From owner-freebsd-usb@freebsd.org Sat Dec 21 21:22:55 2019 Return-Path: Delivered-To: freebsd-usb@mailman.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mailman.nyi.freebsd.org (Postfix) with ESMTP id 3B0CC1DD2AB for ; Sat, 21 Dec 2019 21:22:55 +0000 (UTC) (envelope-from denverh@comcast.net) Received: from resqmta-po-01v.sys.comcast.net (resqmta-po-01v.sys.comcast.net [IPv6:2001:558:fe16:19:96:114:154:160]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 47gJVk1tWQz4fJk for ; Sat, 21 Dec 2019 21:22:54 +0000 (UTC) (envelope-from denverh@comcast.net) Received: from resomta-po-12v.sys.comcast.net ([96.114.154.236]) by resqmta-po-01v.sys.comcast.net with ESMTP id ilxMiZ4yDrEegimD6i2J0b; Sat, 21 Dec 2019 21:22:52 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1576963372; bh=WTnJGNlpwoQrdMpYPAXE/G3HPxzpSlNkdWKcwz9U3AQ=; h=Received:Received:Reply-To:Subject:To:From:Message-ID:Date: MIME-Version:Content-Type; b=UYptZ+t7P4FPk8ozIdEsa/CN2xQAZAof8FblYxIrIpW73fM0MxviaZstK1KBZlpIU IZWWFDxwTQwxmTPq5v5VFpUllPSlepanO65EfZ6OQJbe53EyEsM6BVym7XaxhQYwTh bMofSs9e9VneMhrD6MJo1HyMWM9tXE8L6ryJWtCyNgqJd4TxzWgO8qXXND776ZvS5r vRuMNY7i7VU8Me7Pzm0KeqssAK28tbRwAuQI+ZqJl9gTl//eGXJ5aw+OL3VpzJpYdY XNynw3OcNyDLii/99VEf3yBpdfWlP9BEiOzqUa0T5aEuK4WRa2GCnh3EFE0kDOPPA/ SkWfRUvZ5LYcg== Received: from dhbsd.dhull.home ([104.129.31.27]) by resomta-po-12v.sys.comcast.net with ESMTPA id imCviAP0JyNGJimCwizwtg; Sat, 21 Dec 2019 21:22:49 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedufedrvdduhedgudegiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurheprhfuvfhfhffkffgfgggjtgesmhdtreertdefjeenucfhrhhomhepffgvnhhvvghrucfjuhhllhcuoeguvghnvhgvrhhhsegtohhmtggrshhtrdhnvghtqeenucfkphepuddtgedruddvledrfedurddvjeenucfrrghrrghmpehhvghlohepughhsghsugdrughhuhhllhdrhhhomhgvpdhinhgvthepuddtgedruddvledrfedurddvjedpmhgrihhlfhhrohhmpeguvghnvhgvrhhhsegtohhmtggrshhtrdhnvghtpdhrtghpthhtohepfhhrvggvsghsugdquhhssgesfhhrvggvsghsugdrohhrghdprhgtphhtthhopehhphhssehsvghlrghskhihrdhorhhgnecuvehluhhsthgvrhfuihiivgeptd X-Xfinity-VMeta: sc=0.00;st=legit Reply-To: denverh@comcast.net Subject: Re: Timeouts during initial Mode Sense commands To: Hans Petter Selasky , freebsd-usb@freebsd.org References: <98b6599e-5027-48c9-4230-47bc0f087180@comcast.net> <079c989a-5d45-df1f-ed48-15cdd8c8f194@comcast.net> From: Denver Hull Message-ID: Date: Sat, 21 Dec 2019 15:22:41 -0600 User-Agent: Mozilla/5.0 (X11; FreeBSD amd64; rv:52.0) Gecko/20100101 Firefox/52.0 SeaMonkey/2.49.4 MIME-Version: 1.0 In-Reply-To: X-Rspamd-Queue-Id: 47gJVk1tWQz4fJk X-Spamd-Bar: / Authentication-Results: mx1.freebsd.org; dkim=pass header.d=comcast.net header.s=20190202a header.b=UYptZ+t7; dmarc=pass (policy=none) header.from=comcast.net; spf=pass (mx1.freebsd.org: domain of denverh@comcast.net designates 2001:558:fe16:19:96:114:154:160 as permitted sender) smtp.mailfrom=denverh@comcast.net X-Spamd-Result: default: False [-0.10 / 15.