From owner-freebsd-ppc@freebsd.org Wed May 27 01:18:54 2020 Return-Path: Delivered-To: freebsd-ppc@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id BD0A02F9E50 for ; Wed, 27 May 2020 01:18:54 +0000 (UTC) (envelope-from corky1951@comcast.net) Received: from resqmta-po-01v.sys.comcast.net (resqmta-po-01v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:160]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 49WtJY52K0z4Jl3 for ; Wed, 27 May 2020 01:18:53 +0000 (UTC) (envelope-from corky1951@comcast.net) Received: from resomta-po-14v.sys.comcast.net ([96.114.154.238]) by resqmta-po-01v.sys.comcast.net with ESMTP id dkYPj3216cC7KdkiZjnxl5; Wed, 27 May 2020 01:18:51 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1590542331; bh=2uzX5l5MXtWV8XZ96NcubFDEWigIJtQvSAx8yoFzCdc=; h=Received:Received:Subject:From:To:Message-ID:Date:MIME-Version: Content-Type; b=mQ7A+d8X4+3vggW9yIxfkRuKHoL6090KZnsNKPN5cxYu9yenpMuMrdumrxzLnukFt kxP+Ziab4IigIrRYKqf517GMYlv6gsHb7+fSuf23Z9fwJqv2oMU8hnll4Nodd+arCR wcjg3D29u1lxhwZhAuuNHfGdBb2UD9x3A4O4QhLn+VuDmNDLuj23aC397LNWAINCtL NRC/i1cuPv/8a9ixl4W6/z3AAYbtfVE6Fgyzdme8Zq+M+IVXt7Zx4Za/obyYDIhtiL aENS2KllplSd368JSSQ+i6H56Haxy4Jsi42lf+6LsQX4VzysouI9mRCrSxBkASH7k+ RNFVq6zuKEDDg== Received: from [192.168.1.106] ([67.170.125.248]) by resomta-po-14v.sys.comcast.net with ESMTPA id dkiYjiMhugsj9dkiZjQBIB; Wed, 27 May 2020 01:18:51 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduhedruddvfedggeefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefuhffvfhfkffgfgggjtgfgsehtkeertddtfeejnecuhfhrohhmpeevhhgrrhhlihgvucfmvghsthgvrhcuoegtohhrkhihudelhedusegtohhmtggrshhtrdhnvghtqeenucggtffrrghtthgvrhhnpeeikeehleehieevvedtveefudduvdffuddtvefhteelueehvdehveekvdeivdekfeenucfkphepieejrddujedtrdduvdehrddvgeeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheplgduledvrdduieekrddurddutdeingdpihhnvghtpeeijedrudejtddruddvhedrvdegkedpmhgrihhlfhhrohhmpegtohhrkhihudelhedusegtohhmtggrshhtrdhnvghtpdhrtghpthhtohepfhhrvggvsghsugdqphhptgesfhhrvggvsghsugdrohhrghdprhgtphhtthhopegthhhmvggvvggurghlfhesghhmrghilhdrtghomh X-Xfinity-VMeta: sc=0.00;st=legit Subject: Re: Build failure of gmp-6.2.0 on Mac Mini G4 From: Charlie Kester To: Justin Hibbits Cc: freebsd-ppc@freebsd.org References: <18d93226-7cc6-4cef-1667-f05dea8770a3@comcast.net> <20200526194532.07d637bb@titan.knownspace> <83543ad1-48c9-cf6c-b24b-f47c249a1634@comcast.net> Message-ID: Date: Tue, 26 May 2020 18:18:50 -0700 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:68.0) Gecko/20100101 Thunderbird/68.8.1 MIME-Version: 1.0 In-Reply-To: <83543ad1-48c9-cf6c-b24b-f47c249a1634@comcast.net> Content-Type: text/plain; charset=utf-8; format=flowed Content-Language: en-US Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 49WtJY52K0z4Jl3 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=comcast.net header.s=20190202a header.b=mQ7A+d8X; dmarc=pass (policy=none) header.from=comcast.net; spf=pass (mx1.freebsd.org: domain of corky1951@comcast.net designates 2001:558:fe16:19:96:114:154:160 as permitted sender) smtp.mailfrom=corky1951@comcast.net X-Spamd-Result: default: False [-0.68 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; TO_DN_SOME(0.00)[]; FREEMAIL_FROM(0.00)[comcast.net]; R_SPF_ALLOW(-0.20)[+ip6:2001:558:fe16:19:96:114:154:0/112]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[comcast.