id:MIME-Version:Content-Type; b=PE6JCUxdzxXXt7LjHfPLyOhDIRcOqntVKl95GMiynEOy9PE5FNZR4ugOPIx9dwli0 rk0iFb3C/jMgcjdu5HpoPvBWTBijzJkfVuYNK7lsKJ4rUGr/NdtD9MSMGvTLp0EsIb TmhFwoJL9CBfp33EmMAZup52++EpoJMElkBbhvr8= X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16138, ipnet:217.74.64.0/22, country:PL] X-Rspamd-Queue-Id: 4fgzhg2bbtz3sZk X-Spamd-Bar: ---- Sure - just just '/usr/freebsd-packages/offline' from disc1.iso instead. There are ready to install PKGBASE packages. Temat: Re: installing world from src on a pkgbase system Data: 2026-03-25 21:51 Nadawca: Wismos@proton.me Adresat: "vermaden" <vermaden@interia.pl>; DW: "freebsd-pkgbase@freebsd.org" <freebsd-pkgbase@freebsd.org>; "freebsd-questions@freebsd.org" <freebsd-questions@freebsd.org>; > hi, i asked for a method that allows me to install > pkgbase world packages without having to > buildkernel and make buildkernel and make > packages means building kernel, i am not > looking for some sort of hack as well > > Thank you From nobody Wed Mar 25 21:15:30 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh07M67zgz6Wnk1; Wed, 25 Mar 2026 21:15:43 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh07M5Nhcz3twJ; Wed, 25 Mar 2026 21:15:43 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774473343; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=PoFrGxyKOw8KrBdt6e2JxrF2W7mvh6XfpfYI9q36gQ8=; b=B+peW0ifJG+G43VcPWaTcTcTmdJ2Vn5FtISNCrmsqF9tma/2w0MqEhCK0j6IKo6HcC2XeO 5c9CQBhd0zdwKcPq3ff8A4NitlupFe49hXR4aUMrdFmw6CufYdn6tkMX6k/vTVPP2pbfMd fw5kmTatIUhEwlB+U1TCiSLxdWrVaw4OPB66z+oGBSJhOiw5ymKPedWwbcnz70qJXm+IQA fpI6tQlohA/rRUASYqGr7/8b5XZLRi5f5V5rP5k+yiE7NKH/R2G3r8IjqI6ZwrSaVkmtck h6vhbK7dg3ILJv5S5uzapyU2Jj2uY1IWYiVq814B3cEk4gBdXLB9I6VAebpLAg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774473343; a=rsa-sha256; cv=none; b=gsic86Z9A4C2tAnKVIcFVEZSFMRPf0qwUjzgGgLKRY1E2aykm4yKZl1wIEvCUu0hguTJlS nKZAIv5z6iKCGFkX9Q31UTRe2WhjfYSj72SYVqi1bIY/i/lQMVTlLJpHQlbftlSh3nZplt mOWOGvGX4EG2GA5NUDg+xyJMN3ajdkzqCakVrZqCMwZBLAW2Xx+W/asdu75+E1kN9eKTUr MSBI/QpgxSADBKIhz3D/15P8KZQNpUJgwo30rwnemOu0rkuFtEiU4LH/QGi+xI0nq5E8Mf VRSFxh4RXpZsDjhj77GHbCb9/hXgAYuxMAwAZliCUr8rENSfRREjJNgAsdTkeA== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774473343; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=PoFrGxyKOw8KrBdt6e2JxrF2W7mvh6XfpfYI9q36gQ8=; b=GSuvT2LlRj9GdDuyJMBth1TEZ8ez8sHKzFkG9wqsJHQ5otJr9wbuMTJ7bIF2vFNR1GZgVu EuanJIpzJ/Nl0586bQlv4CwfobKo9gBAIs/FukhB0X7fYASGMcOG8kdg4pFIDx1ZHgc5Ak f0yeYO1Q07iAM4s76TWY9gLkfdThYid4XpN+wBRPAKh6XK+24lcSKpPlYLsZfmJj8OXFhV v4dCW40dEFmEdVo/AlRfZFmHlAA6CR7WbQJyHbSzCpD5h1UTd4owGgYT2Z9SxvY5Ig9XOf 4HJ8PmG2vncAdbA1BKUvzOWZSG+fls2LMjTV4yiCQj/kqp/BwQrJ6ikV3bSYNw== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fh07M2Rxpzyhv; Wed, 25 Mar 2026 21:15:43 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 21:15:30 +0000 From: Lexi Winter To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Subject: Re: installing world from src on a pkgbase system Message-ID: Mail-Followup-To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org References: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="feR3mgzwvxTXB0Ws" Content-Disposition: inline In-Reply-To: --feR3mgzwvxTXB0Ws Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable Wismos@proton.me wrote in : > i have been trying pkgbase for a while but there is one specific topic > that's still not very clear to me is how do i go around only > inatalling world from src on a pkgbase system you build the system from source, then you build a package repository, then you install packages from the repository. assuming your src is in /usr/src: % cd /usr/src % make buildworld buildkernel update-packages this builds a package repository in ${REPODIR}, which is by default, i think, /usr/obj/repo. =20 to upgrade from this repository, you need a suitable pkg(8) repository configuration, such as: base { url: "file:///usr/obj/repo/${ABI}/latest", enabled: yes } i haven't tested this recently, so the paths there might not be entirely correct. you will need to disable the 'FreeBSD-base' repository that bsdinstall creates; the easiest way to do this is to simply rm /usr/local/etc/pkg/repos/FreeBSD-base.conf. you should then be able to do 'pkg upgrade' to upgrade from the packages you built. > make packages requires you to do both buildworld and buildkernel, you should use 'make update-packages', not 'make packages'. but yes, either of those targets require you to build the world first, because that's what creates the binaries in the packages. > it also requires you to setup a local repo using nginx(as far as i can > read from the handbook) no, it doesn't. if the handbook says that, it's wrong; unfortunately the documentation for pkgbase is fairly poor right now. but as you can see from what i said above, it's possible to do this using only local files, you do not need a web server. >i tried to do just pkg add * from the >/usr/obj/usr/src/repo/FreeBSD:${ABI}.xxxx/xxxx and that obviously >messed up my system pretty bad that's wrong and you shouldn't do that. > so i was wondering if there was a way to build packages of only base > without having buildkernel as well currently, you have to build both world and kernel to create a package repository. > and if there was a way to install those packages without having to go > through setting up a server with nginx you do not need to set up nginx for this. > and as far as i am aware packageworld target is only for release > targets and not for me "make packageworld" is nothing to do with pkgbase, despite the name; it's related to some other, not relevant distribution methods. --feR3mgzwvxTXB0Ws Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacRQawAKCRD1nT63mIK/ YHa/AQCzT2Pq0Hks55TV50qgfTgbsxDIVzsCveX+bs2ogCq0nQEAvuA/MyRQ/kx+ BKi909ww+mtR+CbpT7F/QtdnZxD5Rws= =HC5Q -----END PGP SIGNATURE----- --feR3mgzwvxTXB0Ws-- From nobody Wed Mar 25 21:20:30 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh0Dy60fnz6Wnvk; Wed, 25 Mar 2026 21:20:34 +0000 (UTC) (envelope-from vermaden@interia.pl) Received: from smtpo49.interia.pl (smtpo49.interia.pl [217.74.67.49]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh0Dy4r4lz3wfQ; Wed, 25 Mar 2026 21:20:34 +0000 (UTC) (envelope-from vermaden@interia.pl) Authentication-Results: mx1.freebsd.org; none Date: Wed, 25 Mar 2026 22:20:30 +0100 From: vermaden Subject: Re: installing world from src on a pkgbase system To: Lexi Winter , "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" X-Mailer: interia.pl/pf09 In-Reply-To: References: X-Originating-IP: 45.148.42.24 Message-Id: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=dk; t=1774473633; bh=bN+0sLiNdgyz/EaT4tLSeF6gFqhPEuAdvMaW2EddlkI=; h=Date:From:Subject:To:Message-Id:MIME-Version:Content-Type; b=jx3uo7fQPR6Bprmped+mnUc5DCdKNBit+GFIrD3SYwOCL4m+nuUpFAt0/uMcNBjdW 3bVXkwB35GnjAT/5AUk7jjh0uH5vc4k4m9S85Ln8HK7AeqSDyuR12b727uO2dbUFd3 VTIkUtND26LlHbPZs7Y4pRxa5XH2Tmg0CfgQ68BA= X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16138, ipnet:217.74.64.0/22, country:PL] X-Rspamd-Queue-Id: 4fh0Dy4r4lz3wfQ X-Spamd-Bar: ---- > you should use 'make update-packages', not 'make packages' I was told the same thing - but got hit by that 'recommendation'. I mean - after these: # make buildworld buildkernel When I type: # make update-packages It sometimes fails with some strange error. But it does not throw that error when I type: # make packages So now I keep to the routine that goes like: - first time? # make packages - 2nd and later times? # make update-packages Regards, vermaden From nobody Wed Mar 25 21:24:01 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh0K91tmLz6WpHC; Wed, 25 Mar 2026 21:24:13 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh0K91MgWz3xJx; Wed, 25 Mar 2026 21:24:13 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774473853; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=VEXSAkTVLkfjH8hHkI14hRYXI9O1ixrQxbxdSEcQgB4=; b=FE64ru2MBq+lGvSPOwip6tcnSnUjJBTn4vZGkJWrqjA5FpEIiZ2Q3Sv+/ua8RBjwpVwCV/ vVjKEv2oWIUisfleBROUlX4B4oKCCNh4QOI+gQCGgxa7Y80TQOFkU+bKTOFIh6lnJZBPEV KAIBEGoIYby7cUcXyg4HWccHz59wPkgN2r1hw/qOy3ynIK1bzososaUgYGNzlSfdQ2I3Q+ k0MdduRPrrc/vWk7bYi461ITlZVXmg4Odh3lQK9QjH35/BHsn2k9cqCCqZMoyNaIiMFyuR BU3rD8KpgWpaT/K7t4KLx9dEhnK4BF3W5GqipdyKpkQhdKMpU2JANbHQZ3tZ8Q== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774473853; a=rsa-sha256; cv=none; b=axvl1V5d9ud9kQ6MiGg9bhpOJz8yjFb+g9CQQjG9kQoed5WDvq/PfGkVZ1FkJawmlsLkSj DYnIumvtv5TYECXr9dwZINxrvoADr31J1GDs1oCJswBIxmhDT+ncbn8t8t9uSQoqcG6G06 pVYXaCaMxMebA99AUhQqSjWXbxtn12+AiTubHsTieSPZDZOAnnRanP2vvoKUFi9msa4Etf Mlc87AIs28/V/CgWM/Hu0hFocxp4a0jUk8yfVvKhBXgtxggCcwkFmZ61KSM/7zSdEfEl/W pN3Hzkwwqp/88q6lsx6tUPfaO8SsOoSl99dq6riADDQf1Qbu7tj/PlSPNjZgEQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774473853; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=VEXSAkTVLkfjH8hHkI14hRYXI9O1ixrQxbxdSEcQgB4=; b=YatIzs2YSN2QCfjoWe71GTb8dzicLVEd0+0K03Dz2At523lQCfUGwd6nDI1WBxIuPuw8Er oIZBuDZczDR2T0/0jUpoR/79FwC6gKVRDB41baHjDa8uRPQQLVJcYLbZrYuo5nSzHlLHj6 csiDok9jQHn0kP/beIj/D+iZl8vl1/0geyNzzKM7HR0R4xXg91XNFdCK3kbUN4U5IDT6ZE HfaaJ3JEHTxbMo4UTsgOo8U/hxkunBAHoW2gvKLBqkxeNC1KJooBI4+DqYstS4MtlZ3ONl 9k5BlWrg0R3BG459nJ64EIYPofc9fJpi4k23sDzNkGjrIqIGPX2cmX78tf9y9A== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fh0K85NMhz12Qk; Wed, 25 Mar 2026 21:24:12 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 21:24:01 +0000 From: Lexi Winter To: "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" Subject: Re: installing world from src on a pkgbase system Message-ID: Mail-Followup-To: "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" References: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="2BkpGAuZ21oTYu3d" Content-Disposition: inline In-Reply-To: --2BkpGAuZ21oTYu3d Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable vermaden wrote in : > > you should use 'make update-packages', not 'make packages' >=20 > I was told the same thing - but got hit by that 'recommendation'. >=20 > I mean - after these: >=20 > # make buildworld buildkernel >=20 > When I type: >=20 > # make update-packages >=20 > It sometimes fails with some strange error. =20 are you going to tell us the error or do we have to guess? --2BkpGAuZ21oTYu3d Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacRScQAKCRD1nT63mIK/ YAklAP9lva5jEpm8303eUH8zRe7iz+bxVmxLHdayecXLxK2ijQEA7EtRJksSCsHd 4Qz2Ah9CuOU2Hfxa4bLpi0MtlfFqbgI= =qSJE -----END PGP SIGNATURE----- --2BkpGAuZ21oTYu3d-- From nobody Wed Mar 25 21:38:52 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh0fH6QxTz6WpRp; Wed, 25 Mar 2026 21:39:03 +0000 (UTC) (envelope-from vermaden@interia.pl) Received: from smtpo63.interia.pl (smtpo63.interia.pl [217.74.67.63]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh0fH3y2fz41G3; Wed, 25 Mar 2026 21:39:03 +0000 (UTC) (envelope-from vermaden@interia.pl) Authentication-Results: mx1.freebsd.org; none Date: Wed, 25 Mar 2026 22:38:52 +0100 From: vermaden Subject: Re: installing world from src on a pkgbase system To: Lexi Winter , "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" X-Mailer: interia.pl/pf09 In-Reply-To: References: X-Originating-IP: 45.148.42.24 Message-Id: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=dk; t=1774474734; bh=p5sNQNvrQaurrODDfUi1Rkv/q5Z1oSEW0KVPbIA9Nj0=; h=Date:From:Subject:To:Message-Id:MIME-Version:Content-Type; b=ZtyM/UjdFEJ6xoFL+UkfTCsj92pPGGAIyzgzEavmEYZADAJJmSjJSMqBB0M4ndKR7 62gXoktYTuFmoUp2Vq9R5rdGvsfWQMIcQNcOLAax8ujJR7DOr0/y8yGrdewaqpeqQO nuvZccwZxTP7jWX69Q3Uz86LaToNkL9/y4pBLuhA= X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16138, ipnet:217.74.64.0/22, country:PL] X-Rspamd-Queue-Id: 4fh0fH3y2fz41G3 X-Spamd-Bar: ---- > are you going to tell us the error or do we have to guess? Guess please :) It was reported to me by my buddy ... and it seems he forgot the 'buildworld' part: # cd /usr/src # make buildkernel KERNCONF='GENERIC FIREWALL' update-packages --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-optional-jail-dbg.ucl --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-optional-jail.ucl --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-optional.ucl --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-tests.ucl ==> Checking for new packages (comparing 15.0p4 to 15.0p4) ==> Keeping old FreeBSD-acct-15.0p4.pkg cp: /usr/obj/usr/src/repo/FreeBSD:15:amd64/15.0p4/FreeBSD-acct-15.0p4.pkg: No such file or directory *** Error code 1 Stop. make[3]: stopped making "real-update-packages" in /usr/src *** Error code 1 Stop. make[2]: stopped making "real-update-packages" in /usr/src *** Error code 1 Stop. make[1]: stopped making "update-packages" in /usr/src *** Error code 1 Stop. make: stopped making "buildkernel update-packages" in /usr/src From nobody Wed Mar 25 21:40:21 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh0gy1mGQz6WpqC; Wed, 25 Mar 2026 21:40:30 +0000 (UTC) (envelope-from polyduekes@proton.me) Received: from mail-43166.protonmail.ch (mail-43166.protonmail.ch [185.70.43.166]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "protonmail.com", Issuer "R12" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh0gx6087z417w; Wed, 25 Mar 2026 21:40:29 +0000 (UTC) (envelope-from polyduekes@proton.me) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=proton.me; s=protonmail; t=1774474827; x=1774734027; bh=Wi63vGlbP8nMsASyacUoKv9AnxQtmpO7uyQ47SjXLYM=; h=Date:To:From:Cc:Subject:Message-ID:In-Reply-To:References: Feedback-ID:From:To:Cc:Date:Subject:Reply-To:Feedback-ID: Message-ID:BIMI-Selector; b=WSllYb+irKl7XWjNw6PJUj5lfSrV6a2nzyh30RXDxqZR1UOM81ltFck+p7BB3A/6z htshjOOmqVw6uLcCHrOPujaUYppnSbmZeJz+C5pDKg49B3DsPi0I8DTZ4s7jdu5xGU dbUy1Zu2JP/MOM/3HxTZYaY8ZKic3aDY8qmP9cyQezeWRloG/0w5ViygH9SFtgFhRD aOkNg1cHAFggP3LCicPVW3dHb35wL6hTw4GXZ2EK7VbbfSbVq7bCUX6XMjXvteMqh7 O5i9KTjT9n/kIeWDv5iExBMqP7b4ymDHtksHlsUxf8EE7fX6wMrgKQ7MYhL4nSBVVr thW39QGH5REAA== Date: Wed, 25 Mar 2026 21:40:21 +0000 To: Lexi Winter From: polyduekes@proton.me Cc: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Subject: Re: installing world from src on a pkgbase system Message-ID: In-Reply-To: References: Feedback-ID: 94987605:user:proton X-Pm-Message-ID: ee2f9e4a28f69da0576dc6b17a7ee8bc3ff4fb73 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:62371, ipnet:185.70.43.0/24, country:CH] X-Rspamd-Queue-Id: 4fh0gx6087z417w X-Spamd-Bar: ---- hi there, thanks for the response is needing to do both buildworld and buildkernel to create a pkg repo the i= ntended behaviour or is that planned to change additionally may i ask why it's recommended to do 'make upodate-packages' o= ver 'make packages' Thank You -------- Original Message -------- On Thursday, 03/26/26 at 02:45 Lexi Winter wrote: Wismos@proton.me wrote in : > i have been trying pkgbase for a while but there is one specific topic > that's still not very clear to me is how do i go around only > inatalling world from src on