From owner-freebsd-usb@freebsd.org Thu Dec 19 00:11:43 2019 Return-Path: Delivered-To: freebsd-usb@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 5CA111CA00A for ; Thu, 19 Dec 2019 00:11:43 +0000 (UTC) (envelope-from denverh@comcast.net) Received: from resqmta-po-11v.sys.comcast.net (resqmta-po-11v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:170]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 47dXNs53RGz3R10 for ; Thu, 19 Dec 2019 00:11:41 +0000 (UTC) (envelope-from denverh@comcast.net) Received: from resomta-po-06v.sys.comcast.net ([96.114.154.230]) by resqmta-po-11v.sys.comcast.net with ESMTP id hjPMixjWtlzyshjPniaDQX; Thu, 19 Dec 2019 00:11:39 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1576714299; bh=42stzaALvsOqKtwUjslHgpjjD49kdUSu3zEpS+E52is=; h=Received:Received:To:Reply-To:From:Subject:Message-ID:Date: MIME-Version:Content-Type; b=IC8l/RsZuTHNOwcVuFAX0fOj7Ka5KjrWnBqa1XrtUDDiUScRBg6GMRsJCRUxCHnbP Xzv88cvLetEqKu4f+yvckkSNweLxpG8w0vy9G0c+0caQuOHr3BS82uJUQx7H+iAHBS 4R14iyf633nrPuUxrMhSi9NaXC1Mb/dius91iOGjVjNhs2HXhIc0vEdayjUzTvIvCo QjN19bhT1AB2HQdrgMQxFaIvOv8HVTVGPugVAVu+l2mbB/fv3B98cDFO5baxMpU4/a fawHTn05Q55zWyLrnefOZ2uVmQrZiEEcu2vPn/sYblmrMM0krE15UM73+qAKF2Umpn bPOH1pECyBwjQ== Received: from dhbsd.dhull.home ([104.129.31.27]) by resomta-po-06v.sys.comcast.net with ESMTPA id hjPei4WGxdzx9hjPfiZsUJ; Thu, 19 Dec 2019 00:11:37 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedufedrvddutddgudekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucenucfjughrpefvrhfhuffkffgfgggtgfesthekredttdefjeenucfhrhhomhepffgvnhhvvghrucfjuhhllhcuoeguvghnvhgvrhhhsegtohhmtggrshhtrdhnvghtqeenucfkphepuddtgedruddvledrfedurddvjeenucfrrghrrghmpehhvghlohepughhsghsugdrughhuhhllhdrhhhomhgvpdhinhgvthepuddtgedruddvledrfedurddvjedpmhgrihhlfhhrohhmpeguvghnvhgvrhhhsegtohhmtggrshhtrdhnvghtpdhrtghpthhtohepfhhrvggvsghsugdquhhssgesfhhrvggvsghsugdrohhrghenucevlhhushhtvghrufhiiigvpedt X-Xfinity-VMeta: sc=0.00;st=legit To: freebsd-usb@freebsd.org Reply-To: denverh@comcast.net From: Denver Hull Subject: Timeouts during initial Mode Sense commands Message-ID: Date: Wed, 18 Dec 2019 18:11:30 -0600 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Rspamd-Queue-Id: 47dXNs53RGz3R10 X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=comcast.net header.s=20190202a header.b=IC8l/RsZ; dmarc=pass (policy=none) header.from=comcast.net; spf=pass (mx1.freebsd.org: domain of denverh@comcast.net designates 2001:558:fe16:19:96:114:154:170 as permitted sender) smtp.mailfrom=denverh@comcast.net X-Spamd-Result: default: False [-0.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[denverh@comcast.net]; R_SPF_ALLOW(-0.20)[+ip6:2001:558:fe16:19:96:114:154:160/123]; FREEMAIL_FROM(0.00)[comcast.net]; TO_DN_NONE(0.00)[]; REPLYTO_ADDR_EQ_FROM(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[comcast.net:+]; DMARC_POLICY_ALLOW(-0.50)[comcast.net,none]; HFILTER_HELO_5(3.00)[resqmta-po-11v.sys.comcast.net]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[0.7.1.0.4.5.1.0.4.1.1.0.6.9.0.0.9.1.0.0.6.1.e.f.8.5.5.0.1.0.0.2.list.dnswl.org : 127.0.5.1]; ASN(0.00)[asn:7922, ipnet:2001:558::/29, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[comcast.net.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[comcast.net]; R_DKIM_ALLOW(-0.20)[comcast.net:s=20190202a]; NEURAL_HAM_MEDIUM(-1.00)[-1.000,0]; FROM_HAS_DN(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[text/plain]; FREEMAIL_REPLYTO(0.00)[comcast.net]; IP_SCORE_FREEMAIL(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; IP_SCORE(0.00)[ipnet: 2001:558::/29(-0.41), asn: 7922(-0.42), country: US(-0.05)] X-BeenThere: freebsd-usb@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: FreeBSD support for USB List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 19 Dec 2019 00:11:43 -0000 Hello, I have several different microcontroller boards that are supposed to appear as storage devices when plugged in.  They work fine on Linux systems, but on FreeBSD 11.3 and 12.1 they don't show up at all. Here's what dmesg shows for one of them: ugen1.3: at usbus1 umodem0 on uhub1 umodem0: on usbus1 umodem0: data interface 1, has no CM over data, has no break umass3 on uhub1 umass3: on usbus1 umass3:  SCSI over Bulk-Only; quirks = 0x0000 umass3:5:3: Attached to scbus5 uaudio0 on uhub1 uaudio0: on usbus1 uaudio0: No playback. uaudio0: No recording. uaudio0: MIDI sequencer. uaudio0: No HID volume keys found. ums2 on uhub1 ums2: on usbus1 ums2: 16 buttons and [XYZ] coordinates ID=2 (da3:umass-sim3:3:0:0): got CAM status 0x44 (da3:umass-sim3:3:0:0): fatal error, failed to attach to device g_access(944): provider da3 has error 6 set g_access(944): provider da3 has error 6 set g_access(944): provider da3 has error 6 set g_access(944): provider da3 has error 6 set g_access(944): provider da3 has error 6 set There's a definite delay after the last ums message.  I used camcontrol debug in single user mode on a bare 12.1 system to get a little more information about what was happening.  It looks like the initial Inquiry and Test Unit Ready commands succeed, but the next Mode Sense command times out, as well as all subsequent commands. There are several seconds of inactivity between retries, and there's no sense data, so I'm assuming that indicates timeout. At this point I'm not sure how best to proceed to get these devices to work, so any help will be appreciated. Regards, Denver