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[comcast.net,none]; NEURAL_HAM_SHORT(-0.66)[-0.662]; HFILTER_HELO_5(3.00)[resqmta-po-01v.sys.comcast.net]; FREEMAIL_TO(0.00)[gmail.com]; RECEIVED_SPAMHAUS_PBL(0.00)[67.170.125.248:received]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; FREEMAIL_ENVFROM(0.00)[comcast.net]; ASN(0.00)[asn:7922, ipnet:2001:558::/29, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[comcast.net:dkim]; ARC_NA(0.00)[]; NEURAL_HAM_MEDIUM(-1.03)[-1.027]; R_DKIM_ALLOW(-0.20)[comcast.net:s=20190202a]; RCVD_TLS_LAST(0.00)[]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-0.99)[-0.989]; MIME_GOOD(-0.10)[text/plain]; TO_MATCH_ENVRCPT_SOME(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[2001:558:fe16:19:96:114:154:160:from] X-BeenThere: freebsd-ppc@freebsd.org X-Mailman-Version: 2.1.33 Precedence: list List-Id: Porting FreeBSD to the PowerPC List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Wed, 27 May 2020 01:18:54 -0000 On 5/26/20 6:00 PM, Charlie Kester wrote: > On 5/26/20 5:45 PM, Justin Hibbits wrote: >> On Tue, 26 May 2020 15:27:46 -0700 >> Charlie Kester wrote: >> >>> (This is a copy of email sent to the port maintainer.  Re-sending to >>> this list in case someone familiar with powerpc has already >>> encountered and resolved this issue.) >>> >>> >>> I'm trying to get FreeBSD running on an old Mac Mini and have hit a >>> snag with this port, which is a dependency of many others. >>> >>> The configure step fails with the following output (I don't have mail >>> running on the mini yet and am typing this on another machine, >>> so please disregard any typos.  blank lines = line breaks in output): >>> --------------------------------------------------------------------- >>> >>> ===> gmp-6.2.0 depends on file: /usr/local/bin/makeinfo - found >>> >>> ===> Configuring for gmp-6.2.0 >>> >>> checking build system type... invalid configuration >>> 'powerpc7447-unknown-freebsd12.1': machine 'powerpc7447-unknown' not >>> recognized >>> >>> configure: error: /bin/sh ./config.sub >>> powerpc7447-unknown-freebsd12.1 failed >>> >>> etc. >>> ---------------------------------------------------------------------- >>> I tried >>> # make configure CONFIGURE_ARGS=--build=powerpc7447 >>> and >>> # make configure CONFIGURE_TARGET=powerpc7447 >>> >>> Neither worked.  Same failure. >>> >>> Any suggestions on how I can resolve this issue? >> >> Where do you get powerpc7447?  The arch is 'powerpc', and you shouldn't >> need to set anything for the port. If you want to customize for your >> specific CPU, add the following to /etc/make.conf: >> >> CPUTYPE=7450 >> > > I got it from the error message above.  ;-) > > This is a vanilla install using the ISO CD image downloaded yesterday > and installed, followed by a portsnap fetch and portsnap extract. > I haven't made any edits to /etc/make.conf or changed any other > settings.  Expected it to work "out of the box" but for some reason it > doesn't. > > Am I correct in assuming that the 7447 came as a result of the kernel > reading the PVR at some point?  Or is this due to the gmp port's own > attempt to get the processor version in config.guess?  How can I confirm > which of 7447 or 7450 is correct? sysctl reports hw.model as "Motorola PowerPC 7447A" So I tried adding CPUTYPE=7447 to /etc/make.conf cd /usr/ports/math/gmp make distclean make install clean Same failure as above ("invalid configuration") -- charlie