a pkgbase system you build the system from source, then you build a package repository, then you install packages from the repository. assuming your src is in /usr/src: % cd /usr/src % make buildworld buildkernel update-packages this builds a package repository in ${REPODIR}, which is by default, i think, /usr/obj/repo. to upgrade from this repository, you need a suitable pkg(8) repository configuration, such as: =09base { =09=09url: "file:///usr/obj/repo/${ABI}/latest", =09 enabled: yes =09} i haven't tested this recently, so the paths there might not be entirely correct. you will need to disable the 'FreeBSD-base' repository that bsdinstall creates; the easiest way to do this is to simply rm /usr/local/etc/pkg/repos/FreeBSD-base.conf. you should then be able to do 'pkg upgrade' to upgrade from the packages you built. > make packages requires you to do both buildworld and buildkernel, you should use 'make update-packages', not 'make packages'. but yes, either of those targets require you to build the world first, because that's what creates the binaries in the packages. > it also requires you to setup a local repo using nginx(as far as i can > read from the handbook) no, it doesn't. if the handbook says that, it's wrong; unfortunately the documentation for pkgbase is fairly poor right now. but as you can see from what i said above, it's possible to do this using only local files, you do not need a web server. >i tried to do just pkg add * from the >/usr/obj/usr/src/repo/FreeBSD:${ABI}.xxxx/xxxx and that obviously >messed up my system pretty bad that's wrong and you shouldn't do that. > so i was wondering if there was a way to build packages of only base > without having buildkernel as well currently, you have to build both world and kernel to create a package repository. > and if there was a way to install those packages without having to go > through setting up a server with nginx you do not need to set up nginx for this. > and as far as i am aware packageworld target is only for release > targets and not for me "make packageworld" is nothing to do with pkgbase, despite the name; it's related to some other, not relevant distribution methods. From nobody Wed Mar 25 21:55:54 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh11y4PvKz6WqlS; Wed, 25 Mar 2026 21:56:06 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [96.47.72.83]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh11y2CyQz43md; Wed, 25 Mar 2026 21:56:06 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774475766; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=42KJCLDWDZEBUdys+gp2s/95+dB3mUA7C8c5+vfoH6I=; b=xmqS8KKHVTq0rChdyhZnhnQ+6BwUmumv9vfsRzb1NGgqXfjsvI5C2p7A0fRgM3yaLqj8tV VjBZiJAS+nUCBw8Qwec0FGhUFsVwmBfft5Bx/Dz/Y7MH2InqCrnmMRPB1CucTD0ct9J/0z 8LywPdhoRSlPh0Ykd41ivIB8PTtn1EilMO5jDV4Li9Hky1qeubtOtlEnjhJKOgvUvOx6Ci mmTmyvz6wbZgD+VY9eYwnmY7S9hkgeSeOoOsXVL10XF97wRz888IdDPtfrWG//bpNq+KMB bDWnfpYrtYjW2HbcpyXzf5qemeIeSGzJrtcWz0i0ZrzPO/EBd53l37jR6s155w== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774475766; a=rsa-sha256; cv=none; b=tFrRiEbuSuHchMwoV9D1Jdo98nuX4q7+8+qIcGC3XaA4PY24LoplpT0ToGOhvME/Mnx1RT om42FkpMqaLx7cfhYy1sMAGhEiX4PHqmXLvmmhfDudvSSNEOqw/GNU979IcnXO219mLTOo NcgaZKiuF5UpDIRHXTAWIi/TEdCed3/OvZAh06CVrQ6/L4SwTRT4Lg/DFqvbgj0R0nV9f2 rSyG3UVoItmXdwGVYmDiyKd6HNIc+KrXETwcyMlrtCF5PeJQS/AGDNQvxSnifuSuyFPVIS +/SwgqfQA7IU1PWtKYyJZSPAYl7defGCtXAgrqCSznRXVMO4K00ntZCJWRUcHQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774475766; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=42KJCLDWDZEBUdys+gp2s/95+dB3mUA7C8c5+vfoH6I=; b=FFQhifWXYg7QldYz3Vt2EA4ezOAfwumv77xBfpovXW1mMx/Wgjcb7QD5ehGWm+MP/kuwAb Gfwbw1CL33dou/s8uqw7Y4daHBv6EqLQlvdmoCD6HnzMFFZkdveMEbxroNTO7sLk71oqUr TlXxJZzJIBY3wivH7EOaixmgOGAgKbflnRD4wZ5Mhtsp6Yu7XYTqxP6FEMTnL3TYwAlQSW Ocv+MYsI/8JQetYocUh7/p2kdIu/7Bzy4iekB68zmnzfARuI7jrbPOLVNwDc1cpNQAOurm lfh2Bijzg2r54KIrxKMsrTAhNYe13Hij2NTtwQGHjhYkq01ruwj9wS4GAVcrCA== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fh11x5rFPz12nk; Wed, 25 Mar 2026 21:56:05 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 21:55:54 +0000 From: Lexi Winter To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Subject: Re: installing world from src on a pkgbase system Message-ID: Mail-Followup-To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org References: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="aWp+96hxF07tJmUk" Content-Disposition: inline In-Reply-To: --aWp+96hxF07tJmUk Content-Type: text/plain; charset=us-ascii Content-Disposition: inline polyduekes@proton.me wrote in : > is needing to do both buildworld and buildkernel to create a pkg repo > the intended behaviour or is that planned to change right now i don't believe there are any plans to change that. i suppose it might change in the future. usually people want to build both the world and the kernel, so this isn't an oft-requested feature. could you elaborate on why you want to build world but not kernel? this would help inform development efforts in that area. > additionally may i ask why it's recommended to do 'make > upodate-packages' over 'make packages' 'update-packages' will copy unchanged packages from the previous build to the current build, which means if only a small number of packages have changed, the system won't try to update every package. --aWp+96hxF07tJmUk Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacRZ5wAKCRD1nT63mIK/ YGgGAQCsOXXU0Ba2DHERAzeb2FI8H0fxB3jYkYvY7G6WUxT3vQD+LPZLb4AHuUyo qsjJXvS61h0jcA8oAk7lNCIPF8whsgw= =EOBe -----END PGP SIGNATURE----- --aWp+96hxF07tJmUk-- From nobody Wed Mar 25 22:10:20 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh1LX6sCSz6WrNP for ; Wed, 25 Mar 2026 22:10:28 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic308-55.consmr.mail.gq1.yahoo.com (sonic308-55.consmr.mail.gq1.yahoo.com [98.137.68.31]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh1LX22zWz46KX for ; Wed, 25 Mar 2026 22:10:28 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774476622; bh=ts6ZU5OdKx3Um3kaR3FFDrFB+VkFJ5ry7PJafA59hcU=; h=Date:Subject:To:References:From:In-Reply-To:From:Subject:Reply-To; b=FZ7Y7VLgNrLa9tzSll1u4bCR25D0s2YYJmtRyRHjxSSsQZTWsgqUF3RmX8k/Q1lC5I8HPHtdCMWHmuVKCCUoV9zlZllw0KwxEaQmgsnebdr/O66JBLqkgYrRxENTO2qByJKJuCfeTanmp5tQmPLuKfYLqhFSju8+Fw6rZ7RHk2c7GvSLbTsp9pPrrZw86imvI0ceK0xOCyCuBLefK7Wpe6/IF1CRrodDOV/CXeZ7E1DuFz1ADks2AlTtg5ksVaptD9gaYTjaqy0Rt1XRMlgrwuUMBwJeAfp0YSsKEoUvwfDNIbHQz26vweeD4i2YxRVgixFeLg49GOp6NlXeNqE4BQ== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774476622; bh=03i30b1JK4hkDBFRpECN8g1b9BV3WqKhUvFeHdNfQWw=; h=X-Sonic-MF:Date:Subject:To:From:From:Subject; b=eTKqSfH14HB091/up7rCJvO3u4BcI5SY3RwZLxDjkB8XQ1uEkFcl1Jg3TrPKi/obPRavECYFGOxZjfZHKbfE879fgP3muS7HuCLthhum/nd5CLt0DyUHwGyK5U8CJLMQqK7xZKzR6TfKCGetrrk6f+B+ofWYB8brdPz4nhVPf3ZkbGkgRe6TEJH2AGZx8IIhIcb4QL8CCOXmZ0NL+sJ5md+lRTA4M3/CCzdTobpVACgZjCyqzTw5UUYOtzrTHcf3obvHc0QmPGGqDiJZmJZK6FYt5nFIa6q0gU5kH/6VUXXPcvHg+vjgSaafP63vzGnWBAIfM5iN1IQaFBcAcJjrDg== X-YMail-OSG: OdgEduYVM1mYg3XveYCcswmEC3ri16lCxCMmjV7WN8X7VDrdx_kc9QhYERDnN8Q ryjWTUenZaKXo1xL.dVMYHXlLk6Eaczp_6dGC.cB_iBwWqt73fKalKzGTD0DYaf9VnPVjFWYo9ne D1fZ7DdFFOPfSHWJbp0DNcgeCN4cDOnlWYCWPj7AuX48ENEAesZNR6omzZF1DDyrf6xFcvBlEsIC bHfZR3O8Oi8p28BpJRQfsB.MTO1dJsv7MoW_7cdcoxTb3MRyjFGwcZ1NMEfJLCN69xn54GQdzlbY JdegAGLtu8cVAevanw6qdCKAnlMty_4jM41y4RToEF6CaPEwnCmxNBszBozXGVqaO1o74ju6Gi00 y3htKWbqePjmx5JfTWH5jvPdu5i.ERuG2wU2BgPednr9.gt6byQxuZV2FDbUlBYQYBvdf.IfQxkM 2OR.7ldcGDSCGP474391TBhFGM6pls0NHKo5qNwwabxcOmEwHku9p8pZsekRJihAYe.tRO6tG0u_ WQlGyYlAWhVq.4IEqpibkC0ZgxYxxndw.Vm4yaMHi6TQGm2OaMzEq_jiahDa.TmGoeWk9G9kge5n _SBxfHKPMnrBZkL7vj66FJ7KLwKBgrvC4Vc4XVq6g9FQD7cPbfwEKdZVT34c_eTHsGvWw8mkAawP ma0M4K0Q_kOBXbh.q0s0_F4S0NHvS1TSa5WvTyli7sdR9K3Taf1sIlHm.nIv4zqr7RTFOobK.3e_ SdDeaJ8UCPr0ZuJAoXH64nd84tcuw38GnIZsHTQ47OCs0l_vR6COMWSAMBLvfR5YGOyqCnfYV6_E oYASTOTBKQEQRif_Z_XLFQFc0xGefdcqMHFgC7suTFd9wpW3puJYqDSMPb3AKJXX4qK9gSPYG96V hYO_47BpXkyspx3O5TEe9Rn.ClbdlsTH2fOLmqXe867rv1j8MiSASzg0tT3VMZzeYClGQzGraIvx U4quqrNQJrCDPeYHUj1L0KF6xs6Epi4i4SM8Az1EvPlTEZy.u8FhoRqqt2edc0BWb8rabUWPKH8n KTL5zLWbDNt2ilpQHqq47YzbtmKtIIFKmBYXOZZF5wrzLZs0AOpizVomYzCV3S_4ANQtH3yrcigz aik34TrsO27B3pBwYSXgA5QHlQly0nyNoQZC8TqHlum7ds.iphKTO5kSzmUK4DedQzb9QDiY9p_j C_YCTMXVBsTYAp_gqSQ9EwdNhfNC0VXut5qPEF89fRzrw6kvi1cSwsqelACPGag6PeUz8bYAsKFF BiLAHnrVNZwTyfbMfK0zwSkOGdDLeYCyPOl6izLYbI_SyyxJbtOWTYyF93DQQ8TinfSbHjyVI7h4 1Rex.TbuaghIvNrCEdQZKBiPXuIKPcm.SuKTi4Yz5Qx_ALjymvHJfWEzcJiNK_B.7NeNG1l_6JzC JGtHgNDcea7xPB9ccfhPqBVMPWKisi7JSGmwpvZAjuDXnD.6msM4tIQTr8yUXVHllyYqBPXVS8hK NzrCiz2GTRgCYFmYTIIINT0.EnjUTQdfcJ7ijbpwrWDJE5_vZNu_Cp8aLlVRDZg7eXyolRsiouIO rjqE6HQPxgF_cNH9Mkujv4Iv4DupH0H5Zp4_LUIfNyQ12KJfPMLUntjHnkIG9.vtrnzDAfWzstdg 4uI26I8WIk9eEc.DIvN3D7lQxPUtthiDJsFc1jOp_eBPGTsaPfDW.KvF3MyBf9UZ1Fpvr.3L.UNP THTmNWNhEfr4cp2T0KJqY3.R1Pud8Ql.ROCLNRNIjgwHjCds02xpxXYqeNBzRa6ulHTppk_kXsdz C3DOIOVZabhg3GcxkGjFeIW0XjVUMhJ2LDPSFBQk59M65epnUtKL9lNjB676NqcRhVnbLjC4XIhN ph7k7LC8DKZvKsitK.Z1tizTJrFOLY2Y4psNQGDnjPS6OZhX18pnrdUAa7NAP4RHITPPTBRRt9_Y JEC2jxNZxfYJHDI2WTrAgQ5cz4kQJhbEZr55AqGA.yyyMkKRrCuSEeLngUsJUS5jeM2F9VEZqydh tvGMjzNeDKe79YfTZqqtc6P3vBklb7kaYuElP05Z82d18Yl_l61Qa3itlED4ZfAU2M_F2V78LXxa NCwDoWvawjnPxEp0NiLL1092BmAthcC8IQcHB1qTog8VBGt1.VCT_ebmKOOrDY5hq1mlaeaUA188 fE_H.FiA0m0Iqt26.QLEBm_Nw6VHZueD6NHJRMaXS4k5agOyAj5GU0.gWjWLFDnbYdTGF9TlR2QY w9jUheCOumv76rGucXRhcOBieCG41v6ggB5aYaZRg0IcfaPaWiN1NQ1hvIJ8nK2GU0Ah1aFJF7T9 uBizusD1bPYc0E4NHScbVgW6EqNrulIAkkVS.KWSWeMOU X-Sonic-MF: X-Sonic-ID: 0e7bd3c5-f6cb-4e74-8e2b-db05145773ba Received: from sonic.gate.mail.ne1.yahoo.com by sonic308.consmr.mail.gq1.yahoo.com with HTTP; Wed, 25 Mar 2026 22:10:22 +0000 Received: by hermes--production-gq1-6dfcf9f8b-bpss8 (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 57b127eebee86fc6af8ac57ca4bb497d; Wed, 25 Mar 2026 22:10:21 +0000 (UTC) Message-ID: Date: Wed, 25 Mar 2026 15:10:20 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: installing world from src on a pkgbase system To: Wismos@proton.me, freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org References: Content-Language: en-US From: Mark Millard In-Reply-To: Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.25449 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Queue-Id: 4fh1LX22zWz46KX X-Spamd-Bar: ---- On 3/25/26 12:43, Wismos@proton.me wrote: > Hi there, i have been trying pkgbase for a while but there is one > specific topic that's still not very clear to me is how do i go around > only inatalling world from src on a pkgbase system > > make packages requires you to do both buildworld and buildkernel,it also > requires you to setup a local repo using nginx(as far as i can read from > the handbook) i tried to do just pkg add * from the /usr/obj/usr/src/ > repo/FreeBSD:${ABI}.xxxx/xxxx and that obviously messed up my system > pretty bad > > so i was wondering if there was a way to build packages of only base > without having buildkernel as well and if there was a way to install > those packages without having to go through setting up a server with > nginx and as far as i am aware packageworld target is only for release > targets and not for me I can not answer the overall question but I do have some notes that could be involved overall . . . As I understand, buildworld depends on and uses some kernel source code that is under, for example, /usr/src/sys/ even if no buildkernel is done. If you are building and using other kernels with variant source code that might not be compatible with the /usr/src/ tree and /usr/src/sys/ contained in it for the buildworld activity, the parts used by buildworld instead need to be available for the buildworld activity. You did not provide any notes for me to know if the above would be an issue for you or not. If not, sorry for the noise. -- === Mark Millard marklmi at yahoo.com From nobody Wed Mar 25 22:41:30 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh22c091Nz6WtMy; Wed, 25 Mar 2026 22:41:44 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh22b6ntPz49SP; Wed, 25 Mar 2026 22:41:43 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774478504; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=FTKbX/XhlZ0GbT2cXaFCNsFhzbC2acFmnLZimotdasg=; b=T7k6QKcNevMiRP62aMpYEso1nWDDhn2c3FzYDeN6mBodxFZAwNbzipVMwB3tVxAY/xWlQr QPAqUBuhn8Z9GlTEK6w4yl5AvMcXtImXawvp8AuPOXDkA5OuDMyDxS2n2dUfF63AF/Akhx IOdkZnMdPwct2vRbh37FqGvLKuY4o/nSSELiMfHytfRQrZv9xpuyYQtAgyR3pyVCEhtUOo b5DXrSi0FPbrbUT6yDPGDBBZN3WBlnvsvw3Ygin8aV41Pf7DpSPHqttx83oOv0htEfakdr /HdJFTJUBoUWYEoVHxAlM6x/fomV9cA1O2osSVOap2XTkD8qvpJFfWrq7/WTKA== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774478504; a=rsa-sha256; cv=none; b=LrgjILmvzULnPBgj0ZtFsW33T/BT53Yw2Leoqmgq8y3iftksE7kFrZiJY5cXIPiz0t+HH1 13q6z2w9plCFhXf+HqOIFrAhWzsuz61VeYlUKphbFf0ZGhIPp9PCgpWjeCBiWhXpOiI92j jTXi3y5A+E5zPxRTprAFQnOyQ573Q5ozJgPV6yQJOMqsYCgvZQ12ci6KW4f9tP4IPh8x60 T/2QtK9UO7yy6r6tiFPrCUjjnT4sHmlOW9sZ87BXKxjAxmK7kmDCaGeYKlY+a2AzeVgqZc iH47dpgqU1CQmLj3txwyh66DlW8A+0drj28iFd/v78I0uexPhWQVOXrNtGATPw== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774478504; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=FTKbX/XhlZ0GbT2cXaFCNsFhzbC2acFmnLZimotdasg=; b=igyHxEG0t7uI7VJtbE2DECAjWVQM1CjNSs3OyyeNWKeP8vidDzlmVHdnz3DeyZvgVMyu5Q /fAVnBCNIBrMLz4nDl7GZsi3pcSPX8yu5kTlpOpdqDWi1Si4IBPx/wYVt+TxFC6x26t50a as3dwDvPJuhySveMaO8GobsmKAuAdmI3deqJBXsMIl1Ah3Nl0JgOL0KC6YwEGHnL6Jg4/i G33CA5oPYMmWoF4O1wDLLFM+qMfkB2Gqc6Xc6d4wTE17fVPPNVpW99EqixaGhe9DmuW0NB 4JHuqz00ifeMHKQVkj3+NEN8BeT7Eqr5TNHKR4orj708Auj5fKBhhj793K53Cg== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fh22b46Frz138k; Wed, 25 Mar 2026 22:41:43 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Wed, 25 Mar 2026 22:41:30 +0000 From: Lexi Winter To: "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" Subject: Re: installing world from src on a pkgbase system Message-ID: Mail-Followup-To: "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" References: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="P6m6Z6RZXgZqGsIv" Content-Disposition: inline In-Reply-To: --P6m6Z6RZXgZqGsIv Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable vermaden wrote in : > It was reported to me by my buddy okay, your buddy? what you said was: > I was told the same thing - but got hit by that 'recommendation'. >=20 > I mean - after these: >=20 > # make buildworld buildkernel > > When I type: > > # make update-packages > It sometimes fails with some strange error. is this you or your buddy? > and it seems he forgot the 'buildworld' part: did "your buddy" run "make update-packages" without running buildworld? this is not intended to work and indeed, will not work. perhaps we could produce a better error message there. > # cd /usr/src > # make buildkernel KERNCONF=3D'GENERIC FIREWALL' update-packages >=20 > --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-opti= onal-jail-dbg.ucl > --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-opti= onal-jail.ucl > --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-opti= onal.ucl > --> Processing manifest: /usr/obj/usr/src/amd64.amd64/worldstage/set-test= s.ucl > =3D=3D> Checking for new packages (comparing 15.0p4 to 15.0p4) > =3D=3D> Keeping old FreeBSD-acct-15.0p4.pkg > cp: /usr/obj/usr/src/repo/FreeBSD:15:amd64/15.0p4/FreeBSD-acct-15.0p4.pkg= : No such file or directory that said, i don't really understand this error. can you please share the full buildworld, buildkernel and update-packages log? --P6m6Z6RZXgZqGsIv Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacRklgAKCRD1nT63mIK/ YBwvAP4tlMJTV00cKh4cDaIWyEt5o6xNOq4cNsBQGasZs9jDcQEA0PwSgi76t/F0 aYEaDtxr381PqhPBSU1B1RFeiLXSfQA= =/W+I -----END PGP SIGNATURE----- --P6m6Z6RZXgZqGsIv-- From nobody Wed Mar 25 23:31:40 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh38K0QGpz6Wxkn; Wed, 25 Mar 2026 23:31:45 +0000 (UTC) (envelope-from vermaden@interia.pl) Received: from smtpo63.interia.pl (smtpo63.interia.pl [217.74.67.63]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh38J52Mmz4Gpr; Wed, 25 Mar 2026 23:31:44 +0000 (UTC) (envelope-from vermaden@interia.pl) Authentication-Results: mx1.freebsd.org; none Date: Thu, 26 Mar 2026 00:31:40 +0100 From: vermaden Subject: Re: installing world from src on a pkgbase system To: Lexi Winter , "freebsd-pkgbase@freebsd.org" , "freebsd-questions@freebsd.org" X-Mailer: interia.pl/pf09 In-Reply-To: References: X-Originating-IP: 45.148.42.24 Message-Id: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=interia.pl; s=dk; t=1774481502; bh=N5SQqFHrEQq9G5xKcECacPof0CnYUGW3Hhzjf5ouiIA=; h=Date:From:Subject:To:Message-Id:MIME-Version:Content-Type; b=UoZ+PKiRYQg7k5Ug9duLZu3+jO8Zdc6jQM3J0GALlEPd2iHBH+ksiknBD9YVGyEan JuqZzJRNVJcMvs9pJ6T4uMknBMy4971ZN0aKDrwKu+V6FUzTgKPpRmn7QViRrsAI+8 VLjE2FByF7/MKaNY7aVljNKwgjBDnaqPNdnLaE4s= X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:16138, ipnet:217.74.64.0/22, country:PL] X-Rspamd-Queue-Id: 4fh38J52Mmz4Gpr X-Spamd-Bar: ---- > is this you or your buddy? my buddy that I work with > did "your buddy" run "make update-packages" without running buildworld? seems so > that said, i don't really understand this error. > can you please share the full buildworld, > buildkernel and update-packages log? it was not been saved/copied - only this part I have From nobody Wed Mar 25 23:43:43 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fh3QJ6dFRz6WyGn; Wed, 25 Mar 2026 23:43:52 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Received: from echo.brtsvcs.net (echo.brtsvcs.net [IPv6:2607:f740:c::4ae]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fh3QH6NnKz4JFv; Wed, 25 Mar 2026 23:43:51 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of list_freebsd@bluerosetech.com designates 2607:f740:c::4ae as permitted sender) smtp.mailfrom=list_freebsd@bluerosetech.com Received: from chombo.houseloki.net (chombo [65.100.43.2]) by echo.brtsvcs.net (Postfix) with ESMTPS id 9B5E61258D0; Wed, 25 Mar 2026 23:43:44 +0000 (UTC) Received: from [10.26.25.100] (ivy.pas.ds.pilgrimaccounting.com [10.26.25.100]) by chombo.houseloki.net (Postfix) with ESMTPSA id 38A3C2AE3; Wed, 25 Mar 2026 16:43:44 -0700 (PDT) Message-ID: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> Date: Wed, 25 Mar 2026 16:43:43 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.15.1 Subject: Re: more pkgbase reviewers required To: hackers@freebsd.org, pkgbase@freebsd.org References: Content-Language: en-US From: list_freebsd@bluerosetech.com In-Reply-To: Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-2.62 / 15.00]; NEURAL_HAM_LONG(-1.00)[-0.999]; NEURAL_HAM_MEDIUM(-0.93)[-0.934]; NEURAL_HAM_SHORT(-0.38)[-0.383]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; RCPT_COUNT_TWO(0.00)[2]; RCVD_VIA_SMTP_AUTH(0.00)[]; ASN(0.00)[asn:36236, ipnet:2607:f740:c::/48, country:US]; ARC_NA(0.00)[]; FROM_NO_DN(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; R_DKIM_NA(0.00)[]; MLMMJ_DEST(0.00)[hackers@freebsd.org,pkgbase@freebsd.org]; FROM_EQ_ENVFROM(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; MIME_TRACE(0.00)[0:+]; TO_DN_NONE(0.00)[]; DMARC_NA(0.00)[bluerosetech.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_TLS_ALL(0.00)[] X-Rspamd-Queue-Id: 4fh3QH6NnKz4JFv X-Spamd-Bar: -- On 2026-03-25 5:54, Lexi Winter wrote: > at this point, it's extremely difficult to get any pkgbase-related > changes reviewed in Phabricator, which is an issue since we're now > pushing pkgbase as the default method for installing the system. What is the current state of FreeBSD dogfooding pkgbase? From nobody Thu Mar 26 11:30:24 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhM5h1jzyz6WpNk; Thu, 26 Mar 2026 11:30:32 +0000 (UTC) (envelope-from polyduekes@proton.me) Received: from mail-4319.protonmail.ch (mail-4319.protonmail.ch [185.70.43.19]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "protonmail.com", Issuer "R12" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhM5g56hCz3Gk2; Thu, 26 Mar 2026 11:30:31 +0000 (UTC) (envelope-from polyduekes@proton.me) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=proton.me; s=protonmail; t=1774524627; x=1774783827; bh=Nd/UvK05L5Y1xVMyQWqyynt1u35+1uNirLu1/1XdaVU=; h=Date:To:From:Cc:Subject:Message-ID:In-Reply-To:References: Feedback-ID:From:To:Cc:Date:Subject:Reply-To:Feedback-ID: Message-ID:BIMI-Selector; b=eyxssrjxAiWaSvMXV2oGwwUJRCfGM4BvLYL0miNah2fIGVxVtEsBWLAjGuhDQfT2i ikrsWf/FOQEugU4EIkGitSZsoccKZVTC1eikSrzJSfR6GUrZIhTIktHBNhQ2Tb3oSI PNMUVPLjLh3BJi4Q6hFbJUZud04bDSNBL7EGRG/KAv9e0crwVZI3U/MFx/UxwAVgAL M7Jla7vZ1qPEVGQYFAfS6B6xCPs2MZg85eOolhQFmAF6mIs9MFA48p56yo0rUmhrSZ qaHdwLyov8XOBr1y3NUbyYzNCIqUecqlTIVsrO9ijxGVRRWZzt3GOUxEhUh0xCkLp/ jX/gHk2ARSTSA== Date: Thu, 26 Mar 2026 11:30:24 +0000 To: Lexi Winter From: polyduekes@proton.me Cc: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Subject: Re: installing world from src on a pkgbase system Message-ID: In-Reply-To: References: Feedback-ID: 94987605:user:proton X-Pm-Message-ID: 0f651df87517d45e9900ea194ab57bc885358dcb List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:62371, ipnet:185.70.43.0/24, country:CH] X-Rspamd-Queue-Id: 4fhM5g56hCz3Gk2 X-Spamd-Bar: ---- On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wro= te: > polyduekes@proton.me wrote in : > > is needing to do both buildworld and buildkernel to create a pkg repo > > the intended behaviour or is that planned to change >=20 > right now i don't believe there are any plans to change that. i suppose > it might change in the future. usually people want to build both the > world and the kernel, so this isn't an oft-requested feature. >=20 > could you elaborate on why you want to build world but not kernel? > this would help inform development efforts in that area. >=20 i usually make my own changes to base code to test some things and learn a = few others,and most of the time the changes i make touch only world and don= t touch kernel at all,so i like to avoid unnecessary compilation of the bin= aries and things i didn't change and doing only make buildworld and not mak= e buildkernel buildworld is part of that reason > > additionally may i ask why it's recommended to do 'make > > upodate-packages' over 'make packages' >=20 > 'update-packages' will copy unchanged packages from the previous build > to the current build, which means if only a small number of packages > have changed, the system won't try to update every package. > From nobody Thu Mar 26 16:52:42 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhVFd5SBKz6W4WG for ; Thu, 26 Mar 2026 16:52:53 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic317-20.consmr.mail.gq1.yahoo.com (sonic317-20.consmr.mail.gq1.yahoo.com [98.137.66.146]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhVFd2vx1z41Kx for ; Thu, 26 Mar 2026 16:52:53 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774543966; bh=gqOj8aLvVSw+69uj+umjj/7b4riEs/yY8Sju8lPVeFA=; h=Date:Subject:To:Cc:References:From:In-Reply-To:From:Subject:Reply-To; b=GMM38OKzhokQi+D/VYc0BKfQlLkrTES/4G8iPZDb8+Ls5ONe+rDgBBlUtORioRbKNFvVgBcP2RdZoklEcDiDiAjdt01BTccPbk6ZrI0H+lmatOyTNTa54VGJ+WuVDDcYYsDMPodh/Neb1FAXbWeEJc5oepOjUR0ozpR3Bi2Cx8EmBLVXI3uYPFbii/I5wJRslX9MzeaYJ80vJrlsgeyFYfPNhYqFS9aUXTeAKSQ5E07dIvwx2UKCdQXsdq72eh9ourCtDBoCqE/l27CwsTIs6sBj2/RSvT4NxrIBl2TKCyZMKDFPBwxmSdNpQzbdpffgH6Tdj0+yT4Ec/UNTC7i4qA== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774543966; bh=ssx212bGcs0b2n0mzm2AC2JkCBpHybbFCduX3nnol/W=; h=X-Sonic-MF:Date:Subject:To:From:From:Subject; b=NMkk53skvaWznAxrvU2q5ElcsbYAPTNlSbo4E/W2w8UApEbaqP5jfS6uVsSdkwgqIDIutzXEKyq4aLIvMiv7z8HX8k01vmjE8nUSTBGJFFEb+e6LUiV8BPj24oooMWeinVtSxiiT5dOoJwFNd/l05VVT/JqB3S5P8/0YcchH9p2XpyiZH6aYuqkiQJbfRpNKI6MPtu6fk+/0js9HPLjBj5A442FadmPTNspTVcYvmCRyATrCb/QKw24TYS74kRKNSextEAPov/NRWJ7KS/2bx8sGp83ZDC2nb8cjspupLOqpZ73rzE8ywbG8GSnh335pOHRIbVEFydse9Z+B6E/4+Q== X-YMail-OSG: WztwUF4VM1mJ0BMFzU1gwnrpvh98GPYHIubrJkCkiVIuuYaI.NJTbChDtc80W.D qZMSAtPAabkNZI1Z5IZd8LZnks2OIo_eqxGzemlbUzybypPuboGccC1Zr4Q4EiLnEIl33DtmpKW0 9OKY02YFhIxFUEqv.VgCm9z9JA7fax8AdmgVLNX2Wux0tOMy1vQWGEHRbQhU4woyZdmHCBLOyrAC eMx6lPLSKCqSu8ZvMlOq5W4j9zgkJR4kUhkOfeMGbtLDR_avmnbdm83qv6WoI5NdRnsT5OFZ5AB6 Y_amJDSZhrD3FRhnyjodphZOD_58m.YjlXBjDCZLFJ5nEeEcvXsq86kRUCf9n0SQgOoEuWh_MtKg iLv4HFxAsh7OZytQk6jeJf_J0KeH1oX.p1WB0BcbfjAZeEsOkcSnj.o6eB.ClfPtMTbAVOcn7sIp Ke5ilRztCPEAZgZOI2Z6fMvTLO6WbSLEvPYiYKy8R6tVDmlxxJ.EqL7I75xvcNdhwwDdWhxPAriD 4V9N4cY5YRDhmNUsq3CfxzBKm.CnPFFEUwOhz.yHtXoh1Omrduol8n.CMOc4ZwG3kk2yJ4.zAa_Q Cy2W9.4x4nY0JDVbO_MXuhFLt2JenXZ8ANFAc1I3cTS5BM9gCRQ8aBuuMbBKWNaQRR2nBpyCWIaX iL_J3n1CwUEr6EbVge9ATAEMuz1Bj78ouHiP98cAq71udvHSl.4Zd53r6pyYSqFQFSce4xno.nb. yu5f1WH0p2aVNK.YBmSlVng3HnBx01kRG4zarvkG.aYP8hua6dlT1Yf4S5RMxhmT39Kj.9uyIGBh nAAw1_bpW6lQn2UadV500_wWi2QRlHZ6J.BIFthamPEkiTaIBhOTogTdpTteWQIkikYhZ8JEI2fQ xh3RlUkag.USJHM0RtXRYyCkFqtOnuV9nEAQvjbdy7GNppicuwvITc6hFly4dnhWjZcKs7zgckRk OGjJJnahCO0lAtw_ISDTBq669mmDPb_x7R7raFzBgBkSTDuqM6CG.O8AOU6e8bvio8i.XmSJSCHE 6s9NmZa8d2sylZ8EMtjprOVtTJB4knl8.5H7OoUF7FqHT713_kjiHHCjroSQRJvXh1zQC6a8r4bv piO6rqKO4PCVnfDvhB8CGnwyWT38IcjBsQRi_1kDTamrMKTtdn8Xur371HKSdXh2JZVtP6yAuxNc dDeoB7bgkA3eavvHiVHfWGaSHdah19Ji.jb9IrvgDIm6atcnVeJmuK0e3dpB2XAvSO5yrwFYHkP9 GkOU3OcyfrgxKDtVyaOUyPVwaTd7b0EyqhC2GG926edQTfyOiOeZ3uEeg450fp8s92vjWdTQFglV wR2MTykoIrTRsXT9eV_BWryxsJaK0txdkIUUT609riieMU5AOUFNqNwplEnQgqImM9vYn4FosWA_ OLgOvvQi92GlxcoclBv6AXH2h9xlxOH79z4Ft1au5DwiGYWwLO64IloCGusCwO0b4W_KGmt_2juH BDHP.voRM2OQX5qSZnRSICMp4XOKFIfXvL0nY_2LJvtrPdVCLFICqXajbe7XVwtuiGJNmg8ADIVY MoGtkWD2nldKm0jfMFj7xz1xs3VJJFf1elJcQn22TPPPWEzDY6K2AeVGTram2tOjEXNsnESkLPQH mO90XnxwTtm9D1rhCZCkgqTIxysVaB1r.pbQ_ZHjvPIb5MGZ29wrk_uwipQe9ex8kO48ZGH4KjGq q.2MFnRuNVwOlOwhUSjn5Id73sJ5ymdFUctLYGpP1U7fHQFaEt89T5v7OxKej0RutPdH3ZPPbHsS iAgJdRjrDygptHBDaIBz78ErPPJjtbuwzOJ4wKb7CxcPLmEbpZVHXWm_33RUe07gLXutUhcnAJ87 BMokjjDnYHFrsUeR4DSUbRloinlGTjf.eWsqSX6PURaocjxFWpivaHqoGcG.yBEtieVSfAH7PF6U DtACfkOvynzImCM.Nyy.zNUbN5PbH_S9lpczHrWSGphWNAY31oadCCaVFDWTD.OGTTpr2s22odVq POYbQYwlc4VoEk.J5oG7cAwOn1Jidw9poXPnjXCBNJaPvNMl3Eb4TW0y1EtXHIMy7q1s_V4gqVbB 7c0CygvCjcTcS2krXG4NiSqWhmViUj2S_AaTrp5rMPkr2nR8Bu4c3hBd79eD3Uj9ZB4FVw4yNrD1 wBe398VKFta5iXkPDbp8GWAbLd3JyU9WtO8Z6A9lJ6X8nbhti_Vix3Cnklo1iUCpFUQ_YwSL59dv SnCPyR9Zy9nC.1K7D7Y482suNZG5DMmMO4Q3KDklFzfkDGr_foiRSol7NcYXncr0om2j_Rd3ZdGU RzOBIj0XAxE_iSXGGhnf5BQEiqtyNbvKDKZ5bNyvzANjWOYmRZSknPQj8YeQ25GNUXQ-- X-Sonic-MF: X-Sonic-ID: 619b021d-93b3-4378-b88d-9ccccf9a19a5 Received: from sonic.gate.mail.ne1.yahoo.com by sonic317.consmr.mail.gq1.yahoo.com with HTTP; Thu, 26 Mar 2026 16:52:46 +0000 Received: by hermes--production-gq1-6dfcf9f8b-b2r4l (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 59f2f5d09464adde793f07f739e1602a; Thu, 26 Mar 2026 16:52:42 +0000 (UTC) Message-ID: Date: Thu, 26 Mar 2026 09:52:42 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: installing world from src on a pkgbase system To: polyduekes@proton.me Cc: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org, Lexi Winter References: Content-Language: en-US From: Mark Millard In-Reply-To: Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.25449 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Queue-Id: 4fhVFd2vx1z41Kx X-Spamd-Bar: ---- On 3/26/26 04:30, polyduekes@proton.me wrote: > On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wrote: > >> polyduekes@proton.me wrote in : >>> is needing to do both buildworld and buildkernel to create a pkg repo >>> the intended behaviour or is that planned to change >> >> right now i don't believe there are any plans to change that. i suppose >> it might change in the future. usually people want to build both the >> world and the kernel, so this isn't an oft-requested feature. >> >> could you elaborate on why you want to build world but not kernel? >> this would help inform development efforts in that area. >> > i usually make my own changes to base code to test some things and learn a few others,and most of the time the changes i make touch only world and dont touch kernel at all,so i like to avoid unnecessary compilation of the binaries and things i didn't change and doing only make buildworld and not make buildkernel buildworld is part of that reason Are you aware of META_MODE for buildworld and buildkernel (with its use of filemon.ko)? Its purpose is to keep track of things and so generally rebuild what is necessary but avoid rebuilding what is not. For example, back to back rebuilds have the second one not taking very long based on the lack of changes. >>> additionally may i ask why it's recommended to do 'make >>> upodate-packages' over 'make packages' >> >> 'update-packages' will copy unchanged packages from the previous build >> to the current build, which means if only a small number of packages >> have changed, the system won't try to update every package. >> > > -- === Mark Millard marklmi at yahoo.com From nobody Thu Mar 26 19:05:41 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhYCL2qYjz6WJcS; Thu, 26 Mar 2026 19:06:06 +0000 (UTC) (envelope-from pat@patmaddox.com) Received: from fout-a3-smtp.messagingengine.com (fout-a3-smtp.messagingengine.com [103.168.172.146]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhYCL0Y1Mz3HfV; Thu, 26 Mar 2026 19:06:06 +0000 (UTC) (envelope-from pat@patmaddox.com) Authentication-Results: mx1.freebsd.org; none Received: from phl-compute-02.internal (phl-compute-02.internal [10.202.2.42]) by mailfout.phl.internal (Postfix) with ESMTP id 9CA16EC022C; Thu, 26 Mar 2026 15:06:02 -0400 (EDT) Received: from phl-imap-15 ([10.202.2.104]) by phl-compute-02.internal (MEProxy); Thu, 26 Mar 2026 15:06:02 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=patmaddox.com; h=cc:cc:content-transfer-encoding:content-type:content-type :date:date:from:from:in-reply-to:in-reply-to:message-id :mime-version:references:reply-to:subject:subject:to:to; s=fm3; t=1774551962; x=1774638362; bh=qSS2/MdooDJ9oRb146MoEvb/ZdqsYQw6 