From owner-freebsd-hackers@freebsd.org Fri Apr 10 07:09:35 2020 Return-Path: Delivered-To: freebsd-hackers@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 678E42B5048 for ; Fri, 10 Apr 2020 07:09:35 +0000 (UTC) (envelope-from mremski@comcast.net) Received: from resqmta-po-10v.sys.comcast.net (resqmta-po-10v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:169]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 48z8Jt1nbJz4vJk for ; Fri, 10 Apr 2020 07:09:34 +0000 (UTC) (envelope-from mremski@comcast.net) Received: from resomta-po-15v.sys.comcast.net ([96.114.154.239]) by resqmta-po-10v.sys.comcast.net with ESMTP id MnmdjAUFG2WZ8Mnn9jXhE3; Fri, 10 Apr 2020 07:09:31 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1586502571; bh=4iybX3Z7xB5WCUSr7Q21/EwTZOFeLo02IhsStVVNiIc=; h=Received:Received:From:To:Subject:Date:MIME-Version:Message-ID: Content-Type; b=28Ikp2WkWYpiKA2ljEj/s3fAuEwfjda/5x5zd3zXKeMqwkDcLd6o9u+xZYixw+I0o CHJwSjSHWNnghla2AT+EZ9UZRL+vchi4l891kGHrbdquMHWY1djyHSpWmrUUHyoFEq byncab07+czRCrto79xeiPnFaSoCoTFyPsogLkEV+8wByQYY9zxxppih59I3kq6Lqp jvAc46MyQtTG/Oj8zfR2hRuuoNHtOfw9hTwC5AuTUQ+cKG1LXeP/zWuRbaSJE98oyK x8tSAy9EjYW9A7DaliqUlDdbslOrINfQ1P1+/e7b+8aUaaO9zWk9kZH0r22mvTUV3G zVsiRvlGPMCEg== Received: from localhost ([75.68.96.21]) by resomta-po-15v.sys.comcast.net with ESMTPA id Mnn8jKy2nPHJRMnn9jsOm2; Fri, 10 Apr 2020 07:09:31 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduhedrvddugdduudegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffuffggkfgjfhgftgfgsehtqhertddtreejnecuhfhrohhmpefoihhkvgcutfgvmhhskhhiuceomhhrvghmshhkihestghomhgtrghsthdrnhgvtheqnecuffhomhgrihhnpegrrhhsthgvtghhnhhitggrrdgtohhmnecukfhppeejhedrieekrdeliedrvddunecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheplhhotggrlhhhohhsthdpihhnvghtpeejhedrieekrdeliedrvddupdhmrghilhhfrhhomhepmhhrvghmshhkihestghomhgtrghsthdrnhgvthdprhgtphhtthhopehfrhgvvggsshguqdhhrggtkhgvrhhssehfrhgvvggsshgurdhorhhg X-Xfinity-VMeta: sc=0.00;st=legit From: Mike Remski To: Subject: Re: Ars Technica article on FreeBSD new user experience Date: Fri, 10 Apr 2020 03:09:30 -0400 MIME-Version: 1.0 Message-ID: <9bc85f04-ed38-4d5a-bec3-551079cdcb2b@comcast.net> In-Reply-To: References: User-Agent: Trojita/0.7; Qt/5.13.2; xcb; AnyBSD4.4FreeBSD; Content-Type: text/plain; charset=utf-8; format=flowed Content-Transfer-Encoding: quoted-printable X-Rspamd-Queue-Id: 48z8Jt1nbJz4vJk X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=comcast.net header.s=20190202a header.b=28Ikp2Wk; dmarc=pass (policy=none) header.from=comcast.net; spf=pass (mx1.freebsd.org: domain of mremski@comcast.net designates 2001:558:fe16:19:96:114:154:169 as permitted sender) smtp.mailfrom=mremski@comcast.net X-Spamd-Result: default: False [0.00 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2001:558:fe16:19:96:114:154:0/112]; FREEMAIL_FROM(0.00)[comcast.net]; TO_DN_NONE(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[comcast.net:+]; DMARC_POLICY_ALLOW(-0.50)[comcast.net,none]; HFILTER_HELO_5(3.00)[resqmta-po-10v.sys.comcast.net]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; RECEIVED_SPAMHAUS_PBL(0.00)[21.96.68.75.khpj7ygk5idzvmvt5x4ziurxhy.zen.dq.spamhaus.net : 127.0.0.10]; ASN(0.00)[asn:7922, ipnet:2001:558::/29, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[comcast.net.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[comcast.net]; R_DKIM_ALLOW(-0.20)[comcast.net:s=20190202a]; NEURAL_HAM_MEDIUM(-1.00)[-0.996,0]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; IP_SCORE(0.00)[ipnet: 2001:558::/29(-0.47), asn: 7922(-0.64), country: US(-0.05)]; IP_SCORE_FREEMAIL(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; RCVD_IN_DNSWL_NONE(0.00)[9.6.1.0.4.5.1.0.4.1.1.0.6.9.0.0.9.1.0.0.6.1.e.f.8.5.5.0.1.0.0.2.list.dnswl.org : 127.0.5.0] X-BeenThere: freebsd-hackers@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: Technical Discussions relating to FreeBSD List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Fri, 10 Apr 2020 07:09:35 -0000 On Thursday, April 9, 2020 5:39:45 PM EDT, Rick Macklem wrote: > Ed Maste wrote: >> Jim Salter has an article in Ars Technica discussing his experience >> with FreeBSD 12.1 as a desktop: >> https://arstechnica.com/gadgets/2020/04/not-actually-linux-distro-review-f= reebsd-12-1-release/ >>=20 >> There are some points in there that might involve misunderstanding, >> but there are also a number of real issues raised about the experience ...= > Since this is a public mailing list, I'll repost here... > > One thought here that I'll throw out (I have no idea if others=20 > have suggested > this before)=E2=80=A6 > What about creating a separate release for desktops/laptops that installs > X Windows etc from a simple installer "out of the box"? > --> To keep it simple, don't try to support all hardware, just=20 > stuff that is widely > available and already well supported by the drivers in FreeBSD. > Obviously amd64 only plus a few widely available display=20 > chip sets that work > well, etc and so on... > > If it doesn't support the hardware someone has, then they can go the regula= r > release/install route. (It would be nice to maintain an up to=20 > date list of what > hardware it supports, but it might be easier to just have it=20 > start up live CD > style and then see if the hardware it needs is there. > --> Sorry, can't do this display chipset to that sound chip or... > > Just an idea, rick > ps: I am not volunteering to help do this. I run FreeBSD on laptop/desktop > systems, but bare bones. No X Windows... Something like what old PCBSD did? How about FuryBSD as a starting point? =20= Joe Maloney is layering either XFCE or KDE (2 different ISO/install media)=20= on top of a FreeBSD install, so out of the box, the install gives you=20 FreeBSD with either XFCE or KDE. Disclaimer: I've been using FreeBSD with X as a daily driver for a long=20 time and honestly never found it that difficult to set up. Hardest was=20 when everything started to need the drm-kmod bits, but once I understood=20 what I needed to do, it's not been an issue.