From nobody Sat Dec 16 12:58:30 2023 X-Original-To: freebsd-questions@mlmmj.nyi.freebsd.org Received: from mx1.freebsd.org (mx1.freebsd.org [IPv6:2610:1c1:1:606c::19:1]) by mlmmj.nyi.freebsd.org (Postfix) with ESMTP id 4SsmNq1WDXz53tk6 for ; Sat, 16 Dec 2023 12:58:35 +0000 (UTC) (envelope-from roger.marsh@btinternet.com) Received: from sa-prd-fep-041.btinternet.com (mailomta21-sa.btinternet.com [213.120.69.27]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by mx1.freebsd.org (Postfix) with ESMTPS id 4SsmNp1rS7z4Vvl for ; Sat, 16 Dec 2023 12:58:34 +0000 (UTC) (envelope-from roger.marsh@btinternet.com) Authentication-Results: mx1.freebsd.org; dkim=pass header.d=btinternet.com header.s=btmx201904 header.b=K1XQphJD; spf=pass (mx1.freebsd.org: domain of roger.marsh@btinternet.com designates 213.120.69.27 as permitted sender) smtp.mailfrom=roger.marsh@btinternet.com; dmarc=pass (policy=reject) header.from=btinternet.com Received: from sa-prd-rgout-003.btmx-prd.synchronoss.net ([10.2.38.6]) by sa-prd-fep-041.btinternet.com with ESMTP id <20231216125832.PKVK7232.sa-prd-fep-041.btinternet.com@sa-prd-rgout-003.btmx-prd.synchronoss.net> for ; Sat, 16 Dec 2023 12:58:32 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=btinternet.com; s=btmx201904; t=1702731512; bh=gvFIeIsghxIxL6I7M/3dd19BbagPa5nhIJSOk9zNb2M=; h=Date:From:To:Subject:Message-ID:In-Reply-To:References:X-Mailer:MIME-Version; b=K1XQphJD5qy1U0Eai/YvpN406vUb+ukNM7S6RK3iTcG5VcKBE+5rpFjHxpsf9GAq6jrZ6YFr26a55ymWeHJdWMoWvgWEwFZeK++LPChxPuv1dkIe5MXPEuvRwvJWLPVr1+bqRT/1Gujbb/OA6htKdGGQ3eakwDP6Jyu4v3gToC0C9MhCdB6DPfry2UwpEJwX0NvU7MB8FBmCunMz95SGN+tFflc+SYAx8syHItUP8XqNn9lC7ROjsVsRFDuQTxIK2N0rVhFDQ2eeOXZAcfw4W9XH68krQAuElvnPo555WV4t6Af8b33HMmEKmYQcygJOst67ptaWo/nw7DR3z+OzQQ== X-SNCR-Rigid: 6567CD7102A60D0F X-Originating-IP: [80.229.151.92] X-OWM-Source-IP: 80.229.151.92 X-OWM-Env-Sender: roger.marsh@btinternet.com X-VadeSecure-score: verdict=clean score=0/300, class=clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedvkedrvddtgedggeejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuueftkffvkffujffvgffngfevqffopdfqfgfvnecuuegrihhlohhuthemuceftddunecunecujfgurhepfffhvffukfgjfhfogggtgfesthejredtredtvdenucfhrhhomheptfhoghgvrhcuofgrrhhshhcuoehrohhgvghrrdhmrghrshhhsegsthhinhhtvghrnhgvthdrtghomheqnecuggftrfgrthhtvghrnhepfefgieetveektdegleevudeuueeltdfgtdelgfekhfffheejjedvffduuddtfeegnecukfhppeektddrvddvledrudehuddrledvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepohhpvghnuggvvhdrhhhomhgvpdhinhgvthepkedtrddvvdelrdduhedurdelvddpmhgrihhlfhhrohhmpehrohhgvghrrdhmrghrshhhsegsthhinhhtvghrnhgvthdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehfrhgvvggsshguqdhquhgvshhtihhonhhssefhrhgvvgeuufffrdhorhhgpdhrvghvkffrpehrmhhsfigthhdrphhluhhsrdgtohhmpdgruhhthhgpuhhsvghrpehrohhgvghrrdhmrghrshhhsegsthhinhhtvghrnhgvthdrtghomhdpghgvohfkrfepifeupdfovfetjfhoshhtpehsrgdqphhrugdqrhhgohhuthdqtddtfe X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean X-SNCR-hdrdom: btinternet.com Received: from opendev.home (80.229.151.92) by sa-prd-rgout-003.btmx-prd.synchronoss.net (authenticated as roger.marsh) id 6567CD7102A60D0F for freebsd-questions@FreeBSD.org; Sat, 16 Dec 2023 12:58:32 +0000 Date: Sat, 16 Dec 2023 12:58:30 +0000 From: Roger Marsh To: freebsd-questions@FreeBSD.org Subject: Re: Problem using vi in freebsd-update from 13.2 to 14.0 Message-ID: <20231216125830.4f91c9f9@opendev.home> In-Reply-To: References: <20231215152053.74cf9bf1@opendev.home> X-Mailer: Claws Mail 4.1.1 (GTK 3.24.38; x86_64-unknown-openbsd7.4) List-Id: User questions List-Archive: https://lists.freebsd.org/archives/freebsd-questions List-Help: List-Post: List-Subscribe: List-Unsubscribe: Sender: owner-freebsd-questions@freebsd.org X-BeenThere: freebsd-questions@freebsd.org MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII Content-Transfer-Encoding: 7bit X-Spamd-Result: default: False [-2.62 / 15.00]; NEURAL_HAM_LONG(-1.00)[-1.000]; NEURAL_HAM_MEDIUM(-1.00)[-1.000]; NEURAL_SPAM_SHORT(0.78)[0.783]; DMARC_POLICY_ALLOW(-0.50)[btinternet.com,reject]; RWL_MAILSPIKE_EXCELLENT(-0.40)[213.120.69.27:from]; R_SPF_ALLOW(-0.20)[+ip4:213.120.69.0/24]; R_DKIM_ALLOW(-0.20)[btinternet.com:s=btmx201904]; MIME_GOOD(-0.10)[text/plain]; RCPT_COUNT_ONE(0.00)[1]; FROM_HAS_DN(0.00)[]; PREVIOUSLY_DELIVERED(0.00)[freebsd-questions@freebsd.org]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCVD_IN_DNSWL_NONE(0.00)[213.120.69.27:from]; HAS_XOIP(0.00)[]; DWL_DNSWL_NONE(0.00)[btinternet.com:dkim]; MLMMJ_DEST(0.00)[freebsd-questions@FreeBSD.org]; DKIM_TRACE(0.00)[btinternet.com:+]; TO_DN_NONE(0.00)[]; FREEMAIL_FROM(0.00)[btinternet.com]; ARC_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:2856, ipnet:213.120.0.0/14, country:GB]; FREEMAIL_ENVFROM(0.00)[btinternet.com]; RCVD_COUNT_TWO(0.00)[2] X-Rspamd-Queue-Id: 4SsmNp1rS7z4Vvl X-Spamd-Bar: -- On Fri, 15 Dec 2023 20:53:58 -0500 Karl Vogel wrote: > On Fri, Dec 15, 2023 at 10:21:11AM -0500, Roger Marsh wrote: > > > When doing the merges presented by freebsd-update I have somehow got into > > 'ex input mode' and hitting repeatedly does not get me back to > > command mode. > > That drives me nuts. > > > So, how do I get out of 'ex input mode' in my case? Or can I just kill > > the session running freebsd-update and restart freebsd-update assuming > > it will pick from where it had got to? > > Something's hosed your terminal so that pressing escape doesn't send > the actual escape character (octal 33). Two things I'd try: > > 1. Press Control-V Control-Left-Bracket ([) which should send the > correct character and let you escape. This did not work for me. > > 2. If that doesn't work, can you fire up a separate ssh session and > kill just the running VI? Your terminal will really be hosed now, > so when you get back to your prompt, type "stty sane". Killing vi caused the freebsd-update session to start another vi on the file being edited. Typing "stty sane" in the separate ssh session was not necessary for me and I did not do it: anyway I got all the edits done and got started on the "Does this look reasonable" prompts for the merges. > > I'm not sure what interrupting or restarting freebsd-update will do. > I thought I had made a mistake on one of the edits and answered 'n' to the prompt, expecting to be given a vi session to do the edit again. Instead the freebsd-update job was terminated and I had to restart it anyway. All went well: just about to install the downloaded upgrades by running "/usr/sbin/freebsd-update install". I will probably post another question about what happened after answering 'n' to the "Does this look reasonable" prompt. > -- > Karl Vogel I don't speak for anyone but myself > > Keep your booger hook off the bang button. > --Firearms safety instructor on Reddit, 30 Nov 2023 > Thanks, Roger