36QI4u/Kah0=; b=JCoLVy39TwPZI55gM2mZSj30ADwAIsIfhWAovGjUHfUqrrfh nok85uoMps+kFpmoHQO7T/3Vi/Cy1+gcH+dViitHNe9Z7wXD6SOE/Zk3LYzp7Xls kfdBeWJHrX1juZgoBCJNy+KGUOEdcBLeWw6Tdm58meldnvdhzQVkPc+isPw45/Y8 5kaEea1CoNboS9Lb3i9N8gEp/xh2S2dMo0o2gCNBz+nTtBOOGuRbpM6hpmklcoMP MuxY3YN45OaN555ecFTGJYBFG+u+sganZNV3TgCiFstv7VBcEgZ3BCUuDCwm4eXP Dyib3vhdVLGdb1ayPRqtHJ5DobGaYSozE3mR3Q== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1774551962; x= 1774638362; bh=qSS2/MdooDJ9oRb146MoEvb/ZdqsYQw636QI4u/Kah0=; b=p izWOvfBSiFVpQJn8jyQsYcc3i0oRGa+tXHR7xlDf+Blylj/ZOScly0WIjlCwdzvU orrRK11CMJ2mDkCNayoiz+GAKmyRWSB1/8KHlBDW5UfLIRp0HoE6uFmA9dmMZbxo 6m9nHGAXCREUIW4eTIOt9JkvpzM4i1+aZkbBSdl2acW2uQEw6WkH+6AgbXwtaqar FW7atLSMvnCa2mL0/EomJOBEPAHejgB/ng8LYZhStIJuTHk+tD/bLcl/srKjN1hA F+WuwdJkEqYsqm6VQBTFNUHwbFNPuEtlX224kNZXPY5GADWQl2z+Ram7AKZHG4m5 ZtYDOPbL3jpa5RGFGAdmw== X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefgedrtddtgdefvdekudejucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfurfetoffkrfgpnffqhgenuceu rghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujf gurhepofggfffhvfevkfgjfhfutgfgsehtjeertdertddtnecuhfhrohhmpedfrfgrthcu ofgrugguohigfdcuoehprghtsehprghtmhgrugguohigrdgtohhmqeenucggtffrrghtth gvrhhnpeeihedtieejgfekudevieeiieefteeigfegvddvveejhfeludeuhfetvddutdel teenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehprg htsehprghtmhgrugguohigrdgtohhmpdhnsggprhgtphhtthhopeefpdhmohguvgepshhm thhpohhuthdprhgtphhtthhopehfrhgvvggsshguqdhpkhhgsggrshgvsehfrhgvvggssh gurdhorhhgpdhrtghpthhtohepfhhrvggvsghsugdqqhhuvghsthhiohhnshesfhhrvggv sghsugdrohhrghdprhgtphhtthhopehmrghrkhhlmhhiseihrghhohhordgtohhm X-ME-Proxy: Feedback-ID: i8b6c40f9:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 148E4780070; Thu, 26 Mar 2026 15:06:02 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 X-ThreadId: AAp1ktT6ETCc Date: Thu, 26 Mar 2026 12:05:41 -0700 From: "Pat Maddox" To: "Mark Millard" Cc: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Message-Id: <0802ab25-0509-44d1-929e-2bb81108fa38@app.fastmail.com> In-Reply-To: References: Subject: Re: installing world from src on a pkgbase system Content-Type: text/plain Content-Transfer-Encoding: 7bit X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:151847, ipnet:103.168.172.0/24, country:AU] X-Rspamd-Queue-Id: 4fhYCL0Y1Mz3HfV X-Spamd-Bar: ---- On Thu, Mar 26, 2026, at 9:52 AM, Mark Millard wrote: > On 3/26/26 04:30, polyduekes@proton.me wrote: >> On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wrote: >> >>> polyduekes@proton.me wrote in : >>>> is needing to do both buildworld and buildkernel to create a pkg repo >>>> the intended behaviour or is that planned to change >>> >>> right now i don't believe there are any plans to change that. i suppose >>> it might change in the future. usually people want to build both the >>> world and the kernel, so this isn't an oft-requested feature. >>> >>> could you elaborate on why you want to build world but not kernel? >>> this would help inform development efforts in that area. >>> >> i usually make my own changes to base code to test some things and learn a few others,and most of the time the changes i make touch only world and dont touch kernel at all,so i like to avoid unnecessary compilation of the binaries and things i didn't change and doing only make buildworld and not make buildkernel buildworld is part of that reason > > Are you aware of META_MODE for buildworld and buildkernel (with its use > of filemon.ko)? Its purpose is to keep track of things and so generally > rebuild what is necessary but avoid rebuilding what is not. For example, > back to back rebuilds have the second one not taking very long based on > the lack of changes. How long is "not very long" in your experience? Pat From nobody Thu Mar 26 19:38:45 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhYx93Fmxz6WMcc for ; Thu, 26 Mar 2026 19:38:53 +0000 (UTC) (envelope-from polyduekes@proton.me) Received: from mail-4325.protonmail.ch (mail-4325.protonmail.ch [185.70.43.25]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "protonmail.com", Issuer "R12" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhYx90x9jz3N7W; Thu, 26 Mar 2026 19:38:52 +0000 (UTC) (envelope-from polyduekes@proton.me) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=proton.me; s=protonmail; t=1774553930; x=1774813130; bh=kbs5vtMflRDiZ8C+lGx9YjLxHCBWy5CouuFmkgmdmuw=; h=Date:To:From:Cc:Subject:Message-ID:In-Reply-To:References: Feedback-ID:From:To:Cc:Date:Subject:Reply-To:Feedback-ID: Message-ID:BIMI-Selector; b=jisng9gLIIYd7Jyzf14zAe9ryhsrVgT3cTncXV27ZwgeIPzl9vC+biMqXmwYMyfEr b1ftwgOA7QBde2BUC218vAOF9oeXk7p3PSqA9wAzA8PwV+g8EDyLuNUC788zrzY5Ep TcZ6ZWe3p6UINYA2ICgISEZAnhs65Obht0CypOLU4DQlxXNpz+W0Mq34PqH7I7vCfY 1693ao8Wjh/wPILQ0PLR6arT5DTlZT/+TByrL72Ps5g0agR661RhrxRPwAg67H6oo+ heGpcry1JboyQwOTmRHDmUNT2qSqFe/KjGFOUH7Ba5eyEOLHm8I+Mi71qF02eNGB7w hK/RjV4Qj69vg== Date: Thu, 26 Mar 2026 19:38:45 +0000 To: Mark Millard From: polyduekes@proton.me Cc: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org, Lexi Winter Subject: Re: installing world from src on a pkgbase system Message-ID: In-Reply-To: References: Feedback-ID: 94987605:user:proton X-Pm-Message-ID: 5bb801ea7f7131d1975b5914e2acac4771ca8a0b List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:62371, ipnet:185.70.43.0/24, country:CH] X-Rspamd-Queue-Id: 4fhYx90x9jz3N7W X-Spamd-Bar: ---- yes i am aware of meta mode and i do use it but i usually pull the latest s= napshot of the kernel package available instead of updating kernel from src= since i don't make my own changes to the kernel, so that means every time = i update the src tree via 'git pull' and everytime updating the src tree br= ings a kernel change, the time spent to compile that is wasted time especia= lly since my machine isn't really powerful -------- Original Message -------- On Thursday, 03/26/26 at 22:22 Mark Millard wrote: On 3/26/26 04:30, polyduekes@proton.me wrote: > On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter w= rote: > >> polyduekes@proton.me wrote in : >>> is needing to do both buildworld and buildkernel to create a pkg repo >>> the intended behaviour or is that planned to change >> >> right now i don't believe there are any plans to change that. i suppose >> it might change in the future. usually people want to build both the >> world and the kernel, so this isn't an oft-requested feature. >> >> could you elaborate on why you want to build world but not kernel? >> this would help inform development efforts in that area. >> > i usually make my own changes to base code to test some things and learn = a few others,and most of the time the changes i make touch only world and d= ont touch kernel at all,so i like to avoid unnecessary compilation of the b= inaries and things i didn't change and doing only make buildworld and not m= ake buildkernel buildworld is part of that reason Are you aware of META_MODE for buildworld and buildkernel (with its use of filemon.ko)? Its purpose is to keep track of things and so generally rebuild what is necessary but avoid rebuilding what is not. For example, back to back rebuilds have the second one not taking very long based on the lack of changes. >>> additionally may i ask why it's recommended to do 'make >>> upodate-packages' over 'make packages' >> >> 'update-packages' will copy unchanged packages from the previous build >> to the current build, which means if only a small number of packages >> have changed, the system won't try to update every package. >> > > -- =3D=3D=3D Mark Millard marklmi at yahoo.com From nobody Thu Mar 26 20:59:35 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhbkR0vWlzWBsM for ; Thu, 26 Mar 2026 20:59:43 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic315-55.consmr.mail.gq1.yahoo.com (sonic315-55.consmr.mail.gq1.yahoo.com [98.137.65.31]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhbkQ49lxz3VbP for ; Thu, 26 Mar 2026 20:59:42 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774558779; bh=fA4f+SY+doyx5z+DfR8nKsN3W+7UTKZEtlgS079aPeE=; h=Date:Subject:To:Cc:References:From:In-Reply-To:From:Subject:Reply-To; b=YiacWMh2WPlqT9HtnVv9oHRDiNZAnOG9VUpYUtvpPEB4va8mmBZQuBd9M1kXaDUVD6+d1DwGH1eXKW+ps2bhz1A1oGov7BopkJrYN2gRhtNP//BB62/ZuMlq7GehGWNo/Jx2EMKVahregiQ1+cjj6Kwt93LcB04wmGLek7pmadauBH0JW5bScOEYo586YFRsaKivBg1+EXP+th14SygJhsAXJN6IgbHmGKcojUl65vIhICPPBvfpb28f/mNg9tMVEkI76EEoYs8hMr9S5lggMO7oWAMME6STs4IlEO5JhtCgdUBddLVck8LtKl+CEDGDHmjjzvGLYm+srgNQC94Q8A== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774558779; bh=ZX95gDN8EVdYuwAjlnoo3Z0WjN/EADXq680kZtScQyo=; h=X-Sonic-MF:Date:Subject:To:From:From:Subject; b=qOz3Wodxg2jEeYJcciLMzOWIXib+d5yhFyhgLg+1AKaAQdVjEcxHEd1nVARx+U+fGUnFAI1hEFe6iizdCU8kt6186WkUHNwWMmY5FW4/PShc605VKhVC/LZgcMvg8oTJQ+uc4WU4wWeKZT2Jiudx/6l8X1jQ0OBqEmL3umP4xPA8sKkDBQeHjHozkakrCaKWOp65/9tB2m9m8TOPyufOFIVmEgzOu/Gfuu7Nam76lGekVmFZtYftlnHR5G+wgFp1VJ4ahN2LwAkTDMDtlGJWrnO30lMKXPYipKoX1ei5sCWg1sBaNoXQvqCWnhaDbfxCkr/Tu9v6+dtEhR+LZck6sg== X-YMail-OSG: Yh6dgZoVM1mZNYxTZvtnCnWWmheyRZDcd6HEHeiGZ_.TgIkdP9TuQLZQZoZRkmd HQ3Xudcq06iqBy9bnSomKtOPoO.npzJcopU3nrpzZUre.eov_Pk1n2ItXy8jpwOYQ2fAMMU81khP hqf8N_MA3kMYxCS6lynRBCTvFdN4xs7dPHO0otHJ37suGtWCVz91FvWqoEFko.EffJqA7h2rd0gS FFn3NXHAv2c3WVcobbp8EGiGD0kwkGKmTd_h2KaVlYEYfno5ybrDlb8aWn4I2rIhOt6topw607xe HsB.6ojRI5bUUXIDOXL5AVBxGGQBbjs3Ssr_Sn1G4zS.6RnFEKs.ZJG3bzn21h.jNiguYi9Psnoj 3r7_6lDpchlHVH8n05nqZ.U604pksVfHr2KTcijE_uaOGAtaJEASicGAATkr868peP9nAL6pJk.Z jiV_VZzr0agozhtJ3MMDJVmuOCo6_4FpQADOaphcLq1tFZSOiWOA4bjJPQDV563zBKBF1fjpPCQh zOY4kAjZYDsa6WXSUEO7SO0NrVbfcsoEIys9WZtBEiahox1Jqd7KzQ2H05xdUGZ1aU7SLXzYBC.n 0LqXSIVjhtTYji6G8Rwt76IH2uQogq1oguW5Bbuowni6r5SwDW.gpUatpqtHjcJwsnFdpWyj0izm bKR5tGUza9dYSKr0Q3Y9cRpuzdAKYkHK0C8O5kw2OA0YMZtzzfLEGolKtqNurKdPzMTMU.5R3iJ9 UdW9flmxXsZR9u1PELIZiM3moyE5U8Ptde8UsdoSVNCMaXIEYtVuhfsJplH6yFuE8Mn8y3cMcq5u XSWte38o5pg4ihH6ADptmy7.niPHSf4h..D5L_WUysvAjCgjzOgEa6DLXSVyfMx9ZTfuQDJT.7Aa gOnDWraUWfzD.RJQlPW8vgpGTNf8Ws1VsdRhibhvZUqC9fVBkSx6xfhOxqPS.BqilH04qplkgVgw RxjtlQ0TWpOA4CloWl4CGv_ehqctP6On2dlr1xvOSGUaRx3mFUG8M59dGiWCqQWI3FUIn..RVsSY PeFP0AH9kuwZcEJh_jkSCJDGeVbjUuRd4KNGOOCJ_ZlTL.tX1TXRbTtrf.USUrn89EPgWJtBK781 8WTPjd4_ZBDP02xi8u.m22G_gcpxStM4UfzKV7A13EjBLWUNVlxu8QhUF3XBi7yWIw0H61jpSb8P YKvK_7G6q.EagPKwKPZDSQ9ngLJ0KiO7IPX2kik.vFLWPxD0C7PQiycaaLdv.MQdRFZJ7EZUAmIO GadhHe3rWACeiijUDYdGuH4csiXbCNmaqgsshzZl1VGZG.3gZh8OgUxrTHsvlJrcvfhuZ7Ap0xsZ JPCnq_bfGuoUDoosTwpmbFV7enQSGsXK1Wi2FdDv7bh4WJCgwWytt27kBymE6m0Jxe8cjWSAE_t9 lX.JBv72n6edhMAPr5wPtxel1hYw9lCkvCTnhKpwKCbp.E72OXF8Hk.C2c0.uwGGgxZA6VWUg_6f 7SMvpBcnH03umBSvf0m_WPErN2VHAJdDQS3KuaCT3c0Fw8FlOyZHraCztqqgzVfbXWVm02EY.dBk r.mhprL2Zet45WmVkbefPPW1Wj0LReuJYxFkS7zrFWq5KRKghU4qfGWgUj4cjIUTiA6m5WMz9lyp gxXoI8CWhI6uE8.nfG4lT0YFDhoTFE.bSbQ3qdy57S22O3gnhGLI5OHOqUMtP5jSayKXStjMTNP7 7B1pJZjukeczKKc.LemOCVE_XOkw6uW0Dd5VWM9.eO01LxaQLK_5WZC_db9Q4b2fxfwYX0IsOZMX eM7BLdQXZtEU9TjqwxMNrPfs3c62HlrQZQWiy8OddRgwHH.uF4z_Lk6Hf80rzF6_0AdvAC66iYct hYnwsWWSRiwO..DiYdEKWlvIfl5Ib2hVySaCQticpLdSJLLdGMhoB5U8miOFY2uR5iS2grYeO9dd wRG.Zf0TBDqc0rBkOBqOpnI3YGLwns34fO.grYNQRr327wQ6IX.tJDHO3zdBTrf3Wp0Kd_ZRs0QY 34Hn4bq1P5NYk58fpiHpJQieXr4XWR2kH2Fej4FjglypLwwVrgTiF_YfevPQOYlkI5SKCRUZ5pfY 4TU_lSkp2A8mRZt5qw0UiXPAFT3TGE546KpR2DVz1qmmrW8vDfeWxDxvts7wy3ihwZnBmv.xXqbZ BEkMqG4eHcguSPtEJx6AEV1EIkERrkrHs.yeNObiXyLHm8r_AyNZyexXBjpGBvyay2UpD8w9zucb Cmt6pgOB7mgjbLPwa1HcHMvuCY15aqRxVH8luYCP0bCs1Tjoo2ndasqHX7b6K.Ym1kpviKi.Efl9 h.MJVvzPSu1SUix.CeMIMhnWLQbjw.81QORlAmIIpf3TVVoxC8M.i7aD_j0j3SAfU0rA- X-Sonic-MF: X-Sonic-ID: 4dc8b676-e3b6-42cd-a694-16159d6cd3f3 Received: from sonic.gate.mail.ne1.yahoo.com by sonic315.consmr.mail.gq1.yahoo.com with HTTP; Thu, 26 Mar 2026 20:59:39 +0000 Received: by hermes--production-gq1-6dfcf9f8b-gxljn (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 3302fe016ef5f0a6938195ee56c57c05; Thu, 26 Mar 2026 20:59:36 +0000 (UTC) Message-ID: <82e40b37-64b2-4dc2-b304-5002bacf4dc2@yahoo.com> Date: Thu, 26 Mar 2026 13:59:35 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: installing world from src on a pkgbase system To: Pat Maddox Cc: freebsd-pkgbase@freebsd.org References: <0802ab25-0509-44d1-929e-2bb81108fa38@app.fastmail.com> Content-Language: en-US From: Mark Millard In-Reply-To: <0802ab25-0509-44d1-929e-2bb81108fa38@app.fastmail.com> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.25449 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Queue-Id: 4fhbkQ49lxz3VbP X-Spamd-Bar: ---- On 3/26/26 12:05, Pat Maddox wrote: > On Thu, Mar 26, 2026, at 9:52 AM, Mark Millard wrote: >> On 3/26/26 04:30, polyduekes@proton.me wrote: >>> On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wrote: >>> >>>> polyduekes@proton.me wrote in : >>>>> is needing to do both buildworld and buildkernel to create a pkg repo >>>>> the intended behaviour or is that planned to change >>>> >>>> right now i don't believe there are any plans to change that. i suppose >>>> it might change in the future. usually people want to build both the >>>> world and the kernel, so this isn't an oft-requested feature. >>>> >>>> could you elaborate on why you want to build world but not kernel? >>>> this would help inform development efforts in that area. >>>> >>> i usually make my own changes to base code to test some things and learn a few others,and most of the time the changes i make touch only world and dont touch kernel at all,so i like to avoid unnecessary compilation of the binaries and things i didn't change and doing only make buildworld and not make buildkernel buildworld is part of that reason >> >> Are you aware of META_MODE for buildworld and buildkernel (with its use >> of filemon.ko)? Its purpose is to keep track of things and so generally >> rebuild what is necessary but avoid rebuilding what is not. For example, >> back to back rebuilds have the second one not taking very long based on >> the lack of changes. > > How long is "not very long" in your experience? I happen to have been doing builds as part of a long overdue update of my context. The below builds were executed from an official pkgbase distribution of main that was booted, using the non-debug kernel that was distributed. (Only a debug world is distributed for main.) But I was building non-debug worlds and kernels of nearly the same source code, with other tailoring involved, such as static linking of the llvm related toolchain. I've access to a wide range of system performance, from old armv7 RPi*'s to a 7950X3D amd64 system with Optane 1.4T media on PCIe. First picking an aarch64 system likely slow compared to common amd64 hardware, but faster than a RP* aarch64 system, showing both from-scratch build time and then the rebuild, not having changed anything, showing both World and Kernel. . . Microsoft Dev Kit 2023 from-scratch build sequence, USB3 based media, 8 core, 32 GiByTes of RAM: (I have reordered lines to have the world's together and the kernels together and used extra end-of-lines to group things and some leading spaces to avoid misformatting) # grep "built.