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; HAS_REPLYTO(0.00)[denverh@comcast.net]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2001:558:fe16:19:96:114:154:160/123]; FREEMAIL_FROM(0.00)[comcast.net]; HAS_ATTACHMENT(0.00)[]; REPLYTO_ADDR_EQ_FROM(0.00)[]; RCVD_COUNT_THREE(0.00)[3]; DKIM_TRACE(0.00)[comcast.net:+]; RCPT_COUNT_TWO(0.00)[2]; DMARC_POLICY_ALLOW(-0.50)[comcast.net,none]; HFILTER_HELO_5(3.00)[resqmta-po-01v.sys.comcast.net]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~,3:~]; RCVD_TLS_LAST(0.00)[]; RCVD_IN_DNSWL_LOW(-0.10)[0.6.1.0.4.5.1.0.4.1.1.0.6.9.0.0.9.1.0.0.6.1.e.f.8.5.5.0.1.0.0.2.list.dnswl.org : 127.0.5.1]; ASN(0.00)[asn:7922, ipnet:2001:558::/29, country:US]; MID_RHS_MATCH_FROM(0.00)[]; DWL_DNSWL_NONE(0.00)[comcast.net.dwl.dnswl.org : 127.0.5.0]; ARC_NA(0.00)[]; FREEMAIL_ENVFROM(0.00)[comcast.net]; R_DKIM_ALLOW(-0.20)[comcast.net:s=20190202a]; NEURAL_HAM_MEDIUM(-1.00)[-0.998,0]; FROM_HAS_DN(0.00)[]; NEURAL_HAM_LONG(-1.00)[-1.000,0]; MIME_GOOD(-0.10)[multipart/mixed,text/plain]; FREEMAIL_REPLYTO(0.00)[comcast.net]; IP_SCORE_FREEMAIL(0.00)[]; TO_MATCH_ENVRCPT_SOME(0.00)[]; IP_SCORE(0.00)[ipnet: 2001:558::/29(-0.38), asn: 7922(-0.47), country: US(-0.05)] Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 8bit X-Content-Filtered-By: Mailman/MimeDel 2.1.29 X-BeenThere: freebsd-usb@freebsd.org X-Mailman-Version: 2.1.29 Precedence: list List-Id: FreeBSD support for USB List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Sat, 21 Dec 2019 21:22:55 -0000 Hans Petter Selasky wrote: > On 2019-12-21 00:46, Denver Hull wrote: >> How hard would it be to change things to use 0x1a instead of 0x5a >> temporarily? > > There is a tool called usbtest in /usr/src/tools/tools/usbtest which > can exercise the SCSI commands for mass storage devices. > > --HPS > Very nice, thanks.  My tools require an actual SCSI device node so they aren't much help when there isn't one.  The usbtest host mode tests seem to work ok with the device in question, but not the mass storage tests: >30 Attaching to: ugen2.12: at usbus2 @ iface 2 Resetting device ... Testing SCSI commands ... ERROR: CBW reception: 4 ERROR: CBW reception: 4 ERROR: CBW reception: 4 Cannot read disk capacity (0 / 4) ERROR: CBW reception: 4 Cannot read disk capacity (1 / 4) ERROR: CBW reception: 4 Cannot read disk capacity (2 / 4) ERROR: CBW reception: 4 Cannot read disk capacity (3 / 4) [0.2.4] - Mass Storage Test Parameters: However, I did dust off one of my old tools and tried using it to send both 6 byte and 10 byte mode sense commands from Linux.  The 6 byte commands always worked, but not the 10.  They resulted in lots of "connection reset by peer" and "broken pipe" status messages, along with port reset commands.  I saved wireshark/usbmon traces from both, and have attached them.  I think they're small enough to get through this time. If the problem with these devices really is that they can't respond properly to 10 byte mode sense commands (and that's how it's beginning to look), then what? Thanks, Denver