*ncpu:" /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-*.2026-03-2[56]* /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-25:23:12:00: >>> World built in 10909 seconds, ncpu: 8, make -j12 /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-26:13:04:35: >>> World built in 146 seconds, ncpu: 8, make -j12 /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-26:02:13:50: >>> Kernel(s) GENERIC-NODBG-CA76 built in 632 seconds, ncpu: 8, make -j12 /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-26:13:07:02: >>> Kernel(s) GENERIC-NODBG-CA76 built in 11 seconds, ncpu: 8, make -j12 A faster system . . . amd64 7950X3D with Optane 1.4T media on PCIe, 32 freebsd CPUs (16 SMT cores);, 192 GiBytes of RAM: # grep 'built.*ncpu:' /usr/obj/BUILDs/main-ZNV4-*-clang/sys-typescripts/typescript-make-ZNV4-*-clang-amd64-host-2026-03-2[56]* /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-25:15:50:07: >>> World built in 1048 seconds, ncpu: 32, make -j48 /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-26:13:10:20: >>> World built in 34 seconds, ncpu: 32, make -j48 /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-25:15:47:41: >>> Kernel(s) GENERIC-NODBG built in 91 seconds, ncpu: 32, make -j48 /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-26:13:10:54: >>> Kernel(s) GENERIC-NODBG built in 2 seconds, ncpu: 32, make -j48 So the example ratios span: 10909/146 approx.= 74.7 1048/34 approx.= 30.8 I'll not get into the details of my builds. The builds are personal builds in various ways. > > Pat > > Note: I'm not set up to send to freebsd-questions. -- === Mark Millard marklmi at yahoo.com From nobody Thu Mar 26 22:51:43 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhfCp1SGFz6WDcD for ; Thu, 26 Mar 2026 22:51:50 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic314-20.consmr.mail.gq1.yahoo.com (sonic314-20.consmr.mail.gq1.yahoo.com [98.137.69.83]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhfCn4pyPz3gn4 for ; Thu, 26 Mar 2026 22:51:49 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774565506; bh=h0C6G1Uz/WGkyHUiPaTiWZkMnUVB1ZD52A+x14mWE/w=; h=Date:Subject:To:Cc:References:From:In-Reply-To:From:Subject:Reply-To; b=lNUY0LNFyGSMIs0iumcHYGqPrnZBJ7KiImYaby3LHE9rBY6dWZejg2/GAWO800qwm61c+wkMi/9SJbP/iCfWFZPfORkFdZ1m+eHrUpJfWo2mnmhsalIHJRiSIJnIQoNF6ChTmvIMSbspB9VPhZDD5sohaXr4uJ4qULzkej9LnhRbH72HewLYO+x3/+zjkQif2AptKr6hJnEI4T4YXUa3UFKl8TnCZmIIGOaIQSwEJjYKJ3Pqk6SHLV7j1x1oHjVgiH1bEUTq2Rvghq+/S4pjuZ6OBxfRDrjsrvSk5NDsqON9je8w+buIQWkik7dn4gdS/06NnQIpkWn38FIUa7t4XQ== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774565506; bh=Ify/so04gdMkmyta2jbDh7VVpnnOR5bhV29DSHzcmTz=; h=X-Sonic-MF:Date:Subject:To:From:From:Subject; b=OGMVMPcfKGkckA/B2gpF2Zpl9ZdmjOG657ym89I0pwvEcTSebQfBdhqQp9zoHC0QG0rLdIwaCaxjkKmWX0TYYpyyKAgMDJ92WolDAmvg5v8zG6cpfWeWEPicKwjbnJU7CtzrlSzJs6uspQp+2inDuNIx9qpLS38ca/1AJ4qDOJGBq0W6gU0MMjnS5spuMxU0A2mLPrHcIkWORrutl4N5BI7E75YSbxOkwlms272mH0Ipbf/KbmUN7i96uoDS0dn6nXYxllJV00hBn2YBhF9kSdBDi0DYfdGVfwp9lHw6X/r2IrYocArJftFrauVyRboEZBlsvC1DcNMeD8NNeUDWqQ== X-YMail-OSG: 0PvzFjEVM1lodtIGrZLalruNTmxONSG3uYIF4nzxR6FzOuwHnCGVEqtrVmPw0Xx oocPSrXozO_DcfSkBRUnMJhUve6gmlewm9nCKZvzu_SUtnFRAXm1d6uhEVtbrOM9d1JmNbUdo02M KPq3bqkgsPTr7i6lr9f0d4RPNK3mn2_WXWeyqdOlSqyuN2XIVc9Tv90dhPQ_20of_MBltB4iduh2 PsLdR3XU4W.Ls8cL934xQnrwbra4_EthbWYFlMXbz8plbryceOWs_z2gyPaYNjoJMRXpy2kDJQob gKeZUhKy2j.nJZW96TlPqPUCJU3BUKZ.hUIF1wxsU1dLIg1k8D69Pfu9VCXHSBVZ8DpAV7KBxdTq u5DJJQDzGzuQzB3OZ4k9PHCiusMwNAO7.p.MPbqmHqf0WUbzWQ7JQwmSOMWFXgnLD_ptWBqezX47 bmr6Zt3ENKD5R9hJd_V5pD9igSQoJWyNa6EXXqDAeXJ.lknYsORowngQUlVCc9woEohSVbWG4uqn J8KmsaLozx2Q73c0VAi7s_DrSCZOuuMiZhx6ZdinaJ2u8YZCf_8SF0Sx64hgOIztKbfeOnzdqQzW 7EOHqK3_2wAqbE3poMCEE631tegQSds6I4qAobDISwSMfeUrFtYOP04yBellBLoqeQoPF1EEi3J6 of32RptbjjPTe5FlD4jZvgcEXv.8ZDoWHLhoDQf.cfFAO8xx4slfYJqPQ6qDyeZDGI6.E4Jq3ZQi MNKzAsso7NjOwOpQGIwxsWbGhgqQ8itXaKodUx_2aUb3W123CCJGpPb7e63cs8I8X2i_7PGCdtSl _VIlwAOK8Qz0vqj9_k0TDa0JZnRa.J59toSLgWUlXy.NGXCPcxPYik8NiGdbTgbfvgJzb.1i_yCI mz2gj8vfaE02FMz0st3RUAeOwRA1ntzFYyYMWCGTDr4Rbt1pBI66qCrDntwkwygiklElZX_SuZMq Yl89tNpbrl4vMuJSeHLilIzp5YNTnYs9_6p4qyE75qUVdySTmI9A71rXNmiVkMBa25tMCcjlAK1N 1UW64tb2IvVwxnQB0HAZBFm8MCOLNZlcGNoWal_.LrSaLXoaArT7fNFhUbDzrAF8TQ7wLwapx8SV cvjlWQDaJX89gzNDtk4TK3PsteEiQ8pqjb_5QBPPy57DN6kV0.UIICOKYB7bYvNVZ75nhFQE9g7s ldPxJi4QONDrdiUaQPLB7IBzc39YtxeOOAScuE6PLbnBXkUVJJJZkVBBlMPY4st5G9OUJmLZkmyJ I.XBcY7XEPgnVa6TsbtUHpc1xdN8Vid.jqHvbsAQVbSZ8s.Z9HwJ5IXp2EqkeernVNobeaHXohl0 CZxHBzf87yF9BZPb_dLQTbQcuMYR9FiZ_ipaoim8LElpvdZ04xjMW4jJxIdBp4_AWtOklPmrdN2O qyPJY82xeO93DTHag99YEiOD7SVKxhPtyclWnFI5jqSIE8oL_Dmv1FxoF5TOdY8rH5cks50AoFU5 SieZ9dNVqew1vN_VMPGAPrAE3LOoxSCxq7Vd1.HlPYQ6lugmHN_nsWLnbLxrvdfwHEd6E073uEJ9 ..jjMFqNZeLTgc1s6.CTVWHrJ5PIumxrS1Zlgx5sNpqSMwNaxFAal8v8emdbhC_DlIclilLigySo k1WdedpBGdEgkreD9XkgKDxwtjMBWZcITDdD3QuT4dXD9TLW0VCO5L2gxJ9uuRld.H9kSr7vbIdU UHZ3MuRaLrdGqqhJlVp6hDTc7UNhLR.JZd2Ju7mbD0tGmmbv3tI_.BVJzoS.HH6bLwuj5LRe5GLH 2fQNy_aB5.92SHjQF3J3rzuCHVtbtngvHGArViPgwgQ0iH460Mcj_lq.d7Gr4Q9qGbAtWw8_1gDd fOP8fVyV85VYVGk9KhwPhjXpcj3kmpii1JgV0n4hrW9XaRXRvwveGDVeciTD10QQPzdi1gRQ6v0O nmvWTSFCdCpeJgNRXspq1ybopXNXYf1bpxUDHKfLNrfr1q3cCTU67.oSm7On12Ggx53KLq6tMy8O Kek22Cvmob75c8NXhtXkeHLF.KdqMpChmTFPgGDezgjo.k7Yj3erT1jQgUeZioXhXVWUa2CzQnVN jRILdTwNCa3jvL9AbqO_i6Jc1K1W5MOLtErIutAHbU7q8GHhFWm4p0ZHadUfwuCWff9tIPgzCisO QrqNR11QlqR_luEc5H_3tyYhk3oJmVYHsPlClocRn49ZdFpNDBbH34V5w47nXi07RiUvgxvkXjTS IxhjloJaQFufYCWPJyp6mnp5KnSDnB7ODrJut4vJD21BTg_mQc1OmawmkhEyaUehwFoeKxQXJz5j giUZpR3AuWkb3Z3RsMoPz_pjXuyMNGa7jh8LXRVj7FZaFbt9Wuwg2jm5BL0_.PsqETMOk X-Sonic-MF: X-Sonic-ID: 9abec98b-a59d-43ee-ad3a-b627075c4760 Received: from sonic.gate.mail.ne1.yahoo.com by sonic314.consmr.mail.gq1.yahoo.com with HTTP; Thu, 26 Mar 2026 22:51:46 +0000 Received: by hermes--production-gq1-6dfcf9f8b-tq2jw (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID 87af47ee482ce09d54ed21869718866f; Thu, 26 Mar 2026 22:51:44 +0000 (UTC) Message-ID: <3ff6c824-d9a1-426b-aa04-d19d1ee1c958@yahoo.com> Date: Thu, 26 Mar 2026 15:51:43 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: installing world from src on a pkgbase system To: polyduekes@proton.me Cc: freebsd-pkgbase@freebsd.org, Lexi Winter References: Content-Language: en-US From: Mark Millard In-Reply-To: Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.25449 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo X-Rspamd-Pre-Result: action=no action; module=replies; Message is reply to one we originated X-Spamd-Result: default: False [-4.00 / 15.00]; REPLY(-4.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US] X-Rspamd-Queue-Id: 4fhfCn4pyPz3gn4 X-Spamd-Bar: ---- On 3/26/26 12:38, polyduekes@proton.me wrote: > yes i am aware of meta mode and i do use it but i usually pull the latest snapshot of the kernel package available instead of updating kernel from src since i don't make my own changes to the kernel, so that means every time i update the src tree via 'git pull' and everytime updating the src tree brings a kernel change, the time spent to compile that is wasted time especially since my machine isn't really powerful FYI . . . git pull results need not always match the source code for the official pkgbase package distribution of interest unless you are being very careful. pkgbase publishes the source directory trees for its distributions independently of git: FreeBSD-src-*.pkg ( provides /usr/src/ without /usr/src/sys/ ) FreeBSD-src-sys-*.pkg ( provides /usr/src/sys/ ) The the 2 are not necessarily even from the exact same commit in git unless it is a base_release_* pkgbase instead of a base_latest or base_weekly one (and no new release update has been started): the kernel and world source need not be grabbed or built at the same time for base_latest or for base_weekly and more commits might have happened between the world and kernel builds. (There can be some additional risk if the kernel's source code was older than the world's source code as the world built might be dependent on a later change to the kernel source code. Typically this probably prevents such a world's build from finishing.) (See below for details the above wording does not cover.) As stands . . . For base_release_* for some FreeBSD:15:ARCH : pkgbase is based on a releng/15.*/ and the source should match as long as that release has not started a new update sequence for the next update to a new -p? release. A base_release_* distribution does not update based on just new commits to its releng/15.*/ but only at/for the official release-update distribution process that happens later. For base_release_* for some FreeBSD:14:ARCH : pkgbase is based on releng/14.*/ snapshots but may update during the middle of changes for the next release update to a new -p? release, tracking its releng/14.*/ that may be in development instead of finished. A pkgbase distribution time is possibly later then the build time. For base_latest or base_weekly for some FreeBSD:1[45]:ARCH : pkgbase is based on stable/* snapshots and need not match git pull at a specific commit. pkgbase base_latest updates 2 times per day if new commits are present and the build works. A pkgbase distribution time is possibly later then the build time. For base_latest or base_weekly for some FreeBSD:16:ARCH : pkgbase is based on main/ and need not match a git pull at a specific commit. pkgbase base_latest updates 2 times per day if new commits are present and the build works. A pkgbase distribution time is possibly later then the build time. Such is my understanding. I've no clue which if the above your activity might involve. > > -------- Original Message -------- > On Thursday, 03/26/26 at 22:22 Mark Millard wrote: > On 3/26/26 04:30, polyduekes@proton.me wrote: >> On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wrote: >> >>> polyduekes@proton.me wrote in : >>>> is needing to do both buildworld and buildkernel to create a pkg repo >>>> the intended behaviour or is that planned to change >>> >>> right now i don't believe there are any plans to change that. i suppose >>> it might change in the future. usually people want to build both the >>> world and the kernel, so this isn't an oft-requested feature. >>> >>> could you elaborate on why you want to build world but not kernel? >>> this would help inform development efforts in that area. >>> >> i usually make my own changes to base code to test some things and learn a few others,and most of the time the changes i make touch only world and dont touch kernel at all,so i like to avoid unnecessary compilation of the binaries and things i didn't change and doing only make buildworld and not make buildkernel buildworld is part of that reason > > Are you aware of META_MODE for buildworld and buildkernel (with its use > of filemon.ko)? Its purpose is to keep track of things and so generally > rebuild what is necessary but avoid rebuilding what is not. For example, > back to back rebuilds have the second one not taking very long based on > the lack of changes. > >>>> additionally may i ask why it's recommended to do 'make >>>> upodate-packages' over 'make packages' >>> >>> 'update-packages' will copy unchanged packages from the previous build >>> to the current build, which means if only a small number of packages >>> have changed, the system won't try to update every package. >>> >> >> > > > -- > === > Mark Millard > marklmi at yahoo.com > > > -- === Mark Millard marklmi at yahoo.com From nobody Thu Mar 26 23:37:47 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fhgF43dMmz6WK1Z for ; Thu, 26 Mar 2026 23:38:00 +0000 (UTC) (envelope-from marklmi@yahoo.com) Received: from sonic306-21.consmr.mail.gq1.yahoo.com (sonic306-21.consmr.mail.gq1.yahoo.com [98.137.68.84]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fhgF25948z3lYV for ; Thu, 26 Mar 2026 23:37:58 +0000 (UTC) (envelope-from marklmi@yahoo.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=yahoo.com header.s=s2048 header.b=um6WUjJS; dmarc=pass (policy=reject) header.from=yahoo.com; spf=pass (mx1.freebsd.org: domain of marklmi@yahoo.com designates 98.137.68.84 as permitted sender) smtp.mailfrom=marklmi@yahoo.com DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774568275; bh=v/cHI1LBWqx6/V+8RtM1CeTO50NlnZvfuSm53e9oj5M=; h=Date:Subject:From:To:Cc:References:In-Reply-To:From:Subject:Reply-To; b=um6WUjJSFTx0/hZGsTWBjNTxlcwz1+nrsyTmXkULQ7gp2Y8dpdLEau86TUD0F83/vXKNmKIGvEkwHD9dU4SjEX5xDSsfTE7jQNWPnM7FRcNU9RPsh4DtEfnUum5YcT8tsp+Iwg662kQqs9y8d1qQAjUy2JGr2ka8hqEl/ydSygEEuiZ8Q3aOKFn/hVtgyxN6aQMgfnekfaLbd5l8Szk35YFtay3wv4Ou8DvIk3V2pA4SptIQfWERS9S4kMoYXY5K0GblPe4MygU0wwKG25V4KB0xVm6Q7pEQA5NxSbDFCf1X/jFBKzSHqfinL6K5y+5v5maFYdIYxnoU3fACN9XXKQ== X-SONIC-DKIM-SIGN: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1774568275; bh=b60pM5th7EYU8qRJ7jeppzgK4bAJQSLBul9tqy4hGfN=; h=X-Sonic-MF:Date:Subject:From:To:From:Subject; b=WIwmcv0BqLB6IfkxdN/qF60JRZlMNpQQhba1KAc5BOkFOzupzz5I+xKye5zspnFu6lZi5qnP8CCzrbZYJr1GZ5AQrblYeKw4KoOZL+69Ed3IwgFcSaThif3fwsX9xEmk9npkFqd27kWHDQc6GDa8lFzVvYZManOQZjfHWwgA4Tgl/StqAeTPkgJ/W6bUc76gKnvqdQpGZ+44C8dRIk1a1XJC65vo4GUdGzv1343g5LmjqjtP85ci5yYx2pLD06oF/gahWIuAMnHfYadisJJZurEOHJ0+Qm9yAjEyAJhNhsJ2ciPHRRGOsXipsQABdCw9LHA1wiH1OiahxTXhvbfbSQ== X-YMail-OSG: Y_IyBJYVM1mEqynYBGfovW58b19kLewjLc7drzTeZrR9dq6lMChoK.yxl25LO0M s.V3bw6PXKs4Kxu8OieoQCCHWOGm_1TjuVVNNSm887mg2rHn.p7_jATTE3b9MhLq53ka7VkLVm.f P_V9Ma8Va0z99V.v92pObXio1eOjStOAgtgUuszNdtBn3C68fViEVVJh0sFKTlzyBS9qJZtj2O41 fesWTVl.erdnUlCx_CYTrbFcZ9SyeGdrWTLm__zAOLb7693yiHLoXsnqHtT8LdMaDh24MRHq1i2T gcuvswXnj9ZMXJ3o.HLFkW3H9EfFg9d8ADv9i_FvJhphaXQzRTzUY8JeEBuLAUDj4f1V0zgyyN3g 2Si5QHqbT3SZcBSbuyptfjUsv8r1qAy1uYI5uFiITAQN_Vxg.mVEbhFxCho5iCe2RsNe49OeOwEq O0GHAA9ZgmWtAOIWvD.5u98eJ7hmT309XA_igIgKYMfzrB4nFEjtKuUAMhm6cGKAOvGsiZeD2V0d IO6USEn_qBxEd3x5p3juqS6QCQCX2OVUfqprxYsEw.lEIjfM9LaxOD9SwcvpcthStz7RnfvvvESs OX4vKHvbQ4rXUyWwp7NQQBVTWfu39d_CaBCC.GFAk3FFva0RiIEdqLqgQZFPCd1MEM3YWYDDmGuJ C7X1qZlClY7YGktGu2menpIXT0FqFs0K7bqJzyeT1pYNB5P1hYoR.UUmoStBb80uTXn4ylzhUTYw OKn.Q2M5nj.46mlDIgvgSo6SUGdqqcJ7LoFcePy_FJfhvDG_y6LV9mfnL5iV6MsfgDojiPGa3UeQ klTTd0PACTBpr6lmscXL0yWkVYufMDsUFGdYHIB4zynfDop5NBeJs8qcGeVapSkW_Saq.Hk0G0vj PwhV7Z15X9uMo9qXUNpx88Nsgze2UtFw_vb49QzdKE0TRQ1wM67xq.JrOrHtPDtOJo7PbzWD_MT0 BuYjtduDF448q__iSn_l92mom1LDag2CWUmbisJWtOIJMMNFDaH1RUAwWopyqXcBJxotOS26UGmI IymyLYDJ4OnAoVVYyGzrdk9RXXWODyHqeBdBrddoz.xQDDwuwJ5Ph21KBL3SUPscWAir.t0os2jY OCmrCl2N2XPZz0kkSyuSmRPI7fcU.P5.14OCe.M7mrsPCezyZfSjySHAy_ZlOyZGJxUrqEOeYoZ3 BdbY46KCklzyY64REXWUPCKcb_v76YvylaCOA8gneFZ8nr11uApwHHXz7JamNCpLoNIEZU2zu8vA 2JKk1WnuPvR4w6HmDB9rZvhb_QO9PC33Nu0N3PuLZz0hi0ajD0v6LYQfQWXfQnh861d5Mfb.3xAg im10QhAD55V3SsE82HlCsa_VmtOO_bt1B6CaL0dmQBw10mMqeDRbxSyhyPKLf00fxGH3qjjHpA9X mGL_ZFumXXwboyliHi6MyYZXa7KVodN0cPfizLTfZkNXJNu85j0Aa4O8kNtV4YwVszwubGSmuSMb gl8oWqDLDfbnDdb07RnuoB4QWVFaRm86dnF_oH_Z1cDvZaw.1bJcujUaq5Okzau.0HeVtZucCBeN KVRwTiNGiLCmh0DfblY2WHcv6GtpIUzf9AVMG4e0pJcD_bBL7cLcuw_9kyv4STF8D_NPaDVxO1m6 Q2bM6pc7.Fhkx19X7Eq6I3_mAFORG_jB_NHj3p2KO9uurDXk__SnMX53vVEtpGQod5ScekDD9q3s 1X1Eam71dN5Gu3pp_rSfDDVIkbN0OPtndP6Q0e0.AagyxlmP.4HE9zloGEzjiVGt4UeVqZj22lIl TP3auW7SMpUE13_qmQezFcgcGWvVp5lwzqgF9SmTyFa6K84b7gcaonnufHdWwSyQbIIuJ.T_IKVs or7j1Qnv9B0XU_ShBVSclGwN9P1daLlWlWJcZuTGBmxd.uvgT9C6BBLAao6q9ENr_qRnYwbztM7y npPcBjbP.E1v7bl0ZU6sEOO16D7c0m9tYA7CN396.zdVbebUZguLJZhzgZ2H4n33wQCbMXM3ZckM xqWrlktNaUKre6vIbHKzLLqNsXg2OJGq1gvf9dC3iQ3SGnwUyk3PW7me4HP1974ZMbleRH66wZgM ejColptb2P.J_Wj0KQCoedLQebUzK1FCrX_XiWAef8VnH0oqd8vGVo_npQyLC8Xf3b6YfcwUiosi SHnc4pIQwJrs_UZhO49pRHfdU_bMNrfo0kM9_ranuB_Tum9SlSg43vn5IPbuWNMvgfS1fOPLgDJT E4fI8afti7j7eoaBYByj7Y72AwAcjE4aZD6HzhYOgiUgOKI22vacfdZrZM6ebfCjPg3Rm17EYxVQ NXOFYHAejJw6YDcouK5hdzTE4B97fKIOhG4IDLPJCaUms6dSB1c9ZVI4YpVpt9lX0 X-Sonic-MF: X-Sonic-ID: 2470f946-f47e-4c26-8f25-ad4133f34eed Received: from sonic.gate.mail.ne1.yahoo.com by sonic306.consmr.mail.gq1.yahoo.com with HTTP; Thu, 26 Mar 2026 23:37:55 +0000 Received: by hermes--production-gq1-6dfcf9f8b-x2pwf (Yahoo Inc. Hermes SMTP Server) with ESMTPA ID b27a04c476bd8004a13abaab6cfa71b2; Thu, 26 Mar 2026 23:37:48 +0000 (UTC) Message-ID: Date: Thu, 26 Mar 2026 16:37:47 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla Thunderbird Subject: Re: installing world from src on a pkgbase system From: Mark Millard To: Pat Maddox Cc: freebsd-pkgbase@freebsd.org References: <0802ab25-0509-44d1-929e-2bb81108fa38@app.fastmail.com> <82e40b37-64b2-4dc2-b304-5002bacf4dc2@yahoo.com> Content-Language: en-US In-Reply-To: <82e40b37-64b2-4dc2-b304-5002bacf4dc2@yahoo.com> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit X-Mailer: WebService/1.1.25449 mail.backend.jedi.jws.acl:role.jedi.acl.token.atz.jws.hermes.yahoo X-Spamd-Result: default: False [-3.99 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.99)[-0.987]; DMARC_POLICY_ALLOW(-0.50)[yahoo.com,reject]; R_SPF_ALLOW(-0.20)[+ptr:yahoo.com]; R_DKIM_ALLOW(-0.20)[yahoo.com:s=s2048]; MIME_GOOD(-0.10)[text/plain]; RCPT_COUNT_TWO(0.00)[2]; RCVD_TLS_LAST(0.00)[]; ARC_NA(0.00)[]; TO_DN_SOME(0.00)[]; MIME_TRACE(0.00)[0:+]; DWL_DNSWL_NONE(0.00)[yahoo.com:dkim]; FREEMAIL_FROM(0.00)[yahoo.com]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:36647, ipnet:98.137.64.0/20, country:US]; FREEMAIL_ENVFROM(0.00)[yahoo.com]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_COUNT_TWO(0.00)[2]; FROM_EQ_ENVFROM(0.00)[]; DKIM_TRACE(0.00)[yahoo.com:+]; MLMMJ_DEST(0.00)[freebsd-pkgbase@freebsd.org]; RWL_MAILSPIKE_POSSIBLE(0.00)[98.137.68.84:from]; MID_RHS_MATCH_FROM(0.00)[]; RCVD_VIA_SMTP_AUTH(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[98.137.68.84:from] X-Rspamd-Queue-Id: 4fhgF25948z3lYV X-Spamd-Bar: --- On 3/26/26 13:59, Mark Millard wrote: > On 3/26/26 12:05, Pat Maddox wrote: >> On Thu, Mar 26, 2026, at 9:52 AM, Mark Millard wrote: >>> On 3/26/26 04:30, polyduekes@proton.me wrote: >>>> On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wrote: >>>> >>>>> polyduekes@proton.me wrote in : >>>>>> is needing to do both buildworld and buildkernel to create a pkg repo >>>>>> the intended behaviour or is that planned to change >>>>> >>>>> right now i don't believe there are any plans to change that. i suppose >>>>> it might change in the future. usually people want to build both the >>>>> world and the kernel, so this isn't an oft-requested feature. >>>>> >>>>> could you elaborate on why you want to build world but not kernel? >>>>> this would help inform development efforts in that area. >>>>> >>>> i usually make my own changes to base code to test some things and learn a few others,and most of the time the changes i make touch only world and dont touch kernel at all,so i like to avoid unnecessary compilation of the binaries and things i didn't change and doing only make buildworld and not make buildkernel buildworld is part of that reason >>> >>> Are you aware of META_MODE for buildworld and buildkernel (with its use >>> of filemon.ko)? Its purpose is to keep track of things and so generally >>> rebuild what is necessary but avoid rebuilding what is not. For example, >>> back to back rebuilds have the second one not taking very long based on >>> the lack of changes. >> >> How long is "not very long" in your experience? > > I happen to have been doing builds as part of a long overdue update of > my context. The below builds were executed from an official pkgbase > distribution of main that was booted, using the non-debug kernel that > was distributed. (Only a debug world is distributed for main.) But I was > building non-debug worlds and kernels of nearly the same source code, > with other tailoring involved, such as static linking of the llvm > related toolchain. > > I've access to a wide range of system performance, from old armv7 RPi*'s > to a 7950X3D amd64 system with Optane 1.4T media on PCIe. > > First picking an aarch64 system likely slow compared to common amd64 > hardware, but faster than a RP* aarch64 system, showing both > from-scratch build time and then the rebuild, not having changed > anything, showing both World and Kernel. . . > > Microsoft Dev Kit 2023 from-scratch build sequence, USB3 based media, 8 > core, 32 GiByTes of RAM: (I have reordered lines to have the world's > together and the kernels together and used extra end-of-lines to group > things and some leading spaces to avoid misformatting) > > # grep "built.*ncpu:" > /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-*.2026-03-2[56]* > > /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-25:23:12:00: > >>> World built in 10909 seconds, ncpu: 8, make -j12 > /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-26:13:04:35: > >>> World built in 146 seconds, ncpu: 8, make -j12 > > /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-26:02:13:50: > >>> Kernel(s) GENERIC-NODBG-CA76 built in 632 seconds, ncpu: 8, make -j12 > /usr/obj/BUILDs/main-CA76-nodbg-clang/sys-typescripts/typescript-make-main-CA76-nodbg-clang.aarch64-host.2026-03-26:13:07:02: > >>> Kernel(s) GENERIC-NODBG-CA76 built in 11 seconds, ncpu: 8, make -j12 > > > A faster system . . . > > amd64 7950X3D with Optane 1.4T media on PCIe, 32 freebsd CPUs (16 SMT > cores);, 192 GiBytes of RAM: > > # grep 'built.*ncpu:' > /usr/obj/BUILDs/main-ZNV4-*-clang/sys-typescripts/typescript-make-ZNV4-*-clang-amd64-host-2026-03-2[56]* > > /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-25:15:50:07: > >>> World built in 1048 seconds, ncpu: 32, make -j48 > /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-26:13:10:20: > >>> World built in 34 seconds, ncpu: 32, make -j48 > > /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-25:15:47:41: > >>> Kernel(s) GENERIC-NODBG built in 91 seconds, ncpu: 32, make -j48 > /usr/obj/BUILDs/main-ZNV4-nodbg-clang/sys-typescripts/typescript-make-ZNV4-nodbg-clang-amd64-host-2026-03-26:13:10:54: > >>> Kernel(s) GENERIC-NODBG built in 2 seconds, ncpu: 32, make -j48 > > > So the example ratios span: > 10909/146 approx.= 74.7 > 1048/34 approx.= 30.8 I should have pointed out that back-to-back builds (no changes) have the 2nd build being about as fast as it can get: otherwise changes lead to more being rebuilt. Even back to back builds [no changes] do some build/linking activity. It is difficult to make everything perfectly minimal while always rebuilding when it is important. For some aspects there are tradeoffs for false positive vs. false negative handling for things not likely to actually need a rebuild. For the most part, where possible, the bias has been for uncertainty to lead to some rebuild activity that might not have been necessary --instead of having potential broken builds. An example context is: buildworld reboot installworld reboot buildworld The install activity leads to more rebuild activity later --from the install updating programs (and other files) to be technically newer than they were during the prior buildworld, despite lack of changes in those files that might be relevant to worrying about the program results being different for the use in the build sequence. For example, if echo contributed to a file's content (say, via >> use), how likely is it that an updated echo's output would be any different for that file in the rebuild? Arbitrary changes touching common usage results is unlikely for something like echo at this point. > > I'll not get into the details of my builds. The builds are personal > builds in various ways. > >> >> Pat >> >> > > Note: I'm not set up to send to freebsd-questions. > -- === Mark Millard marklmi at yahoo.com From nobody Fri Mar 27 12:12:36 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fj00226ZTz6W5DF; Fri, 27 Mar 2026 12:12:50 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fj0021Pv1z3pDC; Fri, 27 Mar 2026 12:12:50 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774613570; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=3eA3QnsMiMkZq5nhnZSM/G/gudGuIj77tTHZ/lmjyHs=; b=sUqfrKnRhFmwzpZSRtZdK6QnsAcKCm0eLYT746E5wBWNMJ+w8FyIUJhu6G+e8SKYm0LUE0 ZvAQNJshy1MmuSg3xzYbA2U/vo8LBC3ajyhrNbjOySww/4Gk9Bn9+SgrLecSwBEMv5iizV XNmZ9fAlygHc9vTxKZQClu6sGscdZTrdwNZWNN4oR96ZKrGkl+F2t9LLeK6JzlPH1SuANT DzNJVcCNPHQRVmjE7jPuhKeWZKnzjbA6dHKNwsUQptan0Auxdn+Vg8x3akquZtJ91k1ymQ DjV8fcqTi9ITd5RfQo8UTXHY8+nPGEBGwnRYTFYi5R4mjR7rQXtP2UOw/5Lrvw== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774613570; a=rsa-sha256; cv=none; b=f2/+s2WEMYCz1KlIrRmAaO853ftVVmWWryUUu8l6WbWBh3PDX4mPJ4BjMIFvCJ5TG3izYd Cx4GKydSNqS87yDjeFGwB5NMe9k0ri6EAGa/qmXaZ27f31Y15vW9YO1d1P+Lt7o/Lev4LP usTAip0eXCmtK8k+8rjW22IRVqmzD+9ymAvJjHewrXPznZ7PfnjQBGnFRfp2OL01OoRAZ7 cLU1bhu60bjBzja4tUolfVPrTBDyePKc39ib9MRPaBugX4mHWaBgA6HtxrDetHApd5wlAR rYPKEi0Tmjpbj2/RzAvqRoRIzS0bG2f0XPX5i1eb5q23DrMOzCDidyl35fDTtg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774613570; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=3eA3QnsMiMkZq5nhnZSM/G/gudGuIj77tTHZ/lmjyHs=; b=ezo0c0MGP/yFN/DW2SDbyIR0GYDY+ehZXLqm0bZm5zvmetq57qrgp2bz+TDp4v3+a+2Q7R xGtfZBNhEbiKdWX9d2P/cEYwCq4tkLjIehcRbSsTDMZxfVT0M/ydjbpcbUCV4NKJmQvZWN 2wU9iGNU2jbyQIKQ23DWMcufkJTgqaXCod009kcOZn+upz1cy78IvGD4/ZMVG5Bxx1XI1J A9MvKM44e81kXNAfUZnCHlIAgTI325AZxbBO23I9B5LIKhX2RW+UiVEUVDJKUhz+133rF8 Jp2FERlDZQrs8rrla1paKi+ZOeSh6tkk9Xww8Nwkh75sTCt3aB+gNHipWpfCzw== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fj0015DRJzsFj; Fri, 27 Mar 2026 12:12:49 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Fri, 27 Mar 2026 12:12:36 +0000 From: Lexi Winter To: freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org Subject: Re: more pkgbase reviewers required Message-ID: Mail-Followup-To: freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org References: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="KFOw1Hgs2DMSMraI" Content-Disposition: inline In-Reply-To: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> --KFOw1Hgs2DMSMraI Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable list_freebsd@bluerosetech.com wrote in <5990d939-a3a0-403b-e419-949043559c0= f@bluerosetech.com>: > On 2026-03-25 5:54, Lexi Winter wrote: > > at this point, it's extremely difficult to get any pkgbase-related > > changes reviewed in Phabricator, which is an issue since we're now > > pushing pkgbase as the default method for installing the system. >=20 > What is the current state of FreeBSD dogfooding pkgbase? as far as i'm aware, no cluster machines are currently using pkgbase. based on bug reports, i'd say a reasonable number of developers are using pkgbase on their development systems, but this is probably significantly less than a majority of developers. --KFOw1Hgs2DMSMraI Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacZ0MQAKCRD1nT63mIK/ YMI1AQDwtG+s1aZTEIphwbQgpM21jrye/bzAHmwTzLXmrHiCbQD+NlI6ef7drKWU zdftHA7q6v48rU/E6EcCSJmxV0jaJgw= =F+ls -----END PGP SIGNATURE----- --KFOw1Hgs2DMSMraI-- From nobody Fri Mar 27 12:12:36 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fj00226ZTz6W5DF; Fri, 27 Mar 2026 12:12:50 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fj0021Pv1z3pDC; Fri, 27 Mar 2026 12:12:50 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774613570; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=3eA3QnsMiMkZq5nhnZSM/G/gudGuIj77tTHZ/lmjyHs=; b=sUqfrKnRhFmwzpZSRtZdK6QnsAcKCm0eLYT746E5wBWNMJ+w8FyIUJhu6G+e8SKYm0LUE0 ZvAQNJshy1MmuSg3xzYbA2U/vo8LBC3ajyhrNbjOySww/4Gk9Bn9+SgrLecSwBEMv5iizV XNmZ9fAlygHc9vTxKZQClu6sGscdZTrdwNZWNN4oR96ZKrGkl+F2t9LLeK6JzlPH1SuANT DzNJVcCNPHQRVmjE7jPuhKeWZKnzjbA6dHKNwsUQptan0Auxdn+Vg8x3akquZtJ91k1ymQ DjV8fcqTi9ITd5RfQo8UTXHY8+nPGEBGwnRYTFYi5R4mjR7rQXtP2UOw/5Lrvw== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774613570; a=rsa-sha256; cv=none; b=f2/+s2WEMYCz1KlIrRmAaO853ftVVmWWryUUu8l6WbWBh3PDX4mPJ4BjMIFvCJ5TG3izYd Cx4GKydSNqS87yDjeFGwB5NMe9k0ri6EAGa/qmXaZ27f31Y15vW9YO1d1P+Lt7o/Lev4LP usTAip0eXCmtK8k+8rjW22IRVqmzD+9ymAvJjHewrXPznZ7PfnjQBGnFRfp2OL01OoRAZ7 cLU1bhu60bjBzja4tUolfVPrTBDyePKc39ib9MRPaBugX4mHWaBgA6HtxrDetHApd5wlAR rYPKEi0Tmjpbj2/RzAvqRoRIzS0bG2f0XPX5i1eb5q23DrMOzCDidyl35fDTtg== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774613570; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=3eA3QnsMiMkZq5nhnZSM/G/gudGuIj77tTHZ/lmjyHs=; b=ezo0c0MGP/yFN/DW2SDbyIR0GYDY+ehZXLqm0bZm5zvmetq57qrgp2bz+TDp4v3+a+2Q7R xGtfZBNhEbiKdWX9d2P/cEYwCq4tkLjIehcRbSsTDMZxfVT0M/ydjbpcbUCV4NKJmQvZWN 2wU9iGNU2jbyQIKQ23DWMcufkJTgqaXCod009kcOZn+upz1cy78IvGD4/ZMVG5Bxx1XI1J A9MvKM44e81kXNAfUZnCHlIAgTI325AZxbBO23I9B5LIKhX2RW+UiVEUVDJKUhz+133rF8 Jp2FERlDZQrs8rrla1paKi+ZOeSh6tkk9Xww8Nwkh75sTCt3aB+gNHipWpfCzw== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fj0015DRJzsFj; Fri, 27 Mar 2026 12:12:49 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Fri, 27 Mar 2026 12:12:36 +0000 From: Lexi Winter To: freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org Subject: Re: more pkgbase reviewers required Message-ID: Mail-Followup-To: freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org References: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="KFOw1Hgs2DMSMraI" Content-Disposition: inline In-Reply-To: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> --KFOw1Hgs2DMSMraI Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable list_freebsd@bluerosetech.com wrote in <5990d939-a3a0-403b-e419-949043559c0= f@bluerosetech.com>: > On 2026-03-25 5:54, Lexi Winter wrote: > > at this point, it's extremely difficult to get any pkgbase-related > > changes reviewed in Phabricator, which is an issue since we're now > > pushing pkgbase as the default method for installing the system. >=20 > What is the current state of FreeBSD dogfooding pkgbase? as far as i'm aware, no cluster machines are currently using pkgbase. based on bug reports, i'd say a reasonable number of developers are using pkgbase on their development systems, but this is probably significantly less than a majority of developers. --KFOw1Hgs2DMSMraI Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacZ0MQAKCRD1nT63mIK/ YMI1AQDwtG+s1aZTEIphwbQgpM21jrye/bzAHmwTzLXmrHiCbQD+NlI6ef7drKWU zdftHA7q6v48rU/E6EcCSJmxV0jaJgw= =F+ls -----END PGP SIGNATURE----- --KFOw1Hgs2DMSMraI-- From nobody Fri Mar 27 18:40:19 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fj8bY3jltz6WFyT; Fri, 27 Mar 2026 18:40:41 +0000 (UTC) (envelope-from brd@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fj8bY3G1Wz3dfF; Fri, 27 Mar 2026 18:40:41 +0000 (UTC) (envelope-from brd@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774636841; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=TAZPgY4sVtqXqFs1skdW9BdaHxi2pdsqT6gkAmcXjmo=; b=DgL5EJaCUozIoF8hXXS9EsjhhdyYqdRqgmYALg74aiOwjPH7BBc/4YJjf3w9Nb2IbRMxwY XzUbQ/jwFxV2LGQbJ6h5UzTyVF2Xhw0MVOpH76vXM89TmAtY5+QjS7jq8fBqONA530pbSt rmFPdo2dmV8U4K8FFmCB5bwIUKa/BxWI5JqJYxthoYNLJdsthlLAjOWEvZMCArrkMxEM5s RAqM4XfXeupPE1xAu/pWmvdB/MYD5M4pHyXJcARBfysY6wzXDkt4mmnX49khcUBBKXqovK b+xO8BMNCoV8shMZJZQ/U7jRnUUotLSCzfh8GRl5o4qvtb4DJvR23eJFyEQA+w== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774636841; a=rsa-sha256; cv=none; b=PMkihiOEblGoL+yyPEaeM2lVEp/0WOTqPW17l6Q+e8KhVnKW1Uw6PuQvK0+B6Ttvb3h7Xk PljMePl7MTy4wyItN4Gs8IIxKuu8w6q0LFS9vvsIu5t3DPzSJR8/7yITRFsOfXKEzUGb9/ RrUbN78ThVN/3HQ7Ofa6m7X8msxw8l/0hnJgvRhW6WhHlbL6PTLX35vG/Xphm6JGgpUirr VKEbP0roeXlYWTxgjjf8AAC/FxDYd9KgttMrRyTEsAp8/+THDcTLrgYhRjXWAliBYqOTr5 zme0PA9C5MxRubktki1opfCy93qcXaBWxFPMxECpcDw+HY2RvHrnsLZHi/gHKA== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774636841; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=TAZPgY4sVtqXqFs1skdW9BdaHxi2pdsqT6gkAmcXjmo=; b=ttKqVeB8+8yfuVjtUbXI1y+dw1pDwAJE660mFEQnJDyA2cQbdeOpZ+SmpLFVaNXLzFnj91 AxCAAojltCOtEpaXLWld40EilY9kkrtoJZ1Qnbow7wuKU81UUiyZ+LR5y8FXXFdTLyF+gZ fkiTbNVnKEtfUfubOO2jQw7RJ4Zhsb7q8x0eES4ZDI8Pn1ioU6QynUhXSaHWAMv3CpYntR 4Z7I4wKA/VkU9gAQvR+U3b49mpuDvAcFspcnFLQb/4cNldeyvrHzvjNvex4CFeSUHfjPsD Bub7+OnaW5t1f+AKaYFE0FZzaPCcsHz4wzCWi86TpVGfQS6kOwR7gR6oG0PQRA== Received: from fauth-a2-smtp.messagingengine.com (fauth-a2-smtp.messagingengine.com [103.168.172.201]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: brd/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fj8bY1rzRz13xW; Fri, 27 Mar 2026 18:40:41 +0000 (UTC) (envelope-from brd@FreeBSD.org) Received: from phl-compute-02.internal (phl-compute-02.internal [10.202.2.42]) by mailfauth.phl.internal (Postfix) with ESMTP id AB334F40074; Fri, 27 Mar 2026 14:40:40 -0400 (EDT) Received: from phl-imap-02 ([10.202.2.81]) by phl-compute-02.internal (MEProxy); Fri, 27 Mar 2026 14:40:40 -0400 X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefgedrtddtgdeffedutddvucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfurfetoffkrfgpnffqhgenuceu rghilhhouhhtmecufedttdenucenucfjughrpefoggffhffvkfgjfhfutgfgsehtjeertd ertddtnecuhfhrohhmpedfuehrrgguucffrghvihhsfdcuoegsrhgusefhrhgvvgeuufff rdhorhhgqeenucggtffrrghtthgvrhhnpedvjeeiteejfeeivdelvdeiteduudduvdegge eggeeuffdvtdeuteekhfdttefhheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgr mhepmhgrihhlfhhrohhmpegsrhgrugdomhgvshhmthhprghuthhhphgvrhhsohhnrghlih hthidqjedtjeeifedvfedvqddukedtieelieekkedqsghrugeppefhrhgvvgeuufffrdho rhhgsegsrhgruggurghvihhsrdhiohdpnhgspghrtghpthhtohepgedpmhhouggvpehsmh htphhouhhtpdhrtghpthhtohepfhhrvggvsghsugdqphhkghgsrghsvgesfhhrvggvsghs ugdrohhrghdprhgtphhtthhopehhrggtkhgvrhhssehfrhgvvggsshgurdhorhhgpdhrtg hpthhtohepihhvhiesfhhrvggvsghsugdrohhrghdprhgtphhtthhopehpkhhgsggrshgv sehfrhgvvggsshgurdhorhhg X-ME-Proxy: Feedback-ID: if7394599:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 4A590700065; Fri, 27 Mar 2026 14:40:40 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 X-ThreadId: ARp2TeoknmQJ Date: Fri, 27 Mar 2026 12:40:19 -0600 From: "Brad Davis" To: "Lexi Winter" , freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org Message-Id: <191d2592-2800-4285-a5b0-8c0dda73c584@app.fastmail.com> In-Reply-To: References: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> Subject: Re: more pkgbase reviewers required Content-Type: text/plain Content-Transfer-Encoding: 7bit On Fri, Mar 27, 2026, at 6:12 AM, Lexi Winter wrote: > list_freebsd@bluerosetech.com wrote in > <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com>: >> On 2026-03-25 5:54, Lexi Winter wrote: >> > at this point, it's extremely difficult to get any pkgbase-related >> > changes reviewed in Phabricator, which is an issue since we're now >> > pushing pkgbase as the default method for installing the system. >> >> What is the current state of FreeBSD dogfooding pkgbase? > > as far as i'm aware, no cluster machines are currently using pkgbase. It is being slowly deployed within the cluster. Regards, Brad Davis From nobody Fri Mar 27 18:40:19 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fj8bY3jltz6WFyT; Fri, 27 Mar 2026 18:40:41 +0000 (UTC) (envelope-from brd@FreeBSD.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fj8bY3G1Wz3dfF; Fri, 27 Mar 2026 18:40:41 +0000 (UTC) (envelope-from brd@FreeBSD.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774636841; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=TAZPgY4sVtqXqFs1skdW9BdaHxi2pdsqT6gkAmcXjmo=; b=DgL5EJaCUozIoF8hXXS9EsjhhdyYqdRqgmYALg74aiOwjPH7BBc/4YJjf3w9Nb2IbRMxwY XzUbQ/jwFxV2LGQbJ6h5UzTyVF2Xhw0MVOpH76vXM89TmAtY5+QjS7jq8fBqONA530pbSt rmFPdo2dmV8U4K8FFmCB5bwIUKa/BxWI5JqJYxthoYNLJdsthlLAjOWEvZMCArrkMxEM5s RAqM4XfXeupPE1xAu/pWmvdB/MYD5M4pHyXJcARBfysY6wzXDkt4mmnX49khcUBBKXqovK b+xO8BMNCoV8shMZJZQ/U7jRnUUotLSCzfh8GRl5o4qvtb4DJvR23eJFyEQA+w== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774636841; a=rsa-sha256; cv=none; b=PMkihiOEblGoL+yyPEaeM2lVEp/0WOTqPW17l6Q+e8KhVnKW1Uw6PuQvK0+B6Ttvb3h7Xk PljMePl7MTy4wyItN4Gs8IIxKuu8w6q0LFS9vvsIu5t3DPzSJR8/7yITRFsOfXKEzUGb9/ RrUbN78ThVN/3HQ7Ofa6m7X8msxw8l/0hnJgvRhW6WhHlbL6PTLX35vG/Xphm6JGgpUirr VKEbP0roeXlYWTxgjjf8AAC/FxDYd9KgttMrRyTEsAp8/+THDcTLrgYhRjXWAliBYqOTr5 zme0PA9C5MxRubktki1opfCy93qcXaBWxFPMxECpcDw+HY2RvHrnsLZHi/gHKA== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774636841; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=TAZPgY4sVtqXqFs1skdW9BdaHxi2pdsqT6gkAmcXjmo=; b=ttKqVeB8+8yfuVjtUbXI1y+dw1pDwAJE660mFEQnJDyA2cQbdeOpZ+SmpLFVaNXLzFnj91 AxCAAojltCOtEpaXLWld40EilY9kkrtoJZ1Qnbow7wuKU81UUiyZ+LR5y8FXXFdTLyF+gZ fkiTbNVnKEtfUfubOO2jQw7RJ4Zhsb7q8x0eES4ZDI8Pn1ioU6QynUhXSaHWAMv3CpYntR 4Z7I4wKA/VkU9gAQvR+U3b49mpuDvAcFspcnFLQb/4cNldeyvrHzvjNvex4CFeSUHfjPsD Bub7+OnaW5t1f+AKaYFE0FZzaPCcsHz4wzCWi86TpVGfQS6kOwR7gR6oG0PQRA== Received: from fauth-a2-smtp.messagingengine.com (fauth-a2-smtp.messagingengine.com [103.168.172.201]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: brd/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fj8bY1rzRz13xW; Fri, 27 Mar 2026 18:40:41 +0000 (UTC) (envelope-from brd@FreeBSD.org) Received: from phl-compute-02.internal (phl-compute-02.internal [10.202.2.42]) by mailfauth.phl.internal (Postfix) with ESMTP id AB334F40074; Fri, 27 Mar 2026 14:40:40 -0400 (EDT) Received: from phl-imap-02 ([10.202.2.81]) by phl-compute-02.internal (MEProxy); Fri, 27 Mar 2026 14:40:40 -0400 X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefgedrtddtgdeffedutddvucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfurfetoffkrfgpnffqhgenuceu rghilhhouhhtmecufedttdenucenucfjughrpefoggffhffvkfgjfhfutgfgsehtjeertd ertddtnecuhfhrohhmpedfuehrrgguucffrghvihhsfdcuoegsrhgusefhrhgvvgeuufff rdhorhhgqeenucggtffrrghtthgvrhhnpedvjeeiteejfeeivdelvdeiteduudduvdegge eggeeuffdvtdeuteekhfdttefhheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgr mhepmhgrihhlfhhrohhmpegsrhgrugdomhgvshhmthhprghuthhhphgvrhhsohhnrghlih hthidqjedtjeeifedvfedvqddukedtieelieekkedqsghrugeppefhrhgvvgeuufffrdho rhhgsegsrhgruggurghvihhsrdhiohdpnhgspghrtghpthhtohepgedpmhhouggvpehsmh htphhouhhtpdhrtghpthhtohepfhhrvggvsghsugdqphhkghgsrghsvgesfhhrvggvsghs ugdrohhrghdprhgtphhtthhopehhrggtkhgvrhhssehfrhgvvggsshgurdhorhhgpdhrtg hpthhtohepihhvhiesfhhrvggvsghsugdrohhrghdprhgtphhtthhopehpkhhgsggrshgv sehfrhgvvggsshgurdhorhhg X-ME-Proxy: Feedback-ID: if7394599:Fastmail Received: by mailuser.phl.internal (Postfix, from userid 501) id 4A590700065; Fri, 27 Mar 2026 14:40:40 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 X-ThreadId: ARp2TeoknmQJ Date: Fri, 27 Mar 2026 12:40:19 -0600 From: "Brad Davis" To: "Lexi Winter" , freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org Message-Id: <191d2592-2800-4285-a5b0-8c0dda73c584@app.fastmail.com> In-Reply-To: References: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> Subject: Re: more pkgbase reviewers required Content-Type: text/plain Content-Transfer-Encoding: 7bit On Fri, Mar 27, 2026, at 6:12 AM, Lexi Winter wrote: > list_freebsd@bluerosetech.com wrote in > <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com>: >> On 2026-03-25 5:54, Lexi Winter wrote: >> > at this point, it's extremely difficult to get any pkgbase-related >> > changes reviewed in Phabricator, which is an issue since we're now >> > pushing pkgbase as the default method for installing the system. >> >> What is the current state of FreeBSD dogfooding pkgbase? > > as far as i'm aware, no cluster machines are currently using pkgbase. It is being slowly deployed within the cluster. Regards, Brad Davis From nobody Sat Mar 28 01:29:55 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fjq963WYmz6WdkZ; Sat, 28 Mar 2026 20:38:34 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Received: from echo.brtsvcs.net (echo.brtsvcs.net [208.111.40.118]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fjq950bF0z3KMH; Sat, 28 Mar 2026 20:38:33 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of list_freebsd@bluerosetech.com designates 208.111.40.118 as permitted sender) smtp.mailfrom=list_freebsd@bluerosetech.com Received: from chombo.houseloki.net (chombo [65.100.43.2]) by echo.brtsvcs.net (Postfix) with ESMTPS id 7F9EA1258D3; Sat, 28 Mar 2026 01:29:56 +0000 (UTC) Received: from [10.26.25.100] (ivy.pas.ds.pilgrimaccounting.com [10.26.25.100]) by chombo.houseloki.net (Postfix) with ESMTPSA id DFE8B30AC; Fri, 27 Mar 2026 18:29:55 -0700 (PDT) Message-ID: <3ccd3452-db13-63cb-5817-cf52695e064c@bluerosetech.com> Date: Fri, 27 Mar 2026 18:29:55 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.15.1 Subject: Re: more pkgbase reviewers required To: Brad Davis , Lexi Winter , freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org References: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> <191d2592-2800-4285-a5b0-8c0dda73c584@app.fastmail.com> Content-Language: en-US From: list_freebsd@bluerosetech.com In-Reply-To: <191d2592-2800-4285-a5b0-8c0dda73c584@app.fastmail.com> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-2.86 / 15.00]; NEURAL_HAM_LONG(-1.00)[-0.998]; NEURAL_HAM_MEDIUM(-0.99)[-0.987]; NEURAL_HAM_SHORT(-0.58)[-0.578]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; ASN(0.00)[asn:36236, ipnet:208.111.40.0/24, country:US]; MIME_TRACE(0.00)[0:+]; FROM_NO_DN(0.00)[]; TO_DN_SOME(0.00)[]; RCVD_TLS_ALL(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-pkgbase@freebsd.org,hackers@freebsd.org,pkgbase@freebsd.org]; RCVD_COUNT_TWO(0.00)[2]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; DMARC_NA(0.00)[bluerosetech.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCPT_COUNT_FIVE(0.00)[5] X-Rspamd-Queue-Id: 4fjq950bF0z3KMH X-Spamd-Bar: -- On 2026-03-27 11:40, Brad Davis wrote: > On Fri, Mar 27, 2026, at 6:12 AM, Lexi Winter wrote: >> list_freebsd@bluerosetech.com wrote in >> <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com>: >>> On 2026-03-25 5:54, Lexi Winter wrote: >>>> at this point, it's extremely difficult to get any pkgbase-related >>>> changes reviewed in Phabricator, which is an issue since we're now >>>> pushing pkgbase as the default method for installing the system. >>> >>> What is the current state of FreeBSD dogfooding pkgbase? >> >> as far as i'm aware, no cluster machines are currently using pkgbase. > > It is being slowly deployed within the cluster. That's good news. Features like pkgbase are a non-starter otherwise. From nobody Sat Mar 28 01:29:55 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fjq963WYmz6WdkZ; Sat, 28 Mar 2026 20:38:34 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Received: from echo.brtsvcs.net (echo.brtsvcs.net [208.111.40.118]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4fjq950bF0z3KMH; Sat, 28 Mar 2026 20:38:33 +0000 (UTC) (envelope-from list_freebsd@bluerosetech.com) Authentication-Results: mx1.freebsd.org; dkim=none; dmarc=none; spf=pass (mx1.freebsd.org: domain of list_freebsd@bluerosetech.com designates 208.111.40.118 as permitted sender) smtp.mailfrom=list_freebsd@bluerosetech.com Received: from chombo.houseloki.net (chombo [65.100.43.2]) by echo.brtsvcs.net (Postfix) with ESMTPS id 7F9EA1258D3; Sat, 28 Mar 2026 01:29:56 +0000 (UTC) Received: from [10.26.25.100] (ivy.pas.ds.pilgrimaccounting.com [10.26.25.100]) by chombo.houseloki.net (Postfix) with ESMTPSA id DFE8B30AC; Fri, 27 Mar 2026 18:29:55 -0700 (PDT) Message-ID: <3ccd3452-db13-63cb-5817-cf52695e064c@bluerosetech.com> Date: Fri, 27 Mar 2026 18:29:55 -0700 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.15.1 Subject: Re: more pkgbase reviewers required To: Brad Davis , Lexi Winter , freebsd-pkgbase@freebsd.org, hackers@freebsd.org, pkgbase@freebsd.org References: <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com> <191d2592-2800-4285-a5b0-8c0dda73c584@app.fastmail.com> Content-Language: en-US From: list_freebsd@bluerosetech.com In-Reply-To: <191d2592-2800-4285-a5b0-8c0dda73c584@app.fastmail.com> Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-2.86 / 15.00]; NEURAL_HAM_LONG(-1.00)[-0.998]; NEURAL_HAM_MEDIUM(-0.99)[-0.987]; NEURAL_HAM_SHORT(-0.58)[-0.578]; R_SPF_ALLOW(-0.20)[+mx]; MIME_GOOD(-0.10)[text/plain]; RCVD_VIA_SMTP_AUTH(0.00)[]; ARC_NA(0.00)[]; ASN(0.00)[asn:36236, ipnet:208.111.40.0/24, country:US]; MIME_TRACE(0.00)[0:+]; FROM_NO_DN(0.00)[]; TO_DN_SOME(0.00)[]; RCVD_TLS_ALL(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-pkgbase@freebsd.org,hackers@freebsd.org,pkgbase@freebsd.org]; RCVD_COUNT_TWO(0.00)[2]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; DMARC_NA(0.00)[bluerosetech.com]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCPT_COUNT_FIVE(0.00)[5] X-Rspamd-Queue-Id: 4fjq950bF0z3KMH X-Spamd-Bar: -- On 2026-03-27 11:40, Brad Davis wrote: > On Fri, Mar 27, 2026, at 6:12 AM, Lexi Winter wrote: >> list_freebsd@bluerosetech.com wrote in >> <5990d939-a3a0-403b-e419-949043559c0f@bluerosetech.com>: >>> On 2026-03-25 5:54, Lexi Winter wrote: >>>> at this point, it's extremely difficult to get any pkgbase-related >>>> changes reviewed in Phabricator, which is an issue since we're now >>>> pushing pkgbase as the default method for installing the system. >>> >>> What is the current state of FreeBSD dogfooding pkgbase? >> >> as far as i'm aware, no cluster machines are currently using pkgbase. > > It is being slowly deployed within the cluster. That's good news. Features like pkgbase are a non-starter otherwise. From nobody Sat Mar 28 22:32:39 2026 X-Original-To: pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fjsj04kbDz6X5kL for ; Sat, 28 Mar 2026 22:32:52 +0000 (UTC) (envelope-from adrian.chadd@gmail.com) Received: from mail-qk1-f179.google.com (mail-qk1-f179.google.com [209.85.222.179]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (2048 bits) client-digest SHA256) (Client CN "smtp.gmail.com", Issuer "WR4" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fjshz73jsz3WCC for ; Sat, 28 Mar 2026 22:32:51 +0000 (UTC) (envelope-from adrian.chadd@gmail.com) Authentication-Results: mx1.freebsd.org; dkim=none; arc=pass ("google.com:s=arc-20240605:i=1"); dmarc=fail reason="SPF not aligned (relaxed), No valid DKIM" header.from=freebsd.org (policy=none); spf=pass (mx1.freebsd.org: domain of adrian.chadd@gmail.com designates 209.85.222.179 as permitted sender) smtp.mailfrom=adrian.chadd@gmail.com Received: by mail-qk1-f179.google.com with SMTP id af79cd13be357-8d006a80ccbso432732785a.2 for ; Sat, 28 Mar 2026 15:32:51 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1774737171; cv=none; d=google.com; s=arc-20240605; b=WXTDPJXyloGbByiXiv7QMd4zPzYbMqBXU+RjmrEdaNWYEUHXfs5SovO5tO4+mkrx4v /dgB0+fZ9urNygXduEf+2Gz+AxJ3OvV68LLdi7LeDAfUlPLWH1v2LwM+LBmmWqSB4vQ2 Vk0L8BLt4DBohYnW+k7a7LW5h6rVBmwPvGEUOm0DTGA6+423g12X7mN7u6xiNGPeuduu rjtjuuVCqgrirRuXs9jIjrlFW0sl/BtGzjBO5zpQ6X/0bimnvdCbD7iMaVYmB94VF4a8 IZGmiVm7mbnRp4i/e7e/ygJw/rD+moPg8rdIMR7uPtfpPApC1jmyov2ONlS80VWzJ8CV WiuA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20240605; h=to:subject:message-id:date:from:in-reply-to:references:mime-version; bh=ZPjc4TCIWb5nhAW2ITr4E/C9o42SCSw1HEZN3ICFrkw=; fh=iWn0+fitJNmZ/iPE11foebHNgq6GpynI1kV9HfZ11n4=; b=kjzTuAiUlaxjZPK5sAL1bML2faSPHrsnDT8hZpZFBLFbPqA+RB2ASgSJ9Bs3f11dIv MR58Kek5jG1TJKnKj8vG8TlK9QgwgT90a4VUZjruaJLWEF4b90wwcvyDvAOjme3iQVbT ZNATPG3KJWh7+4skrhpKUdxuWwEHPA5WMcBYRX5JMtI6wxIeaGl23iFMCHdrFCAZD8Og 2qYfDr/5FK2U9bQo5LhFWNiPyUNRjTOeiTWwgQgwuHJU3sh2YOhZ8gpUjtlarU63tgi6 GcuSAiIS/Nz4G+KIt1RHYLZj4QcsrpqLDKxXmgPyI1uJfCkQWHldL6F9L7iQVmO1O+4t 5cOA==; darn=freebsd.org ARC-Authentication-Results: i=1; mx.google.com; arc=none X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20251104; t=1774737171; x=1775341971; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-gg:x-gm-message-state:from:to:cc:subject:date:message-id :reply-to; bh=ZPjc4TCIWb5nhAW2ITr4E/C9o42SCSw1HEZN3ICFrkw=; b=X9iRRoG+bpBw6ymmty3ATPg+DqYZ8Je1P/m8iZyyZIGEgvfgdDzujDlVXd2f5dtwdU N/LBYZ9dV25CVtvAOVdbPmWAb+KCEzEz6ftOcs2S7Iy7kpfww+X5kqHjpowVgcYLKz9o fnrm4vw4yPAUiTwK7imxrMbsBzd9JAUinyWjC7rK1SEtLTdSAVzP8TGCXsBXJ619ZWHR DnnKo4NXJf6wnLOt88dqyfzcT3QmJDjWxonIJXVNIf57oRLrtwKfr/PCvDUzYrV4Ajaw bt7FZSiJDMeaKaTeQeYFAys0FgIqzW8a35PGD6tsMB5CUzAEp2dnPVmRplXueMh//Tgh HzpQ== X-Forwarded-Encrypted: i=1; AJvYcCWhUZ/8xSEjYqGEVhyVeGLjE9NhKx5/dLq3320Rm94nkPB0l9UTTG2aGbhuYJz5IAcLf272e51Y@freebsd.org X-Gm-Message-State: AOJu0YwoIQyD7HcnfBJ/pZX/i8ZeBfhmoo2emtKmFpmpw3QcHpdzKXsZ psyCw+i04mS3aQ4SZl3/EncaJGz+zGh27olklIE8jHuzw24+zBEXpBHYQ3k8ZyPdUrbJCZb75Kf 3Gv54rBl5btn0AqB9XrM/qmg/LUr2BqoDug== X-Gm-Gg: ATEYQzwIaufVrggFA75ZJWv7D39G2qke0NVJ9x+L6yKwpuHyDZ9ceieAsYPW7mB/NWX 7Y5/efquMqenJwHTvpAGSs0id+elKsmTiyuDl/leDKBOVPzlebQtf1Z6dK3ebYPtm6oQYkNfrfN JcgdKdq2T7bbbWN/rJTnjYabAJulKgXA2WpA3M/hTdSOGKxSzLW34tV64W3FseG/voISUYS0zxH fASoFyIIfLePce7JCWB6BdtiJDU6o8iT6DlxYCWE1WfRyqSO1dOaF1gdv5qCrkZdOX0JaFk736g g85X89jJkDSN7TztBhH3f0Rq+KQi2SVUwErzu0niZdubjRIMkW8iD9WmJAsPtt9Xa9a19/hH4pA WYvukAA4KQ61NyTmy9tfChaF/gLY= X-Received: by 2002:a05:6214:5f85:b0:8a0:4780:a445 with SMTP id 6a1803df08f44-8a04780a8b6mr3220446d6.48.1774737170949; Sat, 28 Mar 2026 15:32:50 -0700 (PDT) List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 References: In-Reply-To: From: Adrian Chadd Date: Sat, 28 Mar 2026 15:32:39 -0700 X-Gm-Features: AQROBzDehIGoEuDrGtXiWrFmlvoargbD1lLqtC2I3VyZ1bNPn84HAmCZYBB-drQ Message-ID: Subject: Re: more pkgbase reviewers required To: hackers@freebsd.org, pkgbase@freebsd.org Content-Type: text/plain; charset="UTF-8" X-Spamd-Result: default: False [-1.77 / 15.00]; ARC_ALLOW(-1.00)[google.com:s=arc-20240605:i=1]; NEURAL_HAM_SHORT(-0.93)[-0.931]; FORGED_SENDER(0.30)[adrian@freebsd.org,adrianchadd@gmail.com]; R_SPF_ALLOW(-0.20)[+ip4:209.85.128.0/17:c]; NEURAL_SPAM_LONG(0.15)[0.153]; MIME_GOOD(-0.10)[text/plain]; DMARC_POLICY_SOFTFAIL(0.10)[freebsd.org : SPF not aligned (relaxed), No valid DKIM,none]; NEURAL_HAM_MEDIUM(-0.09)[-0.089]; RCVD_COUNT_ONE(0.00)[1]; RWL_MAILSPIKE_POSSIBLE(0.00)[209.85.222.179:from]; RCVD_TLS_LAST(0.00)[]; MISSING_XM_UA(0.00)[]; MIME_TRACE(0.00)[0:+]; ASN(0.00)[asn:15169, ipnet:209.85.128.0/17, country:US]; RCPT_COUNT_TWO(0.00)[2]; R_DKIM_NA(0.00)[]; TO_DN_NONE(0.00)[]; FROM_NEQ_ENVFROM(0.00)[adrian@freebsd.org,adrianchadd@gmail.com]; FROM_HAS_DN(0.00)[]; FREEMAIL_ENVFROM(0.00)[gmail.com]; TAGGED_FROM(0.00)[]; TO_MATCH_ENVRCPT_SOME(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[pkgbase@freebsd.org]; MLMMJ_DEST(0.00)[pkgbase@freebsd.org]; RCVD_IN_DNSWL_NONE(0.00)[209.85.222.179:from] X-Rspamd-Queue-Id: 4fjshz73jsz3WCC X-Spamd-Bar: - hi, I've added myself to pkgbase. I'm using it now on like a dozen random devices here ranging from a test laptop, a bunch of VMs, ppc64/ppc64le bare metal and my little router/gateway test bed rack. Thanks, -adrian On Wed, 25 Mar 2026 at 05:55, Lexi Winter wrote: > > hello, > > at this point, it's extremely difficult to get any pkgbase-related > changes reviewed in Phabricator, which is an issue since we're now > pushing pkgbase as the default method for installing the system. > > if you have some spare time to help with this, please consider adding > yourself to the #pkgbase project on Phabricator and helping with some > outstanding reviews. > > some examples of typical pkgbase reviews (some of which are now reviewed > since i complained about this elsewhere): > > https://reviews.freebsd.org/D55645 > https://reviews.freebsd.org/D55630 > https://reviews.freebsd.org/D54542 > https://reviews.freebsd.org/D54540 > https://reviews.freebsd.org/D54282 > > i appreciate that this sort of install/upgrade stuff is boring and > not sexy, but it is important to users, and it's difficult to find > any motivation to contribute to the project when no one else seems > to care. From nobody Sun Mar 29 18:00:29 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fkMcR1jHMz6X44W for ; Sun, 29 Mar 2026 18:00:39 +0000 (UTC) (envelope-from polyduekes@proton.me) Received: from mail-106103.protonmail.ch (mail-106103.protonmail.ch [79.135.106.103]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "protonmail.com", Issuer "R12" (verified OK)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fkMcN414Sz3Lx9; Sun, 29 Mar 2026 18:00:36 +0000 (UTC) (envelope-from polyduekes@proton.me) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=proton.me header.s=protonmail header.b="e6+/TTCT"; dmarc=pass (policy=quarantine) header.from=proton.me; spf=pass (mx1.freebsd.org: domain of polyduekes@proton.me designates 79.135.106.103 as permitted sender) smtp.mailfrom=polyduekes@proton.me DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=proton.me; s=protonmail; t=1774807233; x=1775066433; bh=CdKqqPUkKP/SZW/GX9saEezvnL2GHjuWRjC2Z2wEnb0=; h=Date:To:From:Cc:Subject:Message-ID:In-Reply-To:References: Feedback-ID:From:To:Cc:Date:Subject:Reply-To:Feedback-ID: Message-ID:BIMI-Selector; b=e6+/TTCTKdvAj0SthD3tIl9Nub4laiufGFFNqULEM58t3WKjEN92oLAEDuLvGxW4t XGzDQlAkUMSLs6vOT2c4j0CUXTIv6Jswz58lIGEJyKa9Kst/v5lzOhQWz+F3iELFsY LG5pl2K+w887QX/du9D/mThUGaYybEBJAxI5WbuY1mryEBCLCC1vnCI6M6uhQ7KtNv ey9DZ/bllY2nQnY6IEULftjGiHRXv4agVm0Sqgl+YtRPpMCl1mUsO1Fe9RQjeHURHA QRh3I+Kz81ITPecyZW1MAkkA7dh65X9vYuGIxjDJtcHxTlfO4/UKfw41l/DGKXPWKo Z/gNFTi3m5zRA== Date: Sun, 29 Mar 2026 18:00:29 +0000 To: Lexi Winter From: polyduekes@proton.me Cc: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Subject: Re: installing world from src on a pkgbase system Message-ID: In-Reply-To: References: Feedback-ID: 94987605:user:proton X-Pm-Message-ID: b9f0c22fd0fd95d510ebd7fb07b3a423966a6fa4 List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable X-Spamd-Result: default: False [-4.38 / 15.00]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_SHORT(-0.88)[-0.882]; DMARC_POLICY_ALLOW(-0.50)[proton.me,quarantine]; RWL_MAILSPIKE_EXCELLENT(-0.40)[79.135.106.103:from]; R_SPF_ALLOW(-0.20)[+ip4:79.135.106.0/24]; R_DKIM_ALLOW(-0.20)[proton.me:s=protonmail]; MIME_GOOD(-0.10)[text/plain]; RCVD_IN_DNSWL_LOW(-0.10)[79.135.106.103:from]; TO_DN_SOME(0.00)[]; ASN(0.00)[asn:62371, ipnet:79.135.106.0/24, country:CH]; FROM_NO_DN(0.00)[]; MIME_TRACE(0.00)[0:+]; MISSING_XM_UA(0.00)[]; RCVD_COUNT_ZERO(0.00)[0]; RCPT_COUNT_THREE(0.00)[3]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; TO_MATCH_ENVRCPT_SOME(0.00)[]; MID_RHS_MATCH_FROM(0.00)[]; MLMMJ_DEST(0.00)[freebsd-pkgbase@freebsd.org]; DKIM_TRACE(0.00)[proton.me:+] X-Rspamd-Queue-Id: 4fkMcN414Sz3Lx9 X-Spamd-Bar: ---- Sent with Proton Mail secure email. On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter wro= te: > polyduekes@proton.me wrote in : > > is needing to do both buildworld and buildkernel to create a pkg repo > > the intended behaviour or is that planned to change >=20 > right now i don't believe there are any plans to change that. i suppose what are your thoughts on the real-update-packages target,it looks it was c= reated for exactly my usecase(b44147bb12450bdf851a519d1cdc85402f89ed1f) although it seems it has been broken for a while(e4988ba172a84b35abab8ce065= f2210dab70f148) > it might change in the future. usually people want to build both the > world and the kernel, so this isn't an oft-requested feature. >=20 > could you elaborate on why you want to build world but not kernel? > this would help inform development efforts in that area. >=20 > > additionally may i ask why it's recommended to do 'make > > upodate-packages' over 'make packages' >=20 > 'update-packages' will copy unchanged packages from the previous build > to the current build, which means if only a small number of packages > have changed, the system won't try to update every package. > From nobody Sun Mar 29 18:52:28 2026 X-Original-To: freebsd-pkgbase@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4fkNmJ5JpCz6X97d; Sun, 29 Mar 2026 18:52:32 +0000 (UTC) (envelope-from ivy@freebsd.org) Received: from smtp.freebsd.org (smtp.freebsd.org [IPv6:2610:1c1:1:606c::24b:4]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256 client-signature RSA-PSS (4096 bits) client-digest SHA256) (Client CN "smtp.freebsd.org", Issuer "R13" (not verified)) by mx1.freebsd.org (Postfix) with ESMTPS id 4fkNmJ1vVXz3V4r; Sun, 29 Mar 2026 18:52:32 +0000 (UTC) (envelope-from ivy@freebsd.org) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774810352; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=8+z96NQOmeA09sQUYIcYIgllT3aDMc+Ai1dsdjCyG9s=; b=AdCxSqdb4646ksdRt5Rydken5Cysoig1mz6vIZvCayXAgAt0gKXDfagi/4x+Q1SPASvVRF hhHC/7gUD69pDkVUoI+D746XO052NhUzWJb3P3PUBSJhA2A6/P2ClokuyOj1EVC9qTGHMB 2ts/u7MoE2/VhYXLkTThw9yFB9W1yBtBjBwMtWlYDzAol9xyQjnhQ/YTqBBcsYlTlHx5oC 4kH1ZtYR3Z3b9HEzMpuKd/iptm3ofg0hTbtHPrQx0ZrZSMcvB0SkLF4/pgNSX7lq507Eg3 0Qfvsw8NnZy1RQl9/xsFl/uTWFYD3EbnJVS1pmzC4yuLG28WQuCQUzy8LR66Wg== ARC-Seal: i=1; s=dkim; d=freebsd.org; t=1774810352; a=rsa-sha256; cv=none; b=DtoF0NO0FxMy07gBG5t/NRbDwnutYdSO/PwH9LDLsYDFh2IUxoxuh8vmJeFj8B+qEKADPg EakphUuLG3Kkgtly9cBCByEBC+KYZ9/wBMz1BpeeIcwbAH/CjHTABAUlsoQ3zixa4yFb7r pj7V5oknDk8O2iPfb0r66qB5BTioqj2ErRhUh8z5K6MtxppcU5bE7it/V4mXqW6N7xKsM8 etzxEK1TP66WqV6+O99GcIKIJm7U4DGqDcvQv7ssYXDx5sJaamONfOh5bs3HKhVFD9iRnX 5v+Sc24WntQYl1oQlG/DE5fXXwU45HHTCAATI5fG6/5KUcUHo+uRLE2M+DuRbQ== ARC-Authentication-Results: i=1; mx1.freebsd.org; none ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=freebsd.org; s=dkim; t=1774810352; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:mime-version:mime-version:content-type:content-type: in-reply-to:in-reply-to:references:references; bh=8+z96NQOmeA09sQUYIcYIgllT3aDMc+Ai1dsdjCyG9s=; b=luGCt90TRLNTINdKF63xRr6b+CseCQy/WQFD5HYIvMvJUDoxAT5SjwDovE57db3p8XWkaP 5J1WBYxlHzdTag1HiUU0rEI/3iY5HFSP7yK7wdQf4rjM3R46t5q+fvy2jRmfmkqbySd3jq gN3n4U5l6c1B7rws6wnMkL1zEqhrUP6xqgbyW79rOEStZ94iLbTmUGSiEc7r9LpmVLODNq TeTHzGccCU8YDTfFaMEd9mZi1UXxuzKUXNLc9OGy46V4fmCjNhGWQfWz/f/wKoPpUz2hQw 2uBTp2UXgdNYfeOAxPAiNY/WTxz3vKlB/g7Hj+NIGXoFoagEQhnnxXFw24qYEg== Received: from amaryllis.le-fay.org (amaryllis.le-fay.org [IPv6:2a00:1098:6b:400::9]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (4096 bits) server-digest SHA256) (Client did not present a certificate) (Authenticated sender: ivy/mail) by smtp.freebsd.org (Postfix) with ESMTPSA id 4fkNmH5y7Cz18kG; Sun, 29 Mar 2026 18:52:31 +0000 (UTC) (envelope-from ivy@freebsd.org) Date: Sun, 29 Mar 2026 19:52:28 +0100 From: Lexi Winter To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org Subject: Re: installing world from src on a pkgbase system Message-ID: Mail-Followup-To: freebsd-pkgbase@freebsd.org, freebsd-questions@freebsd.org References: List-Id: Packaging the FreeBSD base system List-Archive: https://lists.freebsd.org/archives/freebsd-pkgbase List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-pkgbase@FreeBSD.org MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha512; protocol="application/pgp-signature"; boundary="3hDijt+0f6p8kNVd" Content-Disposition: inline In-Reply-To: --3hDijt+0f6p8kNVd Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable polyduekes@proton.me wrote in : > On Thursday, March 26th, 2026 at 3:26 AM, Lexi Winter w= rote: > > polyduekes@proton.me wrote in : > > > is needing to do both buildworld and buildkernel to create a pkg repo > > > the intended behaviour or is that planned to change > >=20 > > right now i don't believe there are any plans to change that. > what are your thoughts on the real-update-packages target, targets whose names begin with 'real' are generally intended for internal use by the build system and aren't supported for users. you might be able to use it for now, but there's a good chance it might vanish soon since i'm in the process of rewriting a lot of the pkgbase build system. my inclination is that the best way to solve this is by adding new src.conf options, WITHOUT_{KERNEL,WORLD}_PACKAGES, which could be used on the make(1) command line to build only some packages. this would not be particularly difficult to do. the alternatively would be something a more flexible option like SKIP_PACKAGES=3D'kernel'; that might be useful if people want to skip more things, like src or tests. --3hDijt+0f6p8kNVd Content-Type: application/pgp-signature; name=signature.asc -----BEGIN PGP SIGNATURE----- iHUEABYKAB0WIQSyjTg96lp3RifySyn1nT63mIK/YAUCacl06AAKCRD1nT63mIK/ YCYlAP9nbPasYomvnf1uYMt9IXEkRpzaeUg1JfbgwBVKXlGDBgEApYMIAJl1SxjF FFo1v3X5VDczlH1r8bI9uUkENUiEsAo= =EKw3 -----END PGP SIGNATURE----- --3hDijt+0f6p8kNVd--